data_5MAF # _entry.id 5MAF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5MAF WWPDB D_1200001973 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5MAF _pdbx_database_status.recvd_initial_deposition_date 2016-11-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Canevari, G.' 1 'Re Depaolini, S.' 2 'Casale, E.' 3 'Felder, E.' 4 'Kuster, B.' 5 'Heinzlmeir, S.' 6 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Science _citation.journal_id_ASTM SCIEAS _citation.journal_id_CSD 0038 _citation.journal_id_ISSN 1095-9203 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 358 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'The target landscape of clinical kinase drugs.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1126/science.aan4368 _citation.pdbx_database_id_PubMed 29191878 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Klaeger, S.' 1 primary 'Heinzlmeir, S.' 2 primary 'Wilhelm, M.' 3 primary 'Polzer, H.' 4 primary 'Vick, B.' 5 primary 'Koenig, P.A.' 6 primary 'Reinecke, M.' 7 primary 'Ruprecht, B.' 8 primary 'Petzoldt, S.' 9 primary 'Meng, C.' 10 primary 'Zecha, J.' 11 primary 'Reiter, K.' 12 primary 'Qiao, H.' 13 primary 'Helm, D.' 14 primary 'Koch, H.' 15 primary 'Schoof, M.' 16 primary 'Canevari, G.' 17 primary 'Casale, E.' 18 primary 'Depaolini, S.R.' 19 primary 'Feuchtinger, A.' 20 primary 'Wu, Z.' 21 primary 'Schmidt, T.' 22 primary 'Rueckert, L.' 23 primary 'Becker, W.' 24 primary 'Huenges, J.' 25 primary 'Garz, A.K.' 26 primary 'Gohlke, B.O.' 27 primary 'Zolg, D.P.' 28 primary 'Kayser, G.' 29 primary 'Vooder, T.' 30 primary 'Preissner, R.' 31 primary 'Hahne, H.' 32 primary 'Tonisson, N.' 33 primary 'Kramer, K.' 34 primary 'Gotze, K.' 35 primary 'Bassermann, F.' 36 primary 'Schlegl, J.' 37 primary 'Ehrlich, H.C.' 38 primary 'Aiche, S.' 39 primary 'Walch, A.' 40 primary 'Greif, P.A.' 41 primary 'Schneider, S.' 42 primary 'Felder, E.R.' 43 primary 'Ruland, J.' 44 primary 'Medard, G.' 45 primary 'Jeremias, I.' 46 primary 'Spiekermann, K.' 47 primary 'Kuster, B.' 48 # _cell.entry_id 5MAF _cell.length_a 59.913 _cell.length_b 63.713 _cell.length_c 91.292 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5MAF _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Maternal embryonic leucine zipper kinase' 40220.539 1 2.7.11.1,2.7.10.2 ? 'UNP residues 2-340' ? 2 non-polymer syn 'DIMETHYL SULFOXIDE' 78.133 1 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 4 non-polymer nat ;methyl (3Z)-3-{[(4-{methyl[(4-methylpiperazin-1-yl)acetyl]amino}phenyl)amino](phenyl)methylidene}-2-oxo-2,3-dihydro-1H-indole-6-carboxylate ; 539.625 1 ? ? ? ? 5 water nat water 18.015 29 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'hMELK,Protein kinase Eg3,pEg3 kinase,Protein kinase PK38,hPK38,Tyrosine-protein kinase MELK' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETA NKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKPKG NKDYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILL LQQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLL LLAKKARGKPVRLRLSSFSCGHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;GPKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETA NKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKPKG NKDYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILL LQQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLL LLAKKARGKPVRLRLSSFSCGHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LYS n 1 4 ASP n 1 5 TYR n 1 6 ASP n 1 7 GLU n 1 8 LEU n 1 9 LEU n 1 10 LYS n 1 11 TYR n 1 12 TYR n 1 13 GLU n 1 14 LEU n 1 15 HIS n 1 16 GLU n 1 17 THR n 1 18 ILE n 1 19 GLY n 1 20 THR n 1 21 GLY n 1 22 GLY n 1 23 PHE n 1 24 ALA n 1 25 LYS n 1 26 VAL n 1 27 LYS n 1 28 LEU n 1 29 ALA n 1 30 CYS n 1 31 HIS n 1 32 ILE n 1 33 LEU n 1 34 THR n 1 35 GLY n 1 36 GLU n 1 37 MET n 1 38 VAL n 1 39 ALA n 1 40 ILE n 1 41 LYS n 1 42 ILE n 1 43 MET n 1 44 ASP n 1 45 LYS n 1 46 ASN n 1 47 THR n 1 48 LEU n 1 49 GLY n 1 50 SER n 1 51 ASP n 1 52 LEU n 1 53 PRO n 1 54 ARG n 1 55 ILE n 1 56 LYS n 1 57 THR n 1 58 GLU n 1 59 ILE n 1 60 GLU n 1 61 ALA n 1 62 LEU n 1 63 LYS n 1 64 ASN n 1 65 LEU n 1 66 ARG n 1 67 HIS n 1 68 GLN n 1 69 HIS n 1 70 ILE n 1 71 CYS n 1 72 GLN n 1 73 LEU n 1 74 TYR n 1 75 HIS n 1 76 VAL n 1 77 LEU n 1 78 GLU n 1 79 THR n 1 80 ALA n 1 81 ASN n 1 82 LYS n 1 83 ILE n 1 84 PHE n 1 85 MET n 1 86 VAL n 1 87 LEU n 1 88 GLU n 1 89 TYR n 1 90 CYS n 1 91 PRO n 1 92 GLY n 1 93 GLY n 1 94 GLU n 1 95 LEU n 1 96 PHE n 1 97 ASP n 1 98 TYR n 1 99 ILE n 1 100 ILE n 1 101 SER n 1 102 GLN n 1 103 ASP n 1 104 ARG n 1 105 LEU n 1 106 SER n 1 107 GLU n 1 108 GLU n 1 109 GLU n 1 110 THR n 1 111 ARG n 1 112 VAL n 1 113 VAL n 1 114 PHE n 1 115 ARG n 1 116 GLN n 1 117 ILE n 1 118 VAL n 1 119 SER n 1 120 ALA n 1 121 VAL n 1 122 ALA n 1 123 TYR n 1 124 VAL n 1 125 HIS n 1 126 SER n 1 127 GLN n 1 128 GLY n 1 129 TYR n 1 130 ALA n 1 131 HIS n 1 132 ARG n 1 133 ASP n 1 134 LEU n 1 135 LYS n 1 136 PRO n 1 137 GLU n 1 138 ASN n 1 139 LEU n 1 140 LEU n 1 141 PHE n 1 142 ASP n 1 143 GLU n 1 144 TYR n 1 145 HIS n 1 146 LYS n 1 147 LEU n 1 148 LYS n 1 149 LEU n 1 150 ILE n 1 151 ASP n 1 152 PHE n 1 153 GLY n 1 154 LEU n 1 155 CYS n 1 156 ALA n 1 157 LYS n 1 158 PRO n 1 159 LYS n 1 160 GLY n 1 161 ASN n 1 162 LYS n 1 163 ASP n 1 164 TYR n 1 165 HIS n 1 166 LEU n 1 167 GLN n 1 168 THR n 1 169 CYS n 1 170 CYS n 1 171 GLY n 1 172 SER n 1 173 LEU n 1 174 ALA n 1 175 TYR n 1 176 ALA n 1 177 ALA n 1 178 PRO n 1 179 GLU n 1 180 LEU n 1 181 ILE n 1 182 GLN n 1 183 GLY n 1 184 LYS n 1 185 SER n 1 186 TYR n 1 187 LEU n 1 188 GLY n 1 189 SER n 1 190 GLU n 1 191 ALA n 1 192 ASP n 1 193 VAL n 1 194 TRP n 1 195 SER n 1 196 MET n 1 197 GLY n 1 198 ILE n 1 199 LEU n 1 200 LEU n 1 201 TYR n 1 202 VAL n 1 203 LEU n 1 204 MET n 1 205 CYS n 1 206 GLY n 1 207 PHE n 1 208 LEU n 1 209 PRO n 1 210 PHE n 1 211 ASP n 1 212 ASP n 1 213 ASP n 1 214 ASN n 1 215 VAL n 1 216 MET n 1 217 ALA n 1 218 LEU n 1 219 TYR n 1 220 LYS n 1 221 LYS n 1 222 ILE n 1 223 MET n 1 224 ARG n 1 225 GLY n 1 226 LYS n 1 227 TYR n 1 228 ASP n 1 229 VAL n 1 230 PRO n 1 231 LYS n 1 232 TRP n 1 233 LEU n 1 234 SER n 1 235 PRO n 1 236 SER n 1 237 SER n 1 238 ILE n 1 239 LEU n 1 240 LEU n 1 241 LEU n 1 242 GLN n 1 243 GLN n 1 244 MET n 1 245 LEU n 1 246 GLN n 1 247 VAL n 1 248 ASP n 1 249 PRO n 1 250 LYS n 1 251 LYS n 1 252 ARG n 1 253 ILE n 1 254 SER n 1 255 MET n 1 256 LYS n 1 257 ASN n 1 258 LEU n 1 259 LEU n 1 260 ASN n 1 261 HIS n 1 262 PRO n 1 263 TRP n 1 264 ILE n 1 265 MET n 1 266 GLN n 1 267 ASP n 1 268 TYR n 1 269 ASN n 1 270 TYR n 1 271 PRO n 1 272 VAL n 1 273 GLU n 1 274 TRP n 1 275 GLN n 1 276 SER n 1 277 LYS n 1 278 ASN n 1 279 PRO n 1 280 PHE n 1 281 ILE n 1 282 HIS n 1 283 LEU n 1 284 ASP n 1 285 ASP n 1 286 ASP n 1 287 CYS n 1 288 VAL n 1 289 THR n 1 290 GLU n 1 291 LEU n 1 292 SER n 1 293 VAL n 1 294 HIS n 1 295 HIS n 1 296 ARG n 1 297 ASN n 1 298 ASN n 1 299 ARG n 1 300 GLN n 1 301 THR n 1 302 MET n 1 303 GLU n 1 304 ASP n 1 305 LEU n 1 306 ILE n 1 307 SER n 1 308 LEU n 1 309 TRP n 1 310 GLN n 1 311 TYR n 1 312 ASP n 1 313 HIS n 1 314 LEU n 1 315 THR n 1 316 ALA n 1 317 THR n 1 318 TYR n 1 319 LEU n 1 320 LEU n 1 321 LEU n 1 322 LEU n 1 323 ALA n 1 324 LYS n 1 325 LYS n 1 326 ALA n 1 327 ARG n 1 328 GLY n 1 329 LYS n 1 330 PRO n 1 331 VAL n 1 332 ARG n 1 333 LEU n 1 334 ARG n 1 335 LEU n 1 336 SER n 1 337 SER n 1 338 PHE n 1 339 SER n 1 340 CYS n 1 341 GLY n 1 342 HIS n 1 343 HIS n 1 344 HIS n 1 345 HIS n 1 346 HIS n 1 347 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 347 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MELK, KIAA0175' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name 'fall armyworm' _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line Sf21 _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Baculovirus _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MELK_HUMAN _struct_ref.pdbx_db_accession Q14680 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETANK IFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKPKGNK DYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILLLQ QMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLLL AKKARGKPVRLRLSSFSCG ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5MAF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 341 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q14680 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 340 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 340 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5MAF GLY A 1 ? UNP Q14680 ? ? 'expression tag' 0 1 1 5MAF PRO A 2 ? UNP Q14680 ? ? 'expression tag' 1 2 1 5MAF HIS A 342 ? UNP Q14680 ? ? 'expression tag' 341 3 1 5MAF HIS A 343 ? UNP Q14680 ? ? 'expression tag' 342 4 1 5MAF HIS A 344 ? UNP Q14680 ? ? 'expression tag' 343 5 1 5MAF HIS A 345 ? UNP Q14680 ? ? 'expression tag' 344 6 1 5MAF HIS A 346 ? UNP Q14680 ? ? 'expression tag' 345 7 1 5MAF HIS A 347 ? UNP Q14680 ? ? 'expression tag' 346 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DMS non-polymer . 'DIMETHYL SULFOXIDE' ? 'C2 H6 O S' 78.133 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 XIN non-polymer . ;methyl (3Z)-3-{[(4-{methyl[(4-methylpiperazin-1-yl)acetyl]amino}phenyl)amino](phenyl)methylidene}-2-oxo-2,3-dihydro-1H-indole-6-carboxylate ; ? 'C31 H33 N5 O4' 539.625 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5MAF _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.17 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 43.22 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '10-20% PEG 3350 or PEG 4000, 0.1 M BIS TRIS pH 6.5, 0.6M NaCl' _exptl_crystal_grow.pdbx_pH_range 6.5 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details 'Toroidal mirror' _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-10-04 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.976254 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.976254 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5MAF _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.8 _reflns.d_resolution_low 52.25 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9059 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6 _reflns.pdbx_Rmerge_I_obs 0.129 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.993 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.8 _reflns_shell.d_res_low 2.95 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.6 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 99.8 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.733 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.2 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.774 _reflns_shell.pdbx_R_split ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5MAF _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 8550 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 52.25 _refine.ls_d_res_high 2.80 _refine.ls_percent_reflns_obs 99.76 _refine.ls_R_factor_obs 0.21207 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.20965 _refine.ls_R_factor_R_free 0.25919 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.3 _refine.ls_number_reflns_R_free 476 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.935 _refine.correlation_coeff_Fo_to_Fc_free 0.902 _refine.B_iso_mean 56.237 _refine.aniso_B[1][1] -3.46 _refine.aniso_B[2][2] 0.38 _refine.aniso_B[3][3] 3.08 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 'In house MELK structure' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.412 _refine.overall_SU_ML 0.310 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 16.104 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 2578 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 45 _refine_hist.number_atoms_solvent 29 _refine_hist.number_atoms_total 2652 _refine_hist.d_res_high 2.80 _refine_hist.d_res_low 52.25 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.007 0.019 ? 2683 'X-RAY DIFFRACTION' ? r_bond_other_d 0.002 0.020 ? 2616 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.204 1.988 ? 3625 'X-RAY DIFFRACTION' ? r_angle_other_deg 1.023 3.006 ? 6019 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.444 5.000 ? 311 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 37.918 24.215 ? 121 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 14.222 15.000 ? 491 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 14.749 15.000 ? 13 'X-RAY DIFFRACTION' ? r_chiral_restr 0.060 0.200 ? 396 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.004 0.021 ? 2927 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.001 0.020 ? 608 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.756 5.519 ? 1256 'X-RAY DIFFRACTION' ? r_mcbond_other 1.752 5.515 ? 1255 'X-RAY DIFFRACTION' ? r_mcangle_it 3.016 8.262 ? 1563 'X-RAY DIFFRACTION' ? r_mcangle_other 3.015 8.267 ? 1564 'X-RAY DIFFRACTION' ? r_scbond_it 1.661 5.727 ? 1427 'X-RAY DIFFRACTION' ? r_scbond_other 1.660 5.726 ? 1428 'X-RAY DIFFRACTION' ? r_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_other 2.918 8.489 ? 2063 'X-RAY DIFFRACTION' ? r_long_range_B_refined 5.013 62.507 ? 3007 'X-RAY DIFFRACTION' ? r_long_range_B_other 5.012 62.506 ? 3008 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.800 _refine_ls_shell.d_res_low 2.873 _refine_ls_shell.number_reflns_R_work 609 _refine_ls_shell.R_factor_R_work 0.294 _refine_ls_shell.percent_reflns_obs 99.69 _refine_ls_shell.R_factor_R_free 0.310 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 44 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.number_reflns_obs ? # _struct.entry_id 5MAF _struct.title 'Crystal structure of MELK in complex with an inhibitor' _struct.pdbx_descriptor 'Maternal embryonic leucine zipper kinase (E.C.2.7.11.1,2.7.10.2)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5MAF _struct_keywords.text 'kinase, inhibitor, complex, transferase' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 TYR A 5 ? LYS A 10 ? TYR A 4 LYS A 9 1 ? 6 HELX_P HELX_P2 AA2 LEU A 52 ? ASN A 64 ? LEU A 51 ASN A 63 1 ? 13 HELX_P HELX_P3 AA3 LEU A 95 ? GLN A 102 ? LEU A 94 GLN A 101 1 ? 8 HELX_P HELX_P4 AA4 SER A 106 ? GLN A 127 ? SER A 105 GLN A 126 1 ? 22 HELX_P HELX_P5 AA5 LYS A 135 ? GLU A 137 ? LYS A 134 GLU A 136 5 ? 3 HELX_P HELX_P6 AA6 ALA A 177 ? GLY A 183 ? ALA A 176 GLY A 182 1 ? 7 HELX_P HELX_P7 AA7 GLY A 188 ? GLY A 206 ? GLY A 187 GLY A 205 1 ? 19 HELX_P HELX_P8 AA8 ASN A 214 ? GLY A 225 ? ASN A 213 GLY A 224 1 ? 12 HELX_P HELX_P9 AA9 SER A 234 ? LEU A 245 ? SER A 233 LEU A 244 1 ? 12 HELX_P HELX_P10 AB1 SER A 254 ? LEU A 259 ? SER A 253 LEU A 258 1 ? 6 HELX_P HELX_P11 AB2 HIS A 261 ? GLN A 266 ? HIS A 260 GLN A 265 1 ? 6 HELX_P HELX_P12 AB3 ASP A 284 ? ARG A 296 ? ASP A 283 ARG A 295 1 ? 13 HELX_P HELX_P13 AB4 ASN A 298 ? SER A 307 ? ASN A 297 SER A 306 1 ? 10 HELX_P HELX_P14 AB5 ASP A 312 ? ARG A 327 ? ASP A 311 ARG A 326 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 12 ? THR A 20 ? TYR A 11 THR A 19 AA1 2 LYS A 25 ? HIS A 31 ? LYS A 24 HIS A 30 AA1 3 MET A 37 ? ASP A 44 ? MET A 36 ASP A 43 AA1 4 LYS A 82 ? GLU A 88 ? LYS A 81 GLU A 87 AA1 5 LEU A 73 ? GLU A 78 ? LEU A 72 GLU A 77 AA2 1 GLY A 93 ? GLU A 94 ? GLY A 92 GLU A 93 AA2 2 LEU A 139 ? PHE A 141 ? LEU A 138 PHE A 140 AA2 3 LEU A 147 ? LEU A 149 ? LEU A 146 LEU A 148 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N HIS A 15 ? N HIS A 14 O LEU A 28 ? O LEU A 27 AA1 2 3 N LYS A 25 ? N LYS A 24 O ILE A 42 ? O ILE A 41 AA1 3 4 N ALA A 39 ? N ALA A 38 O LEU A 87 ? O LEU A 86 AA1 4 5 O PHE A 84 ? O PHE A 83 N LEU A 77 ? N LEU A 76 AA2 1 2 N GLY A 93 ? N GLY A 92 O PHE A 141 ? O PHE A 140 AA2 2 3 N LEU A 140 ? N LEU A 139 O LYS A 148 ? O LYS A 147 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A DMS 401 ? 6 'binding site for residue DMS A 401' AC2 Software A CL 402 ? 2 'binding site for residue CL A 402' AC3 Software A XIN 403 ? 17 'binding site for residue XIN A 403' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 GLU A 36 ? GLU A 35 . ? 1_555 ? 2 AC1 6 MET A 37 ? MET A 36 . ? 1_555 ? 3 AC1 6 TYR A 74 ? TYR A 73 . ? 1_555 ? 4 AC1 6 TYR A 89 ? TYR A 88 . ? 1_555 ? 5 AC1 6 GLU A 143 ? GLU A 142 . ? 1_555 ? 6 AC1 6 ARG A 327 ? ARG A 326 . ? 1_555 ? 7 AC2 2 ARG A 115 ? ARG A 114 . ? 1_555 ? 8 AC2 2 GLU A 273 ? GLU A 272 . ? 1_555 ? 9 AC3 17 LYS A 3 ? LYS A 2 . ? 4_457 ? 10 AC3 17 GLU A 16 ? GLU A 15 . ? 1_555 ? 11 AC3 17 ILE A 18 ? ILE A 17 . ? 1_555 ? 12 AC3 17 GLY A 19 ? GLY A 18 . ? 1_555 ? 13 AC3 17 VAL A 26 ? VAL A 25 . ? 1_555 ? 14 AC3 17 ALA A 39 ? ALA A 38 . ? 1_555 ? 15 AC3 17 LYS A 41 ? LYS A 40 . ? 1_555 ? 16 AC3 17 GLU A 58 ? GLU A 57 . ? 1_555 ? 17 AC3 17 LEU A 87 ? LEU A 86 . ? 1_555 ? 18 AC3 17 GLU A 88 ? GLU A 87 . ? 1_555 ? 19 AC3 17 TYR A 89 ? TYR A 88 . ? 1_555 ? 20 AC3 17 CYS A 90 ? CYS A 89 . ? 1_555 ? 21 AC3 17 GLY A 93 ? GLY A 92 . ? 1_555 ? 22 AC3 17 GLU A 94 ? GLU A 93 . ? 1_555 ? 23 AC3 17 LEU A 140 ? LEU A 139 . ? 1_555 ? 24 AC3 17 ILE A 150 ? ILE A 149 . ? 1_555 ? 25 AC3 17 ASP A 151 ? ASP A 150 . ? 1_555 ? # _atom_sites.entry_id 5MAF _atom_sites.fract_transf_matrix[1][1] 0.016691 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015695 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010954 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 ? ? ? A . n A 1 2 PRO 2 1 1 PRO PRO A . n A 1 3 LYS 3 2 2 LYS LYS A . n A 1 4 ASP 4 3 3 ASP ASP A . n A 1 5 TYR 5 4 4 TYR TYR A . n A 1 6 ASP 6 5 5 ASP ASP A . n A 1 7 GLU 7 6 6 GLU GLU A . n A 1 8 LEU 8 7 7 LEU LEU A . n A 1 9 LEU 9 8 8 LEU LEU A . n A 1 10 LYS 10 9 9 LYS LYS A . n A 1 11 TYR 11 10 10 TYR TYR A . n A 1 12 TYR 12 11 11 TYR TYR A . n A 1 13 GLU 13 12 12 GLU GLU A . n A 1 14 LEU 14 13 13 LEU LEU A . n A 1 15 HIS 15 14 14 HIS HIS A . n A 1 16 GLU 16 15 15 GLU GLU A . n A 1 17 THR 17 16 16 THR THR A . n A 1 18 ILE 18 17 17 ILE ILE A . n A 1 19 GLY 19 18 18 GLY GLY A . n A 1 20 THR 20 19 19 THR THR A . n A 1 21 GLY 21 20 20 GLY GLY A . n A 1 22 GLY 22 21 21 GLY GLY A . n A 1 23 PHE 23 22 22 PHE PHE A . n A 1 24 ALA 24 23 23 ALA ALA A . n A 1 25 LYS 25 24 24 LYS LYS A . n A 1 26 VAL 26 25 25 VAL VAL A . n A 1 27 LYS 27 26 26 LYS LYS A . n A 1 28 LEU 28 27 27 LEU LEU A . n A 1 29 ALA 29 28 28 ALA ALA A . n A 1 30 CYS 30 29 29 CYS CYS A . n A 1 31 HIS 31 30 30 HIS HIS A . n A 1 32 ILE 32 31 31 ILE ILE A . n A 1 33 LEU 33 32 32 LEU LEU A . n A 1 34 THR 34 33 33 THR THR A . n A 1 35 GLY 35 34 34 GLY GLY A . n A 1 36 GLU 36 35 35 GLU GLU A . n A 1 37 MET 37 36 36 MET MET A . n A 1 38 VAL 38 37 37 VAL VAL A . n A 1 39 ALA 39 38 38 ALA ALA A . n A 1 40 ILE 40 39 39 ILE ILE A . n A 1 41 LYS 41 40 40 LYS LYS A . n A 1 42 ILE 42 41 41 ILE ILE A . n A 1 43 MET 43 42 42 MET MET A . n A 1 44 ASP 44 43 43 ASP ASP A . n A 1 45 LYS 45 44 44 LYS LYS A . n A 1 46 ASN 46 45 45 ASN ASN A . n A 1 47 THR 47 46 46 THR THR A . n A 1 48 LEU 48 47 47 LEU LEU A . n A 1 49 GLY 49 48 ? ? ? A . n A 1 50 SER 50 49 ? ? ? A . n A 1 51 ASP 51 50 50 ASP ASP A . n A 1 52 LEU 52 51 51 LEU LEU A . n A 1 53 PRO 53 52 52 PRO PRO A . n A 1 54 ARG 54 53 53 ARG ARG A . n A 1 55 ILE 55 54 54 ILE ILE A . n A 1 56 LYS 56 55 55 LYS LYS A . n A 1 57 THR 57 56 56 THR THR A . n A 1 58 GLU 58 57 57 GLU GLU A . n A 1 59 ILE 59 58 58 ILE ILE A . n A 1 60 GLU 60 59 59 GLU GLU A . n A 1 61 ALA 61 60 60 ALA ALA A . n A 1 62 LEU 62 61 61 LEU LEU A . n A 1 63 LYS 63 62 62 LYS LYS A . n A 1 64 ASN 64 63 63 ASN ASN A . n A 1 65 LEU 65 64 64 LEU LEU A . n A 1 66 ARG 66 65 65 ARG ARG A . n A 1 67 HIS 67 66 66 HIS HIS A . n A 1 68 GLN 68 67 67 GLN GLN A . n A 1 69 HIS 69 68 68 HIS HIS A . n A 1 70 ILE 70 69 69 ILE ILE A . n A 1 71 CYS 71 70 70 CYS CYS A . n A 1 72 GLN 72 71 71 GLN GLN A . n A 1 73 LEU 73 72 72 LEU LEU A . n A 1 74 TYR 74 73 73 TYR TYR A . n A 1 75 HIS 75 74 74 HIS HIS A . n A 1 76 VAL 76 75 75 VAL VAL A . n A 1 77 LEU 77 76 76 LEU LEU A . n A 1 78 GLU 78 77 77 GLU GLU A . n A 1 79 THR 79 78 78 THR THR A . n A 1 80 ALA 80 79 79 ALA ALA A . n A 1 81 ASN 81 80 80 ASN ASN A . n A 1 82 LYS 82 81 81 LYS LYS A . n A 1 83 ILE 83 82 82 ILE ILE A . n A 1 84 PHE 84 83 83 PHE PHE A . n A 1 85 MET 85 84 84 MET MET A . n A 1 86 VAL 86 85 85 VAL VAL A . n A 1 87 LEU 87 86 86 LEU LEU A . n A 1 88 GLU 88 87 87 GLU GLU A . n A 1 89 TYR 89 88 88 TYR TYR A . n A 1 90 CYS 90 89 89 CYS CYS A . n A 1 91 PRO 91 90 90 PRO PRO A . n A 1 92 GLY 92 91 91 GLY GLY A . n A 1 93 GLY 93 92 92 GLY GLY A . n A 1 94 GLU 94 93 93 GLU GLU A . n A 1 95 LEU 95 94 94 LEU LEU A . n A 1 96 PHE 96 95 95 PHE PHE A . n A 1 97 ASP 97 96 96 ASP ASP A . n A 1 98 TYR 98 97 97 TYR TYR A . n A 1 99 ILE 99 98 98 ILE ILE A . n A 1 100 ILE 100 99 99 ILE ILE A . n A 1 101 SER 101 100 100 SER SER A . n A 1 102 GLN 102 101 101 GLN GLN A . n A 1 103 ASP 103 102 102 ASP ASP A . n A 1 104 ARG 104 103 103 ARG ARG A . n A 1 105 LEU 105 104 104 LEU LEU A . n A 1 106 SER 106 105 105 SER SER A . n A 1 107 GLU 107 106 106 GLU GLU A . n A 1 108 GLU 108 107 107 GLU GLU A . n A 1 109 GLU 109 108 108 GLU GLU A . n A 1 110 THR 110 109 109 THR THR A . n A 1 111 ARG 111 110 110 ARG ARG A . n A 1 112 VAL 112 111 111 VAL VAL A . n A 1 113 VAL 113 112 112 VAL VAL A . n A 1 114 PHE 114 113 113 PHE PHE A . n A 1 115 ARG 115 114 114 ARG ARG A . n A 1 116 GLN 116 115 115 GLN GLN A . n A 1 117 ILE 117 116 116 ILE ILE A . n A 1 118 VAL 118 117 117 VAL VAL A . n A 1 119 SER 119 118 118 SER SER A . n A 1 120 ALA 120 119 119 ALA ALA A . n A 1 121 VAL 121 120 120 VAL VAL A . n A 1 122 ALA 122 121 121 ALA ALA A . n A 1 123 TYR 123 122 122 TYR TYR A . n A 1 124 VAL 124 123 123 VAL VAL A . n A 1 125 HIS 125 124 124 HIS HIS A . n A 1 126 SER 126 125 125 SER SER A . n A 1 127 GLN 127 126 126 GLN GLN A . n A 1 128 GLY 128 127 127 GLY GLY A . n A 1 129 TYR 129 128 128 TYR TYR A . n A 1 130 ALA 130 129 129 ALA ALA A . n A 1 131 HIS 131 130 130 HIS HIS A . n A 1 132 ARG 132 131 131 ARG ARG A . n A 1 133 ASP 133 132 132 ASP ASP A . n A 1 134 LEU 134 133 133 LEU LEU A . n A 1 135 LYS 135 134 134 LYS LYS A . n A 1 136 PRO 136 135 135 PRO PRO A . n A 1 137 GLU 137 136 136 GLU GLU A . n A 1 138 ASN 138 137 137 ASN ASN A . n A 1 139 LEU 139 138 138 LEU LEU A . n A 1 140 LEU 140 139 139 LEU LEU A . n A 1 141 PHE 141 140 140 PHE PHE A . n A 1 142 ASP 142 141 141 ASP ASP A . n A 1 143 GLU 143 142 142 GLU GLU A . n A 1 144 TYR 144 143 143 TYR TYR A . n A 1 145 HIS 145 144 144 HIS HIS A . n A 1 146 LYS 146 145 145 LYS LYS A . n A 1 147 LEU 147 146 146 LEU LEU A . n A 1 148 LYS 148 147 147 LYS LYS A . n A 1 149 LEU 149 148 148 LEU LEU A . n A 1 150 ILE 150 149 149 ILE ILE A . n A 1 151 ASP 151 150 150 ASP ASP A . n A 1 152 PHE 152 151 151 PHE PHE A . n A 1 153 GLY 153 152 152 GLY GLY A . n A 1 154 LEU 154 153 153 LEU LEU A . n A 1 155 CYS 155 154 154 CYS CYS A . n A 1 156 ALA 156 155 155 ALA ALA A . n A 1 157 LYS 157 156 156 LYS LYS A . n A 1 158 PRO 158 157 ? ? ? A . n A 1 159 LYS 159 158 ? ? ? A . n A 1 160 GLY 160 159 ? ? ? A . n A 1 161 ASN 161 160 ? ? ? A . n A 1 162 LYS 162 161 ? ? ? A . n A 1 163 ASP 163 162 ? ? ? A . n A 1 164 TYR 164 163 ? ? ? A . n A 1 165 HIS 165 164 ? ? ? A . n A 1 166 LEU 166 165 ? ? ? A . n A 1 167 GLN 167 166 ? ? ? A . n A 1 168 THR 168 167 ? ? ? A . n A 1 169 CYS 169 168 ? ? ? A . n A 1 170 CYS 170 169 ? ? ? A . n A 1 171 GLY 171 170 ? ? ? A . n A 1 172 SER 172 171 171 SER SER A . n A 1 173 LEU 173 172 172 LEU LEU A . n A 1 174 ALA 174 173 173 ALA ALA A . n A 1 175 TYR 175 174 174 TYR TYR A . n A 1 176 ALA 176 175 175 ALA ALA A . n A 1 177 ALA 177 176 176 ALA ALA A . n A 1 178 PRO 178 177 177 PRO PRO A . n A 1 179 GLU 179 178 178 GLU GLU A . n A 1 180 LEU 180 179 179 LEU LEU A . n A 1 181 ILE 181 180 180 ILE ILE A . n A 1 182 GLN 182 181 181 GLN GLN A . n A 1 183 GLY 183 182 182 GLY GLY A . n A 1 184 LYS 184 183 183 LYS LYS A . n A 1 185 SER 185 184 ? ? ? A . n A 1 186 TYR 186 185 ? ? ? A . n A 1 187 LEU 187 186 186 LEU LEU A . n A 1 188 GLY 188 187 187 GLY GLY A . n A 1 189 SER 189 188 188 SER SER A . n A 1 190 GLU 190 189 189 GLU GLU A . n A 1 191 ALA 191 190 190 ALA ALA A . n A 1 192 ASP 192 191 191 ASP ASP A . n A 1 193 VAL 193 192 192 VAL VAL A . n A 1 194 TRP 194 193 193 TRP TRP A . n A 1 195 SER 195 194 194 SER SER A . n A 1 196 MET 196 195 195 MET MET A . n A 1 197 GLY 197 196 196 GLY GLY A . n A 1 198 ILE 198 197 197 ILE ILE A . n A 1 199 LEU 199 198 198 LEU LEU A . n A 1 200 LEU 200 199 199 LEU LEU A . n A 1 201 TYR 201 200 200 TYR TYR A . n A 1 202 VAL 202 201 201 VAL VAL A . n A 1 203 LEU 203 202 202 LEU LEU A . n A 1 204 MET 204 203 203 MET MET A . n A 1 205 CYS 205 204 204 CYS CYS A . n A 1 206 GLY 206 205 205 GLY GLY A . n A 1 207 PHE 207 206 206 PHE PHE A . n A 1 208 LEU 208 207 207 LEU LEU A . n A 1 209 PRO 209 208 208 PRO PRO A . n A 1 210 PHE 210 209 209 PHE PHE A . n A 1 211 ASP 211 210 210 ASP ASP A . n A 1 212 ASP 212 211 211 ASP ASP A . n A 1 213 ASP 213 212 212 ASP ASP A . n A 1 214 ASN 214 213 213 ASN ASN A . n A 1 215 VAL 215 214 214 VAL VAL A . n A 1 216 MET 216 215 215 MET MET A . n A 1 217 ALA 217 216 216 ALA ALA A . n A 1 218 LEU 218 217 217 LEU LEU A . n A 1 219 TYR 219 218 218 TYR TYR A . n A 1 220 LYS 220 219 219 LYS LYS A . n A 1 221 LYS 221 220 220 LYS LYS A . n A 1 222 ILE 222 221 221 ILE ILE A . n A 1 223 MET 223 222 222 MET MET A . n A 1 224 ARG 224 223 223 ARG ARG A . n A 1 225 GLY 225 224 224 GLY GLY A . n A 1 226 LYS 226 225 225 LYS LYS A . n A 1 227 TYR 227 226 226 TYR TYR A . n A 1 228 ASP 228 227 227 ASP ASP A . n A 1 229 VAL 229 228 228 VAL VAL A . n A 1 230 PRO 230 229 229 PRO PRO A . n A 1 231 LYS 231 230 230 LYS LYS A . n A 1 232 TRP 232 231 231 TRP TRP A . n A 1 233 LEU 233 232 232 LEU LEU A . n A 1 234 SER 234 233 233 SER SER A . n A 1 235 PRO 235 234 234 PRO PRO A . n A 1 236 SER 236 235 235 SER SER A . n A 1 237 SER 237 236 236 SER SER A . n A 1 238 ILE 238 237 237 ILE ILE A . n A 1 239 LEU 239 238 238 LEU LEU A . n A 1 240 LEU 240 239 239 LEU LEU A . n A 1 241 LEU 241 240 240 LEU LEU A . n A 1 242 GLN 242 241 241 GLN GLN A . n A 1 243 GLN 243 242 242 GLN GLN A . n A 1 244 MET 244 243 243 MET MET A . n A 1 245 LEU 245 244 244 LEU LEU A . n A 1 246 GLN 246 245 245 GLN GLN A . n A 1 247 VAL 247 246 246 VAL VAL A . n A 1 248 ASP 248 247 247 ASP ASP A . n A 1 249 PRO 249 248 248 PRO PRO A . n A 1 250 LYS 250 249 249 LYS LYS A . n A 1 251 LYS 251 250 250 LYS LYS A . n A 1 252 ARG 252 251 251 ARG ARG A . n A 1 253 ILE 253 252 252 ILE ILE A . n A 1 254 SER 254 253 253 SER SER A . n A 1 255 MET 255 254 254 MET MET A . n A 1 256 LYS 256 255 255 LYS LYS A . n A 1 257 ASN 257 256 256 ASN ASN A . n A 1 258 LEU 258 257 257 LEU LEU A . n A 1 259 LEU 259 258 258 LEU LEU A . n A 1 260 ASN 260 259 259 ASN ASN A . n A 1 261 HIS 261 260 260 HIS HIS A . n A 1 262 PRO 262 261 261 PRO PRO A . n A 1 263 TRP 263 262 262 TRP TRP A . n A 1 264 ILE 264 263 263 ILE ILE A . n A 1 265 MET 265 264 264 MET MET A . n A 1 266 GLN 266 265 265 GLN GLN A . n A 1 267 ASP 267 266 266 ASP ASP A . n A 1 268 TYR 268 267 267 TYR TYR A . n A 1 269 ASN 269 268 268 ASN ASN A . n A 1 270 TYR 270 269 269 TYR TYR A . n A 1 271 PRO 271 270 270 PRO PRO A . n A 1 272 VAL 272 271 271 VAL VAL A . n A 1 273 GLU 273 272 272 GLU GLU A . n A 1 274 TRP 274 273 273 TRP TRP A . n A 1 275 GLN 275 274 274 GLN GLN A . n A 1 276 SER 276 275 275 SER SER A . n A 1 277 LYS 277 276 276 LYS LYS A . n A 1 278 ASN 278 277 277 ASN ASN A . n A 1 279 PRO 279 278 278 PRO PRO A . n A 1 280 PHE 280 279 279 PHE PHE A . n A 1 281 ILE 281 280 280 ILE ILE A . n A 1 282 HIS 282 281 281 HIS HIS A . n A 1 283 LEU 283 282 282 LEU LEU A . n A 1 284 ASP 284 283 283 ASP ASP A . n A 1 285 ASP 285 284 284 ASP ASP A . n A 1 286 ASP 286 285 285 ASP ASP A . n A 1 287 CYS 287 286 286 CYS CYS A . n A 1 288 VAL 288 287 287 VAL VAL A . n A 1 289 THR 289 288 288 THR THR A . n A 1 290 GLU 290 289 289 GLU GLU A . n A 1 291 LEU 291 290 290 LEU LEU A . n A 1 292 SER 292 291 291 SER SER A . n A 1 293 VAL 293 292 292 VAL VAL A . n A 1 294 HIS 294 293 293 HIS HIS A . n A 1 295 HIS 295 294 294 HIS HIS A . n A 1 296 ARG 296 295 295 ARG ARG A . n A 1 297 ASN 297 296 296 ASN ASN A . n A 1 298 ASN 298 297 297 ASN ASN A . n A 1 299 ARG 299 298 298 ARG ARG A . n A 1 300 GLN 300 299 299 GLN GLN A . n A 1 301 THR 301 300 300 THR THR A . n A 1 302 MET 302 301 301 MET MET A . n A 1 303 GLU 303 302 302 GLU GLU A . n A 1 304 ASP 304 303 303 ASP ASP A . n A 1 305 LEU 305 304 304 LEU LEU A . n A 1 306 ILE 306 305 305 ILE ILE A . n A 1 307 SER 307 306 306 SER SER A . n A 1 308 LEU 308 307 307 LEU LEU A . n A 1 309 TRP 309 308 308 TRP TRP A . n A 1 310 GLN 310 309 309 GLN GLN A . n A 1 311 TYR 311 310 310 TYR TYR A . n A 1 312 ASP 312 311 311 ASP ASP A . n A 1 313 HIS 313 312 312 HIS HIS A . n A 1 314 LEU 314 313 313 LEU LEU A . n A 1 315 THR 315 314 314 THR THR A . n A 1 316 ALA 316 315 315 ALA ALA A . n A 1 317 THR 317 316 316 THR THR A . n A 1 318 TYR 318 317 317 TYR TYR A . n A 1 319 LEU 319 318 318 LEU LEU A . n A 1 320 LEU 320 319 319 LEU LEU A . n A 1 321 LEU 321 320 320 LEU LEU A . n A 1 322 LEU 322 321 321 LEU LEU A . n A 1 323 ALA 323 322 322 ALA ALA A . n A 1 324 LYS 324 323 323 LYS LYS A . n A 1 325 LYS 325 324 324 LYS LYS A . n A 1 326 ALA 326 325 325 ALA ALA A . n A 1 327 ARG 327 326 326 ARG ARG A . n A 1 328 GLY 328 327 327 GLY GLY A . n A 1 329 LYS 329 328 328 LYS LYS A . n A 1 330 PRO 330 329 329 PRO PRO A . n A 1 331 VAL 331 330 330 VAL VAL A . n A 1 332 ARG 332 331 331 ARG ARG A . n A 1 333 LEU 333 332 332 LEU LEU A . n A 1 334 ARG 334 333 333 ARG ARG A . n A 1 335 LEU 335 334 ? ? ? A . n A 1 336 SER 336 335 ? ? ? A . n A 1 337 SER 337 336 ? ? ? A . n A 1 338 PHE 338 337 ? ? ? A . n A 1 339 SER 339 338 ? ? ? A . n A 1 340 CYS 340 339 ? ? ? A . n A 1 341 GLY 341 340 ? ? ? A . n A 1 342 HIS 342 341 ? ? ? A . n A 1 343 HIS 343 342 ? ? ? A . n A 1 344 HIS 344 343 ? ? ? A . n A 1 345 HIS 345 344 ? ? ? A . n A 1 346 HIS 346 345 ? ? ? A . n A 1 347 HIS 347 346 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 DMS 1 401 1 DMS DMS A . C 3 CL 1 402 1 CL CL A . D 4 XIN 1 403 1 XIN XIN A . E 5 HOH 1 501 60 HOH HOH A . E 5 HOH 2 502 70 HOH HOH A . E 5 HOH 3 503 10 HOH HOH A . E 5 HOH 4 504 12 HOH HOH A . E 5 HOH 5 505 3 HOH HOH A . E 5 HOH 6 506 5 HOH HOH A . E 5 HOH 7 507 18 HOH HOH A . E 5 HOH 8 508 25 HOH HOH A . E 5 HOH 9 509 8 HOH HOH A . E 5 HOH 10 510 15 HOH HOH A . E 5 HOH 11 511 38 HOH HOH A . E 5 HOH 12 512 54 HOH HOH A . E 5 HOH 13 513 68 HOH HOH A . E 5 HOH 14 514 21 HOH HOH A . E 5 HOH 15 515 11 HOH HOH A . E 5 HOH 16 516 26 HOH HOH A . E 5 HOH 17 517 72 HOH HOH A . E 5 HOH 18 518 1 HOH HOH A . E 5 HOH 19 519 27 HOH HOH A . E 5 HOH 20 520 6 HOH HOH A . E 5 HOH 21 521 40 HOH HOH A . E 5 HOH 22 522 37 HOH HOH A . E 5 HOH 23 523 34 HOH HOH A . E 5 HOH 24 524 28 HOH HOH A . E 5 HOH 25 525 19 HOH HOH A . E 5 HOH 26 526 23 HOH HOH A . E 5 HOH 27 527 29 HOH HOH A . E 5 HOH 28 528 30 HOH HOH A . E 5 HOH 29 529 53 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 410 ? 1 MORE -4 ? 1 'SSA (A^2)' 15130 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-12-06 2 'Structure model' 1 1 2017-12-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.pdbx_database_id_PubMed' 3 2 'Structure model' '_citation.title' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0151 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 14 ? ? -102.81 -155.83 2 1 THR A 19 ? ? -160.87 98.71 3 1 TYR A 73 ? ? -120.39 -51.29 4 1 ASP A 132 ? ? -164.06 44.80 5 1 ASP A 150 ? ? 54.31 75.20 6 1 LEU A 244 ? ? -106.64 41.40 7 1 TYR A 267 ? ? -133.10 -57.90 8 1 HIS A 281 ? ? 54.91 -143.57 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 0 ? A GLY 1 2 1 Y 1 A GLY 48 ? A GLY 49 3 1 Y 1 A SER 49 ? A SER 50 4 1 Y 1 A PRO 157 ? A PRO 158 5 1 Y 1 A LYS 158 ? A LYS 159 6 1 Y 1 A GLY 159 ? A GLY 160 7 1 Y 1 A ASN 160 ? A ASN 161 8 1 Y 1 A LYS 161 ? A LYS 162 9 1 Y 1 A ASP 162 ? A ASP 163 10 1 Y 1 A TYR 163 ? A TYR 164 11 1 Y 1 A HIS 164 ? A HIS 165 12 1 Y 1 A LEU 165 ? A LEU 166 13 1 Y 1 A GLN 166 ? A GLN 167 14 1 Y 1 A THR 167 ? A THR 168 15 1 Y 1 A CYS 168 ? A CYS 169 16 1 Y 1 A CYS 169 ? A CYS 170 17 1 Y 1 A GLY 170 ? A GLY 171 18 1 Y 1 A SER 184 ? A SER 185 19 1 Y 1 A TYR 185 ? A TYR 186 20 1 Y 1 A LEU 334 ? A LEU 335 21 1 Y 1 A SER 335 ? A SER 336 22 1 Y 1 A SER 336 ? A SER 337 23 1 Y 1 A PHE 337 ? A PHE 338 24 1 Y 1 A SER 338 ? A SER 339 25 1 Y 1 A CYS 339 ? A CYS 340 26 1 Y 1 A GLY 340 ? A GLY 341 27 1 Y 1 A HIS 341 ? A HIS 342 28 1 Y 1 A HIS 342 ? A HIS 343 29 1 Y 1 A HIS 343 ? A HIS 344 30 1 Y 1 A HIS 344 ? A HIS 345 31 1 Y 1 A HIS 345 ? A HIS 346 32 1 Y 1 A HIS 346 ? A HIS 347 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'DIMETHYL SULFOXIDE' DMS 3 'CHLORIDE ION' CL 4 ;methyl (3Z)-3-{[(4-{methyl[(4-methylpiperazin-1-yl)acetyl]amino}phenyl)amino](phenyl)methylidene}-2-oxo-2,3-dihydro-1H-indole-6-carboxylate ; XIN 5 water HOH #