data_5M5A # _entry.id 5M5A # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.307 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5M5A WWPDB D_1200001943 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5M5A _pdbx_database_status.recvd_initial_deposition_date 2016-10-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Canevari, G.' 1 'Re Depaolini, S.' 2 'Casale, E.' 3 'Felder, E.' 4 'Kuster, B.' 5 'Heinzlmeir, S.' 6 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Science _citation.journal_id_ASTM SCIEAS _citation.journal_id_CSD 0038 _citation.journal_id_ISSN 1095-9203 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 358 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'The target landscape of clinical kinase drugs.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1126/science.aan4368 _citation.pdbx_database_id_PubMed 29191878 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Klaeger, S.' 1 ? primary 'Heinzlmeir, S.' 2 ? primary 'Wilhelm, M.' 3 ? primary 'Polzer, H.' 4 ? primary 'Vick, B.' 5 ? primary 'Koenig, P.A.' 6 ? primary 'Reinecke, M.' 7 ? primary 'Ruprecht, B.' 8 ? primary 'Petzoldt, S.' 9 ? primary 'Meng, C.' 10 ? primary 'Zecha, J.' 11 ? primary 'Reiter, K.' 12 ? primary 'Qiao, H.' 13 ? primary 'Helm, D.' 14 ? primary 'Koch, H.' 15 ? primary 'Schoof, M.' 16 ? primary 'Canevari, G.' 17 ? primary 'Casale, E.' 18 ? primary 'Depaolini, S.R.' 19 ? primary 'Feuchtinger, A.' 20 ? primary 'Wu, Z.' 21 ? primary 'Schmidt, T.' 22 ? primary 'Rueckert, L.' 23 ? primary 'Becker, W.' 24 ? primary 'Huenges, J.' 25 ? primary 'Garz, A.K.' 26 ? primary 'Gohlke, B.O.' 27 ? primary 'Zolg, D.P.' 28 ? primary 'Kayser, G.' 29 ? primary 'Vooder, T.' 30 ? primary 'Preissner, R.' 31 ? primary 'Hahne, H.' 32 ? primary 'Tonisson, N.' 33 ? primary 'Kramer, K.' 34 ? primary 'Gotze, K.' 35 ? primary 'Bassermann, F.' 36 ? primary 'Schlegl, J.' 37 ? primary 'Ehrlich, H.C.' 38 ? primary 'Aiche, S.' 39 ? primary 'Walch, A.' 40 ? primary 'Greif, P.A.' 41 ? primary 'Schneider, S.' 42 ? primary 'Felder, E.R.' 43 ? primary 'Ruland, J.' 44 ? primary 'Medard, G.' 45 ? primary 'Jeremias, I.' 46 ? primary 'Spiekermann, K.' 47 ? primary 'Kuster, B.' 48 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5M5A _cell.details ? _cell.formula_units_Z ? _cell.length_a 63.282 _cell.length_a_esd ? _cell.length_b 91.206 _cell.length_b_esd ? _cell.length_c 59.649 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5M5A _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Maternal embryonic leucine zipper kinase' 40220.539 1 2.7.11.1,2.7.10.2 ? ? ? 2 non-polymer syn 'SODIUM ION' 22.990 2 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 4 non-polymer syn K-252A 467.473 1 ? ? ? ? 5 water nat water 18.015 106 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'hMELK,Protein kinase Eg3,pEg3 kinase,Protein kinase PK38,hPK38,Tyrosine-protein kinase MELK' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETA NKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKPKG NKDYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILL LQQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLL LLAKKARGKPVRLRLSSFSCGHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;GPKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETA NKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKPKG NKDYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILL LQQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLL LLAKKARGKPVRLRLSSFSCGHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LYS n 1 4 ASP n 1 5 TYR n 1 6 ASP n 1 7 GLU n 1 8 LEU n 1 9 LEU n 1 10 LYS n 1 11 TYR n 1 12 TYR n 1 13 GLU n 1 14 LEU n 1 15 HIS n 1 16 GLU n 1 17 THR n 1 18 ILE n 1 19 GLY n 1 20 THR n 1 21 GLY n 1 22 GLY n 1 23 PHE n 1 24 ALA n 1 25 LYS n 1 26 VAL n 1 27 LYS n 1 28 LEU n 1 29 ALA n 1 30 CYS n 1 31 HIS n 1 32 ILE n 1 33 LEU n 1 34 THR n 1 35 GLY n 1 36 GLU n 1 37 MET n 1 38 VAL n 1 39 ALA n 1 40 ILE n 1 41 LYS n 1 42 ILE n 1 43 MET n 1 44 ASP n 1 45 LYS n 1 46 ASN n 1 47 THR n 1 48 LEU n 1 49 GLY n 1 50 SER n 1 51 ASP n 1 52 LEU n 1 53 PRO n 1 54 ARG n 1 55 ILE n 1 56 LYS n 1 57 THR n 1 58 GLU n 1 59 ILE n 1 60 GLU n 1 61 ALA n 1 62 LEU n 1 63 LYS n 1 64 ASN n 1 65 LEU n 1 66 ARG n 1 67 HIS n 1 68 GLN n 1 69 HIS n 1 70 ILE n 1 71 CYS n 1 72 GLN n 1 73 LEU n 1 74 TYR n 1 75 HIS n 1 76 VAL n 1 77 LEU n 1 78 GLU n 1 79 THR n 1 80 ALA n 1 81 ASN n 1 82 LYS n 1 83 ILE n 1 84 PHE n 1 85 MET n 1 86 VAL n 1 87 LEU n 1 88 GLU n 1 89 TYR n 1 90 CYS n 1 91 PRO n 1 92 GLY n 1 93 GLY n 1 94 GLU n 1 95 LEU n 1 96 PHE n 1 97 ASP n 1 98 TYR n 1 99 ILE n 1 100 ILE n 1 101 SER n 1 102 GLN n 1 103 ASP n 1 104 ARG n 1 105 LEU n 1 106 SER n 1 107 GLU n 1 108 GLU n 1 109 GLU n 1 110 THR n 1 111 ARG n 1 112 VAL n 1 113 VAL n 1 114 PHE n 1 115 ARG n 1 116 GLN n 1 117 ILE n 1 118 VAL n 1 119 SER n 1 120 ALA n 1 121 VAL n 1 122 ALA n 1 123 TYR n 1 124 VAL n 1 125 HIS n 1 126 SER n 1 127 GLN n 1 128 GLY n 1 129 TYR n 1 130 ALA n 1 131 HIS n 1 132 ARG n 1 133 ASP n 1 134 LEU n 1 135 LYS n 1 136 PRO n 1 137 GLU n 1 138 ASN n 1 139 LEU n 1 140 LEU n 1 141 PHE n 1 142 ASP n 1 143 GLU n 1 144 TYR n 1 145 HIS n 1 146 LYS n 1 147 LEU n 1 148 LYS n 1 149 LEU n 1 150 ILE n 1 151 ASP n 1 152 PHE n 1 153 GLY n 1 154 LEU n 1 155 CYS n 1 156 ALA n 1 157 LYS n 1 158 PRO n 1 159 LYS n 1 160 GLY n 1 161 ASN n 1 162 LYS n 1 163 ASP n 1 164 TYR n 1 165 HIS n 1 166 LEU n 1 167 GLN n 1 168 THR n 1 169 CYS n 1 170 CYS n 1 171 GLY n 1 172 SER n 1 173 LEU n 1 174 ALA n 1 175 TYR n 1 176 ALA n 1 177 ALA n 1 178 PRO n 1 179 GLU n 1 180 LEU n 1 181 ILE n 1 182 GLN n 1 183 GLY n 1 184 LYS n 1 185 SER n 1 186 TYR n 1 187 LEU n 1 188 GLY n 1 189 SER n 1 190 GLU n 1 191 ALA n 1 192 ASP n 1 193 VAL n 1 194 TRP n 1 195 SER n 1 196 MET n 1 197 GLY n 1 198 ILE n 1 199 LEU n 1 200 LEU n 1 201 TYR n 1 202 VAL n 1 203 LEU n 1 204 MET n 1 205 CYS n 1 206 GLY n 1 207 PHE n 1 208 LEU n 1 209 PRO n 1 210 PHE n 1 211 ASP n 1 212 ASP n 1 213 ASP n 1 214 ASN n 1 215 VAL n 1 216 MET n 1 217 ALA n 1 218 LEU n 1 219 TYR n 1 220 LYS n 1 221 LYS n 1 222 ILE n 1 223 MET n 1 224 ARG n 1 225 GLY n 1 226 LYS n 1 227 TYR n 1 228 ASP n 1 229 VAL n 1 230 PRO n 1 231 LYS n 1 232 TRP n 1 233 LEU n 1 234 SER n 1 235 PRO n 1 236 SER n 1 237 SER n 1 238 ILE n 1 239 LEU n 1 240 LEU n 1 241 LEU n 1 242 GLN n 1 243 GLN n 1 244 MET n 1 245 LEU n 1 246 GLN n 1 247 VAL n 1 248 ASP n 1 249 PRO n 1 250 LYS n 1 251 LYS n 1 252 ARG n 1 253 ILE n 1 254 SER n 1 255 MET n 1 256 LYS n 1 257 ASN n 1 258 LEU n 1 259 LEU n 1 260 ASN n 1 261 HIS n 1 262 PRO n 1 263 TRP n 1 264 ILE n 1 265 MET n 1 266 GLN n 1 267 ASP n 1 268 TYR n 1 269 ASN n 1 270 TYR n 1 271 PRO n 1 272 VAL n 1 273 GLU n 1 274 TRP n 1 275 GLN n 1 276 SER n 1 277 LYS n 1 278 ASN n 1 279 PRO n 1 280 PHE n 1 281 ILE n 1 282 HIS n 1 283 LEU n 1 284 ASP n 1 285 ASP n 1 286 ASP n 1 287 CYS n 1 288 VAL n 1 289 THR n 1 290 GLU n 1 291 LEU n 1 292 SER n 1 293 VAL n 1 294 HIS n 1 295 HIS n 1 296 ARG n 1 297 ASN n 1 298 ASN n 1 299 ARG n 1 300 GLN n 1 301 THR n 1 302 MET n 1 303 GLU n 1 304 ASP n 1 305 LEU n 1 306 ILE n 1 307 SER n 1 308 LEU n 1 309 TRP n 1 310 GLN n 1 311 TYR n 1 312 ASP n 1 313 HIS n 1 314 LEU n 1 315 THR n 1 316 ALA n 1 317 THR n 1 318 TYR n 1 319 LEU n 1 320 LEU n 1 321 LEU n 1 322 LEU n 1 323 ALA n 1 324 LYS n 1 325 LYS n 1 326 ALA n 1 327 ARG n 1 328 GLY n 1 329 LYS n 1 330 PRO n 1 331 VAL n 1 332 ARG n 1 333 LEU n 1 334 ARG n 1 335 LEU n 1 336 SER n 1 337 SER n 1 338 PHE n 1 339 SER n 1 340 CYS n 1 341 GLY n 1 342 HIS n 1 343 HIS n 1 344 HIS n 1 345 HIS n 1 346 HIS n 1 347 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 347 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MELK, KIAA0175' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name 'fall armyworm' _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line Sf21 _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type BACULOVIRUS _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MELK_HUMAN _struct_ref.pdbx_db_accession Q14680 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETANK IFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKPKGNK DYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILLLQ QMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLLL AKKARGKPVRLRLSSFSCG ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5M5A _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 341 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q14680 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 340 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 340 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5M5A GLY A 1 ? UNP Q14680 ? ? 'expression tag' 0 1 1 5M5A PRO A 2 ? UNP Q14680 ? ? 'expression tag' 1 2 1 5M5A HIS A 342 ? UNP Q14680 ? ? 'expression tag' 341 3 1 5M5A HIS A 343 ? UNP Q14680 ? ? 'expression tag' 342 4 1 5M5A HIS A 344 ? UNP Q14680 ? ? 'expression tag' 343 5 1 5M5A HIS A 345 ? UNP Q14680 ? ? 'expression tag' 344 6 1 5M5A HIS A 346 ? UNP Q14680 ? ? 'expression tag' 345 7 1 5M5A HIS A 347 ? UNP Q14680 ? ? 'expression tag' 346 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 KSA non-polymer . K-252A ? 'C27 H21 N3 O5' 467.473 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5M5A _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.35 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.64 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '10-20% PEG 3350 or PEG 4000, 0.1M BIS TRIS pH 6.5, 0.6 M NaCl' _exptl_crystal_grow.pdbx_pH_range 6.5 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details 'Toroidal mirror' _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-10-04 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.976254 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.976254 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5M5A _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.9 _reflns.d_resolution_low 49.93 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 22643 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I 2 _reflns.percent_possible_obs 94.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.5 _reflns.pdbx_Rmerge_I_obs 0.032 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 21.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.9 _reflns_shell.d_res_low 2.0 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 5.6 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 84.2 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.224 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 4.6 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.974 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.25 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 3.14 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] -3.40 _refine.B_iso_max ? _refine.B_iso_mean 43.972 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.960 _refine.correlation_coeff_Fo_to_Fc_free 0.952 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5M5A _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.90 _refine.ls_d_res_low 49.93 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 19461 _refine.ls_number_reflns_R_free 1012 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 73.42 _refine.ls_percent_reflns_R_free 4.9 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.18672 _refine.ls_R_factor_R_free 0.21366 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.18525 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'in house MELK structure' _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.224 _refine.pdbx_overall_ESU_R_Free 0.171 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 2572 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 38 _refine_hist.number_atoms_solvent 106 _refine_hist.number_atoms_total 2716 _refine_hist.d_res_high 1.90 _refine_hist.d_res_low 49.93 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.012 0.019 2690 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.000 0.020 2595 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.855 1.991 3653 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 3.565 3.000 5980 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.953 5.000 318 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 36.184 24.309 123 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 14.088 15.000 493 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 16.815 15.000 13 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.081 0.200 400 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.020 2951 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.010 0.020 607 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 2.920 4.100 1263 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.917 4.096 1262 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 4.330 6.128 1575 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 4.330 6.133 1576 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 3.419 4.512 1427 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 3.418 4.513 1428 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 5.425 6.584 2076 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 7.281 46.561 3307 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 7.283 46.546 3306 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.900 _refine_ls_shell.d_res_low 1.949 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 21 _refine_ls_shell.number_reflns_R_work 636 _refine_ls_shell.percent_reflns_obs 32.70 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.211 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.171 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5M5A _struct.title 'Crystal structure of MELK in complex with an inhibitor' _struct.pdbx_descriptor 'Maternal embryonic leucine zipper kinase (E.C.2.7.11.1,2.7.10.2)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5M5A _struct_keywords.text 'kinase, inhibitor, complex, transferase' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 3 ? LYS A 10 ? LYS A 2 LYS A 9 1 ? 8 HELX_P HELX_P2 AA2 ASP A 51 ? ASN A 64 ? ASP A 50 ASN A 63 1 ? 14 HELX_P HELX_P3 AA3 LEU A 95 ? ASP A 103 ? LEU A 94 ASP A 102 1 ? 9 HELX_P HELX_P4 AA4 SER A 106 ? GLN A 127 ? SER A 105 GLN A 126 1 ? 22 HELX_P HELX_P5 AA5 LYS A 135 ? GLU A 137 ? LYS A 134 GLU A 136 5 ? 3 HELX_P HELX_P6 AA6 SER A 172 ? ALA A 176 ? SER A 171 ALA A 175 5 ? 5 HELX_P HELX_P7 AA7 ALA A 177 ? GLN A 182 ? ALA A 176 GLN A 181 1 ? 6 HELX_P HELX_P8 AA8 GLY A 188 ? GLY A 206 ? GLY A 187 GLY A 205 1 ? 19 HELX_P HELX_P9 AA9 ASN A 214 ? GLY A 225 ? ASN A 213 GLY A 224 1 ? 12 HELX_P HELX_P10 AB1 SER A 234 ? LEU A 245 ? SER A 233 LEU A 244 1 ? 12 HELX_P HELX_P11 AB2 SER A 254 ? ASN A 260 ? SER A 253 ASN A 259 1 ? 7 HELX_P HELX_P12 AB3 HIS A 261 ? GLN A 266 ? HIS A 260 GLN A 265 1 ? 6 HELX_P HELX_P13 AB4 ASP A 284 ? ARG A 296 ? ASP A 283 ARG A 295 1 ? 13 HELX_P HELX_P14 AB5 ASN A 298 ? SER A 307 ? ASN A 297 SER A 306 1 ? 10 HELX_P HELX_P15 AB6 ASP A 312 ? ARG A 327 ? ASP A 311 ARG A 326 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id metalc1 _struct_conn.conn_type_id metalc _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id GLN _struct_conn.ptnr1_label_seq_id 182 _struct_conn.ptnr1_label_atom_id OE1 _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id C _struct_conn.ptnr2_label_comp_id NA _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id NA _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id GLN _struct_conn.ptnr1_auth_seq_id 181 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id NA _struct_conn.ptnr2_auth_seq_id 402 _struct_conn.ptnr2_symmetry 4_573 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 3.146 _struct_conn.pdbx_value_order ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 12 ? THR A 20 ? TYR A 11 THR A 19 AA1 2 LYS A 25 ? HIS A 31 ? LYS A 24 HIS A 30 AA1 3 MET A 37 ? ASP A 44 ? MET A 36 ASP A 43 AA1 4 LYS A 82 ? GLU A 88 ? LYS A 81 GLU A 87 AA1 5 LEU A 73 ? GLU A 78 ? LEU A 72 GLU A 77 AA2 1 GLY A 93 ? GLU A 94 ? GLY A 92 GLU A 93 AA2 2 LEU A 139 ? PHE A 141 ? LEU A 138 PHE A 140 AA2 3 LEU A 147 ? LEU A 149 ? LEU A 146 LEU A 148 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N HIS A 15 ? N HIS A 14 O LEU A 28 ? O LEU A 27 AA1 2 3 N ALA A 29 ? N ALA A 28 O VAL A 38 ? O VAL A 37 AA1 3 4 N ALA A 39 ? N ALA A 38 O LEU A 87 ? O LEU A 86 AA1 4 5 O VAL A 86 ? O VAL A 85 N TYR A 74 ? N TYR A 73 AA2 1 2 N GLY A 93 ? N GLY A 92 O PHE A 141 ? O PHE A 140 AA2 2 3 N LEU A 140 ? N LEU A 139 O LYS A 148 ? O LYS A 147 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A NA 402 ? 4 'binding site for residue NA A 402' AC2 Software A CL 403 ? 2 'binding site for residue CL A 403' AC3 Software A KSA 404 ? 16 'binding site for residue KSA A 404' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 GLN A 182 ? GLN A 181 . ? 4_473 ? 2 AC1 4 GLU A 273 ? GLU A 272 . ? 1_555 ? 3 AC1 4 TRP A 274 ? TRP A 273 . ? 1_555 ? 4 AC1 4 GLN A 275 ? GLN A 274 . ? 1_555 ? 5 AC2 2 ARG A 115 ? ARG A 114 . ? 1_555 ? 6 AC2 2 GLU A 273 ? GLU A 272 . ? 1_555 ? 7 AC3 16 ILE A 18 ? ILE A 17 . ? 1_555 ? 8 AC3 16 GLY A 19 ? GLY A 18 . ? 1_555 ? 9 AC3 16 THR A 20 ? THR A 19 . ? 1_555 ? 10 AC3 16 GLY A 21 ? GLY A 20 . ? 1_555 ? 11 AC3 16 VAL A 26 ? VAL A 25 . ? 1_555 ? 12 AC3 16 ALA A 39 ? ALA A 38 . ? 1_555 ? 13 AC3 16 LYS A 41 ? LYS A 40 . ? 1_555 ? 14 AC3 16 GLU A 88 ? GLU A 87 . ? 1_555 ? 15 AC3 16 TYR A 89 ? TYR A 88 . ? 1_555 ? 16 AC3 16 CYS A 90 ? CYS A 89 . ? 1_555 ? 17 AC3 16 GLU A 94 ? GLU A 93 . ? 1_555 ? 18 AC3 16 GLU A 137 ? GLU A 136 . ? 1_555 ? 19 AC3 16 ASN A 138 ? ASN A 137 . ? 1_555 ? 20 AC3 16 LEU A 140 ? LEU A 139 . ? 1_555 ? 21 AC3 16 ILE A 150 ? ILE A 149 . ? 1_555 ? 22 AC3 16 HOH F . ? HOH A 515 . ? 1_555 ? # _atom_sites.entry_id 5M5A _atom_sites.fract_transf_matrix[1][1] 0.015802 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010964 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016765 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N NA O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 ? ? ? A . n A 1 2 PRO 2 1 ? ? ? A . n A 1 3 LYS 3 2 2 LYS LYS A . n A 1 4 ASP 4 3 3 ASP ASP A . n A 1 5 TYR 5 4 4 TYR TYR A . n A 1 6 ASP 6 5 5 ASP ASP A . n A 1 7 GLU 7 6 6 GLU GLU A . n A 1 8 LEU 8 7 7 LEU LEU A . n A 1 9 LEU 9 8 8 LEU LEU A . n A 1 10 LYS 10 9 9 LYS LYS A . n A 1 11 TYR 11 10 10 TYR TYR A . n A 1 12 TYR 12 11 11 TYR TYR A . n A 1 13 GLU 13 12 12 GLU GLU A . n A 1 14 LEU 14 13 13 LEU LEU A . n A 1 15 HIS 15 14 14 HIS HIS A . n A 1 16 GLU 16 15 15 GLU GLU A . n A 1 17 THR 17 16 16 THR THR A . n A 1 18 ILE 18 17 17 ILE ILE A . n A 1 19 GLY 19 18 18 GLY GLY A . n A 1 20 THR 20 19 19 THR THR A . n A 1 21 GLY 21 20 20 GLY GLY A . n A 1 22 GLY 22 21 21 GLY GLY A . n A 1 23 PHE 23 22 22 PHE PHE A . n A 1 24 ALA 24 23 23 ALA ALA A . n A 1 25 LYS 25 24 24 LYS LYS A . n A 1 26 VAL 26 25 25 VAL VAL A . n A 1 27 LYS 27 26 26 LYS LYS A . n A 1 28 LEU 28 27 27 LEU LEU A . n A 1 29 ALA 29 28 28 ALA ALA A . n A 1 30 CYS 30 29 29 CYS CYS A . n A 1 31 HIS 31 30 30 HIS HIS A . n A 1 32 ILE 32 31 31 ILE ILE A . n A 1 33 LEU 33 32 32 LEU LEU A . n A 1 34 THR 34 33 33 THR THR A . n A 1 35 GLY 35 34 34 GLY GLY A . n A 1 36 GLU 36 35 35 GLU GLU A . n A 1 37 MET 37 36 36 MET MET A . n A 1 38 VAL 38 37 37 VAL VAL A . n A 1 39 ALA 39 38 38 ALA ALA A . n A 1 40 ILE 40 39 39 ILE ILE A . n A 1 41 LYS 41 40 40 LYS LYS A . n A 1 42 ILE 42 41 41 ILE ILE A . n A 1 43 MET 43 42 42 MET MET A . n A 1 44 ASP 44 43 43 ASP ASP A . n A 1 45 LYS 45 44 44 LYS LYS A . n A 1 46 ASN 46 45 45 ASN ASN A . n A 1 47 THR 47 46 46 THR THR A . n A 1 48 LEU 48 47 47 LEU LEU A . n A 1 49 GLY 49 48 48 GLY GLY A . n A 1 50 SER 50 49 49 SER SER A . n A 1 51 ASP 51 50 50 ASP ASP A . n A 1 52 LEU 52 51 51 LEU LEU A . n A 1 53 PRO 53 52 52 PRO PRO A . n A 1 54 ARG 54 53 53 ARG ARG A . n A 1 55 ILE 55 54 54 ILE ILE A . n A 1 56 LYS 56 55 55 LYS LYS A . n A 1 57 THR 57 56 56 THR THR A . n A 1 58 GLU 58 57 57 GLU GLU A . n A 1 59 ILE 59 58 58 ILE ILE A . n A 1 60 GLU 60 59 59 GLU GLU A . n A 1 61 ALA 61 60 60 ALA ALA A . n A 1 62 LEU 62 61 61 LEU LEU A . n A 1 63 LYS 63 62 62 LYS LYS A . n A 1 64 ASN 64 63 63 ASN ASN A . n A 1 65 LEU 65 64 64 LEU LEU A . n A 1 66 ARG 66 65 65 ARG ARG A . n A 1 67 HIS 67 66 66 HIS HIS A . n A 1 68 GLN 68 67 67 GLN GLN A . n A 1 69 HIS 69 68 68 HIS HIS A . n A 1 70 ILE 70 69 69 ILE ILE A . n A 1 71 CYS 71 70 70 CYS CYS A . n A 1 72 GLN 72 71 71 GLN GLN A . n A 1 73 LEU 73 72 72 LEU LEU A . n A 1 74 TYR 74 73 73 TYR TYR A . n A 1 75 HIS 75 74 74 HIS HIS A . n A 1 76 VAL 76 75 75 VAL VAL A . n A 1 77 LEU 77 76 76 LEU LEU A . n A 1 78 GLU 78 77 77 GLU GLU A . n A 1 79 THR 79 78 78 THR THR A . n A 1 80 ALA 80 79 79 ALA ALA A . n A 1 81 ASN 81 80 80 ASN ASN A . n A 1 82 LYS 82 81 81 LYS LYS A . n A 1 83 ILE 83 82 82 ILE ILE A . n A 1 84 PHE 84 83 83 PHE PHE A . n A 1 85 MET 85 84 84 MET MET A . n A 1 86 VAL 86 85 85 VAL VAL A . n A 1 87 LEU 87 86 86 LEU LEU A . n A 1 88 GLU 88 87 87 GLU GLU A . n A 1 89 TYR 89 88 88 TYR TYR A . n A 1 90 CYS 90 89 89 CYS CYS A . n A 1 91 PRO 91 90 90 PRO PRO A . n A 1 92 GLY 92 91 91 GLY GLY A . n A 1 93 GLY 93 92 92 GLY GLY A . n A 1 94 GLU 94 93 93 GLU GLU A . n A 1 95 LEU 95 94 94 LEU LEU A . n A 1 96 PHE 96 95 95 PHE PHE A . n A 1 97 ASP 97 96 96 ASP ASP A . n A 1 98 TYR 98 97 97 TYR TYR A . n A 1 99 ILE 99 98 98 ILE ILE A . n A 1 100 ILE 100 99 99 ILE ILE A . n A 1 101 SER 101 100 100 SER SER A . n A 1 102 GLN 102 101 101 GLN GLN A . n A 1 103 ASP 103 102 102 ASP ASP A . n A 1 104 ARG 104 103 103 ARG ARG A . n A 1 105 LEU 105 104 104 LEU LEU A . n A 1 106 SER 106 105 105 SER SER A . n A 1 107 GLU 107 106 106 GLU GLU A . n A 1 108 GLU 108 107 107 GLU GLU A . n A 1 109 GLU 109 108 108 GLU GLU A . n A 1 110 THR 110 109 109 THR THR A . n A 1 111 ARG 111 110 110 ARG ARG A . n A 1 112 VAL 112 111 111 VAL VAL A . n A 1 113 VAL 113 112 112 VAL VAL A . n A 1 114 PHE 114 113 113 PHE PHE A . n A 1 115 ARG 115 114 114 ARG ARG A . n A 1 116 GLN 116 115 115 GLN GLN A . n A 1 117 ILE 117 116 116 ILE ILE A . n A 1 118 VAL 118 117 117 VAL VAL A . n A 1 119 SER 119 118 118 SER SER A . n A 1 120 ALA 120 119 119 ALA ALA A . n A 1 121 VAL 121 120 120 VAL VAL A . n A 1 122 ALA 122 121 121 ALA ALA A . n A 1 123 TYR 123 122 122 TYR TYR A . n A 1 124 VAL 124 123 123 VAL VAL A . n A 1 125 HIS 125 124 124 HIS HIS A . n A 1 126 SER 126 125 125 SER SER A . n A 1 127 GLN 127 126 126 GLN GLN A . n A 1 128 GLY 128 127 127 GLY GLY A . n A 1 129 TYR 129 128 128 TYR TYR A . n A 1 130 ALA 130 129 129 ALA ALA A . n A 1 131 HIS 131 130 130 HIS HIS A . n A 1 132 ARG 132 131 131 ARG ARG A . n A 1 133 ASP 133 132 132 ASP ASP A . n A 1 134 LEU 134 133 133 LEU LEU A . n A 1 135 LYS 135 134 134 LYS LYS A . n A 1 136 PRO 136 135 135 PRO PRO A . n A 1 137 GLU 137 136 136 GLU GLU A . n A 1 138 ASN 138 137 137 ASN ASN A . n A 1 139 LEU 139 138 138 LEU LEU A . n A 1 140 LEU 140 139 139 LEU LEU A . n A 1 141 PHE 141 140 140 PHE PHE A . n A 1 142 ASP 142 141 141 ASP ASP A . n A 1 143 GLU 143 142 142 GLU GLU A . n A 1 144 TYR 144 143 143 TYR TYR A . n A 1 145 HIS 145 144 144 HIS HIS A . n A 1 146 LYS 146 145 145 LYS LYS A . n A 1 147 LEU 147 146 146 LEU LEU A . n A 1 148 LYS 148 147 147 LYS LYS A . n A 1 149 LEU 149 148 148 LEU LEU A . n A 1 150 ILE 150 149 149 ILE ILE A . n A 1 151 ASP 151 150 150 ASP ASP A . n A 1 152 PHE 152 151 151 PHE PHE A . n A 1 153 GLY 153 152 152 GLY GLY A . n A 1 154 LEU 154 153 153 LEU LEU A . n A 1 155 CYS 155 154 154 CYS CYS A . n A 1 156 ALA 156 155 155 ALA ALA A . n A 1 157 LYS 157 156 ? ? ? A . n A 1 158 PRO 158 157 ? ? ? A . n A 1 159 LYS 159 158 ? ? ? A . n A 1 160 GLY 160 159 ? ? ? A . n A 1 161 ASN 161 160 ? ? ? A . n A 1 162 LYS 162 161 ? ? ? A . n A 1 163 ASP 163 162 ? ? ? A . n A 1 164 TYR 164 163 ? ? ? A . n A 1 165 HIS 165 164 ? ? ? A . n A 1 166 LEU 166 165 ? ? ? A . n A 1 167 GLN 167 166 ? ? ? A . n A 1 168 THR 168 167 ? ? ? A . n A 1 169 CYS 169 168 ? ? ? A . n A 1 170 CYS 170 169 ? ? ? A . n A 1 171 GLY 171 170 ? ? ? A . n A 1 172 SER 172 171 171 SER SER A . n A 1 173 LEU 173 172 172 LEU LEU A . n A 1 174 ALA 174 173 173 ALA ALA A . n A 1 175 TYR 175 174 174 TYR TYR A . n A 1 176 ALA 176 175 175 ALA ALA A . n A 1 177 ALA 177 176 176 ALA ALA A . n A 1 178 PRO 178 177 177 PRO PRO A . n A 1 179 GLU 179 178 178 GLU GLU A . n A 1 180 LEU 180 179 179 LEU LEU A . n A 1 181 ILE 181 180 180 ILE ILE A . n A 1 182 GLN 182 181 181 GLN GLN A . n A 1 183 GLY 183 182 182 GLY GLY A . n A 1 184 LYS 184 183 183 LYS LYS A . n A 1 185 SER 185 184 ? ? ? A . n A 1 186 TYR 186 185 ? ? ? A . n A 1 187 LEU 187 186 186 LEU LEU A . n A 1 188 GLY 188 187 187 GLY GLY A . n A 1 189 SER 189 188 188 SER SER A . n A 1 190 GLU 190 189 189 GLU GLU A . n A 1 191 ALA 191 190 190 ALA ALA A . n A 1 192 ASP 192 191 191 ASP ASP A . n A 1 193 VAL 193 192 192 VAL VAL A . n A 1 194 TRP 194 193 193 TRP TRP A . n A 1 195 SER 195 194 194 SER SER A . n A 1 196 MET 196 195 195 MET MET A . n A 1 197 GLY 197 196 196 GLY GLY A . n A 1 198 ILE 198 197 197 ILE ILE A . n A 1 199 LEU 199 198 198 LEU LEU A . n A 1 200 LEU 200 199 199 LEU LEU A . n A 1 201 TYR 201 200 200 TYR TYR A . n A 1 202 VAL 202 201 201 VAL VAL A . n A 1 203 LEU 203 202 202 LEU LEU A . n A 1 204 MET 204 203 203 MET MET A . n A 1 205 CYS 205 204 204 CYS CYS A . n A 1 206 GLY 206 205 205 GLY GLY A . n A 1 207 PHE 207 206 206 PHE PHE A . n A 1 208 LEU 208 207 207 LEU LEU A . n A 1 209 PRO 209 208 208 PRO PRO A . n A 1 210 PHE 210 209 209 PHE PHE A . n A 1 211 ASP 211 210 210 ASP ASP A . n A 1 212 ASP 212 211 211 ASP ASP A . n A 1 213 ASP 213 212 212 ASP ASP A . n A 1 214 ASN 214 213 213 ASN ASN A . n A 1 215 VAL 215 214 214 VAL VAL A . n A 1 216 MET 216 215 215 MET MET A . n A 1 217 ALA 217 216 216 ALA ALA A . n A 1 218 LEU 218 217 217 LEU LEU A . n A 1 219 TYR 219 218 218 TYR TYR A . n A 1 220 LYS 220 219 219 LYS LYS A . n A 1 221 LYS 221 220 220 LYS LYS A . n A 1 222 ILE 222 221 221 ILE ILE A . n A 1 223 MET 223 222 222 MET MET A . n A 1 224 ARG 224 223 223 ARG ARG A . n A 1 225 GLY 225 224 224 GLY GLY A . n A 1 226 LYS 226 225 225 LYS LYS A . n A 1 227 TYR 227 226 226 TYR TYR A . n A 1 228 ASP 228 227 227 ASP ASP A . n A 1 229 VAL 229 228 228 VAL VAL A . n A 1 230 PRO 230 229 229 PRO PRO A . n A 1 231 LYS 231 230 230 LYS LYS A . n A 1 232 TRP 232 231 231 TRP TRP A . n A 1 233 LEU 233 232 232 LEU LEU A . n A 1 234 SER 234 233 233 SER SER A . n A 1 235 PRO 235 234 234 PRO PRO A . n A 1 236 SER 236 235 235 SER SER A . n A 1 237 SER 237 236 236 SER SER A . n A 1 238 ILE 238 237 237 ILE ILE A . n A 1 239 LEU 239 238 238 LEU LEU A . n A 1 240 LEU 240 239 239 LEU LEU A . n A 1 241 LEU 241 240 240 LEU LEU A . n A 1 242 GLN 242 241 241 GLN GLN A . n A 1 243 GLN 243 242 242 GLN GLN A . n A 1 244 MET 244 243 243 MET MET A . n A 1 245 LEU 245 244 244 LEU LEU A . n A 1 246 GLN 246 245 245 GLN GLN A . n A 1 247 VAL 247 246 246 VAL VAL A . n A 1 248 ASP 248 247 247 ASP ASP A . n A 1 249 PRO 249 248 248 PRO PRO A . n A 1 250 LYS 250 249 249 LYS LYS A . n A 1 251 LYS 251 250 250 LYS LYS A . n A 1 252 ARG 252 251 251 ARG ARG A . n A 1 253 ILE 253 252 252 ILE ILE A . n A 1 254 SER 254 253 253 SER SER A . n A 1 255 MET 255 254 254 MET MET A . n A 1 256 LYS 256 255 255 LYS LYS A . n A 1 257 ASN 257 256 256 ASN ASN A . n A 1 258 LEU 258 257 257 LEU LEU A . n A 1 259 LEU 259 258 258 LEU LEU A . n A 1 260 ASN 260 259 259 ASN ASN A . n A 1 261 HIS 261 260 260 HIS HIS A . n A 1 262 PRO 262 261 261 PRO PRO A . n A 1 263 TRP 263 262 262 TRP TRP A . n A 1 264 ILE 264 263 263 ILE ILE A . n A 1 265 MET 265 264 264 MET MET A . n A 1 266 GLN 266 265 265 GLN GLN A . n A 1 267 ASP 267 266 266 ASP ASP A . n A 1 268 TYR 268 267 267 TYR TYR A . n A 1 269 ASN 269 268 268 ASN ASN A . n A 1 270 TYR 270 269 269 TYR TYR A . n A 1 271 PRO 271 270 270 PRO PRO A . n A 1 272 VAL 272 271 271 VAL VAL A . n A 1 273 GLU 273 272 272 GLU GLU A . n A 1 274 TRP 274 273 273 TRP TRP A . n A 1 275 GLN 275 274 274 GLN GLN A . n A 1 276 SER 276 275 275 SER SER A . n A 1 277 LYS 277 276 276 LYS LYS A . n A 1 278 ASN 278 277 277 ASN ASN A . n A 1 279 PRO 279 278 278 PRO PRO A . n A 1 280 PHE 280 279 279 PHE PHE A . n A 1 281 ILE 281 280 280 ILE ILE A . n A 1 282 HIS 282 281 281 HIS HIS A . n A 1 283 LEU 283 282 282 LEU LEU A . n A 1 284 ASP 284 283 283 ASP ASP A . n A 1 285 ASP 285 284 284 ASP ASP A . n A 1 286 ASP 286 285 285 ASP ASP A . n A 1 287 CYS 287 286 286 CYS CYS A . n A 1 288 VAL 288 287 287 VAL VAL A . n A 1 289 THR 289 288 288 THR THR A . n A 1 290 GLU 290 289 289 GLU GLU A . n A 1 291 LEU 291 290 290 LEU LEU A . n A 1 292 SER 292 291 291 SER SER A . n A 1 293 VAL 293 292 292 VAL VAL A . n A 1 294 HIS 294 293 293 HIS HIS A . n A 1 295 HIS 295 294 294 HIS HIS A . n A 1 296 ARG 296 295 295 ARG ARG A . n A 1 297 ASN 297 296 296 ASN ASN A . n A 1 298 ASN 298 297 297 ASN ASN A . n A 1 299 ARG 299 298 298 ARG ARG A . n A 1 300 GLN 300 299 299 GLN GLN A . n A 1 301 THR 301 300 300 THR THR A . n A 1 302 MET 302 301 301 MET MET A . n A 1 303 GLU 303 302 302 GLU GLU A . n A 1 304 ASP 304 303 303 ASP ASP A . n A 1 305 LEU 305 304 304 LEU LEU A . n A 1 306 ILE 306 305 305 ILE ILE A . n A 1 307 SER 307 306 306 SER SER A . n A 1 308 LEU 308 307 307 LEU LEU A . n A 1 309 TRP 309 308 308 TRP TRP A . n A 1 310 GLN 310 309 309 GLN GLN A . n A 1 311 TYR 311 310 310 TYR TYR A . n A 1 312 ASP 312 311 311 ASP ASP A . n A 1 313 HIS 313 312 312 HIS HIS A . n A 1 314 LEU 314 313 313 LEU LEU A . n A 1 315 THR 315 314 314 THR THR A . n A 1 316 ALA 316 315 315 ALA ALA A . n A 1 317 THR 317 316 316 THR THR A . n A 1 318 TYR 318 317 317 TYR TYR A . n A 1 319 LEU 319 318 318 LEU LEU A . n A 1 320 LEU 320 319 319 LEU LEU A . n A 1 321 LEU 321 320 320 LEU LEU A . n A 1 322 LEU 322 321 321 LEU LEU A . n A 1 323 ALA 323 322 322 ALA ALA A . n A 1 324 LYS 324 323 323 LYS LYS A . n A 1 325 LYS 325 324 324 LYS LYS A . n A 1 326 ALA 326 325 325 ALA ALA A . n A 1 327 ARG 327 326 326 ARG ARG A . n A 1 328 GLY 328 327 327 GLY GLY A . n A 1 329 LYS 329 328 328 LYS LYS A . n A 1 330 PRO 330 329 329 PRO PRO A . n A 1 331 VAL 331 330 330 VAL VAL A . n A 1 332 ARG 332 331 331 ARG ARG A . n A 1 333 LEU 333 332 332 LEU LEU A . n A 1 334 ARG 334 333 333 ARG ARG A . n A 1 335 LEU 335 334 ? ? ? A . n A 1 336 SER 336 335 ? ? ? A . n A 1 337 SER 337 336 ? ? ? A . n A 1 338 PHE 338 337 ? ? ? A . n A 1 339 SER 339 338 ? ? ? A . n A 1 340 CYS 340 339 ? ? ? A . n A 1 341 GLY 341 340 ? ? ? A . n A 1 342 HIS 342 341 ? ? ? A . n A 1 343 HIS 343 342 ? ? ? A . n A 1 344 HIS 344 343 ? ? ? A . n A 1 345 HIS 345 344 ? ? ? A . n A 1 346 HIS 346 345 ? ? ? A . n A 1 347 HIS 347 346 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NA 1 401 144 NA NA A . C 2 NA 1 402 145 NA NA A . D 3 CL 1 403 148 CL CL A . E 4 KSA 1 404 1 KSA KSA A . F 5 HOH 1 501 98 HOH HOH A . F 5 HOH 2 502 109 HOH HOH A . F 5 HOH 3 503 47 HOH HOH A . F 5 HOH 4 504 90 HOH HOH A . F 5 HOH 5 505 141 HOH HOH A . F 5 HOH 6 506 20 HOH HOH A . F 5 HOH 7 507 89 HOH HOH A . F 5 HOH 8 508 114 HOH HOH A . F 5 HOH 9 509 26 HOH HOH A . F 5 HOH 10 510 106 HOH HOH A . F 5 HOH 11 511 132 HOH HOH A . F 5 HOH 12 512 101 HOH HOH A . F 5 HOH 13 513 102 HOH HOH A . F 5 HOH 14 514 54 HOH HOH A . F 5 HOH 15 515 95 HOH HOH A . F 5 HOH 16 516 22 HOH HOH A . F 5 HOH 17 517 113 HOH HOH A . F 5 HOH 18 518 116 HOH HOH A . F 5 HOH 19 519 96 HOH HOH A . F 5 HOH 20 520 110 HOH HOH A . F 5 HOH 21 521 60 HOH HOH A . F 5 HOH 22 522 79 HOH HOH A . F 5 HOH 23 523 74 HOH HOH A . F 5 HOH 24 524 18 HOH HOH A . F 5 HOH 25 525 48 HOH HOH A . F 5 HOH 26 526 123 HOH HOH A . F 5 HOH 27 527 77 HOH HOH A . F 5 HOH 28 528 126 HOH HOH A . F 5 HOH 29 529 1 HOH HOH A . F 5 HOH 30 530 2 HOH HOH A . F 5 HOH 31 531 10 HOH HOH A . F 5 HOH 32 532 142 HOH HOH A . F 5 HOH 33 533 62 HOH HOH A . F 5 HOH 34 534 137 HOH HOH A . F 5 HOH 35 535 37 HOH HOH A . F 5 HOH 36 536 86 HOH HOH A . F 5 HOH 37 537 23 HOH HOH A . F 5 HOH 38 538 32 HOH HOH A . F 5 HOH 39 539 13 HOH HOH A . F 5 HOH 40 540 112 HOH HOH A . F 5 HOH 41 541 59 HOH HOH A . F 5 HOH 42 542 88 HOH HOH A . F 5 HOH 43 543 71 HOH HOH A . F 5 HOH 44 544 19 HOH HOH A . F 5 HOH 45 545 12 HOH HOH A . F 5 HOH 46 546 29 HOH HOH A . F 5 HOH 47 547 61 HOH HOH A . F 5 HOH 48 548 24 HOH HOH A . F 5 HOH 49 549 6 HOH HOH A . F 5 HOH 50 550 85 HOH HOH A . F 5 HOH 51 551 80 HOH HOH A . F 5 HOH 52 552 68 HOH HOH A . F 5 HOH 53 553 67 HOH HOH A . F 5 HOH 54 554 66 HOH HOH A . F 5 HOH 55 555 35 HOH HOH A . F 5 HOH 56 556 63 HOH HOH A . F 5 HOH 57 557 118 HOH HOH A . F 5 HOH 58 558 82 HOH HOH A . F 5 HOH 59 559 50 HOH HOH A . F 5 HOH 60 560 9 HOH HOH A . F 5 HOH 61 561 41 HOH HOH A . F 5 HOH 62 562 136 HOH HOH A . F 5 HOH 63 563 94 HOH HOH A . F 5 HOH 64 564 43 HOH HOH A . F 5 HOH 65 565 31 HOH HOH A . F 5 HOH 66 566 93 HOH HOH A . F 5 HOH 67 567 100 HOH HOH A . F 5 HOH 68 568 99 HOH HOH A . F 5 HOH 69 569 92 HOH HOH A . F 5 HOH 70 570 64 HOH HOH A . F 5 HOH 71 571 16 HOH HOH A . F 5 HOH 72 572 128 HOH HOH A . F 5 HOH 73 573 120 HOH HOH A . F 5 HOH 74 574 2 HOH HOH A . F 5 HOH 75 575 17 HOH HOH A . F 5 HOH 76 576 39 HOH HOH A . F 5 HOH 77 577 138 HOH HOH A . F 5 HOH 78 578 33 HOH HOH A . F 5 HOH 79 579 21 HOH HOH A . F 5 HOH 80 580 115 HOH HOH A . F 5 HOH 81 581 28 HOH HOH A . F 5 HOH 82 582 4 HOH HOH A . F 5 HOH 83 583 73 HOH HOH A . F 5 HOH 84 584 107 HOH HOH A . F 5 HOH 85 585 58 HOH HOH A . F 5 HOH 86 586 30 HOH HOH A . F 5 HOH 87 587 11 HOH HOH A . F 5 HOH 88 588 87 HOH HOH A . F 5 HOH 89 589 15 HOH HOH A . F 5 HOH 90 590 72 HOH HOH A . F 5 HOH 91 591 78 HOH HOH A . F 5 HOH 92 592 3 HOH HOH A . F 5 HOH 93 593 1 HOH HOH A . F 5 HOH 94 594 46 HOH HOH A . F 5 HOH 95 595 130 HOH HOH A . F 5 HOH 96 596 139 HOH HOH A . F 5 HOH 97 597 122 HOH HOH A . F 5 HOH 98 598 91 HOH HOH A . F 5 HOH 99 599 140 HOH HOH A . F 5 HOH 100 600 134 HOH HOH A . F 5 HOH 101 601 127 HOH HOH A . F 5 HOH 102 602 45 HOH HOH A . F 5 HOH 103 603 53 HOH HOH A . F 5 HOH 104 604 104 HOH HOH A . F 5 HOH 105 605 111 HOH HOH A . F 5 HOH 106 606 125 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1240 ? 1 MORE -27 ? 1 'SSA (A^2)' 14940 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-12-06 2 'Structure model' 1 1 2017-12-13 3 'Structure model' 1 2 2019-04-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Source and taxonomy' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' entity_src_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.pdbx_database_id_PubMed' 3 2 'Structure model' '_citation.title' 4 3 'Structure model' '_entity_src_gen.pdbx_host_org_cell_line' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0151 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 14 ? ? -111.33 -150.58 2 1 LEU A 47 ? ? 50.42 73.73 3 1 ASP A 102 ? ? 76.95 -59.62 4 1 ARG A 131 ? ? 76.42 -2.14 5 1 ASP A 150 ? ? 69.66 80.58 6 1 ASP A 266 ? ? 72.80 -5.91 7 1 ILE A 280 ? ? -102.63 -84.82 8 1 ASP A 311 ? ? -105.86 -166.00 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 0 ? A GLY 1 2 1 Y 1 A PRO 1 ? A PRO 2 3 1 Y 1 A LYS 156 ? A LYS 157 4 1 Y 1 A PRO 157 ? A PRO 158 5 1 Y 1 A LYS 158 ? A LYS 159 6 1 Y 1 A GLY 159 ? A GLY 160 7 1 Y 1 A ASN 160 ? A ASN 161 8 1 Y 1 A LYS 161 ? A LYS 162 9 1 Y 1 A ASP 162 ? A ASP 163 10 1 Y 1 A TYR 163 ? A TYR 164 11 1 Y 1 A HIS 164 ? A HIS 165 12 1 Y 1 A LEU 165 ? A LEU 166 13 1 Y 1 A GLN 166 ? A GLN 167 14 1 Y 1 A THR 167 ? A THR 168 15 1 Y 1 A CYS 168 ? A CYS 169 16 1 Y 1 A CYS 169 ? A CYS 170 17 1 Y 1 A GLY 170 ? A GLY 171 18 1 Y 1 A SER 184 ? A SER 185 19 1 Y 1 A TYR 185 ? A TYR 186 20 1 Y 1 A LEU 334 ? A LEU 335 21 1 Y 1 A SER 335 ? A SER 336 22 1 Y 1 A SER 336 ? A SER 337 23 1 Y 1 A PHE 337 ? A PHE 338 24 1 Y 1 A SER 338 ? A SER 339 25 1 Y 1 A CYS 339 ? A CYS 340 26 1 Y 1 A GLY 340 ? A GLY 341 27 1 Y 1 A HIS 341 ? A HIS 342 28 1 Y 1 A HIS 342 ? A HIS 343 29 1 Y 1 A HIS 343 ? A HIS 344 30 1 Y 1 A HIS 344 ? A HIS 345 31 1 Y 1 A HIS 345 ? A HIS 346 32 1 Y 1 A HIS 346 ? A HIS 347 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SODIUM ION' NA 3 'CHLORIDE ION' CL 4 K-252A KSA 5 water HOH #