data_5MJ0 # _entry.id 5MJ0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5MJ0 WWPDB D_1200002539 # _pdbx_database_related.db_name PDB _pdbx_database_related.details '5MIX is the same protein, but a different crystal form (space group P321)' _pdbx_database_related.db_id 5MIX _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5MJ0 _pdbx_database_status.recvd_initial_deposition_date 2016-11-29 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Klingl, S.' 1 'Egerer-Sieber, C.' 2 'Schmid, B.' 3 'Muller, Y.A.' 4 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Mol. Biol.' _citation.journal_id_ASTM JMOBAK _citation.journal_id_CSD 0070 _citation.journal_id_ISSN 1089-8638 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 429 _citation.language ? _citation.page_first 1227 _citation.page_last 1243 _citation.title 'Crystal Structure of the Extracellular Domain of the Human Dendritic Cell Surface Marker CD83.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jmb.2017.03.009 _citation.pdbx_database_id_PubMed 28315353 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Heilingloh, C.S.' 1 primary 'Klingl, S.' 2 primary 'Egerer-Sieber, C.' 3 primary 'Schmid, B.' 4 primary 'Weiler, S.' 5 primary 'Muhl-Zurbes, P.' 6 primary 'Hofmann, J.' 7 primary 'Stump, J.D.' 8 primary 'Sticht, H.' 9 primary 'Kummer, M.' 10 primary 'Steinkasserer, A.' 11 primary 'Muller, Y.A.' 12 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5MJ0 _cell.details ? _cell.formula_units_Z ? _cell.length_a 149.564 _cell.length_a_esd ? _cell.length_b 149.564 _cell.length_b_esd ? _cell.length_c 149.564 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 96 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5MJ0 _symmetry.cell_setting ? _symmetry.Int_Tables_number 214 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 41 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'CD83 antigen' _entity.formula_weight 12766.979 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation 'C27S, C100S, C129S' _entity.pdbx_fragment ? _entity.details ;The first four residues (GSPG) are non-native residues of the linker which remains after the GST-tag was cleaved off. The first and last two residues as well as the central region were not visible in the electron density maps. ; # _entity_name_com.entity_id 1 _entity_name_com.name 'hCD83,B-cell activation protein,Cell surface protein HB15' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSPGTPEVKVASSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIR NTTSSNSGTYRCTLQDPDGQRNLSGKVILRVTGSPA ; _entity_poly.pdbx_seq_one_letter_code_can ;GSPGTPEVKVASSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIR NTTSSNSGTYRCTLQDPDGQRNLSGKVILRVTGSPA ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 PRO n 1 4 GLY n 1 5 THR n 1 6 PRO n 1 7 GLU n 1 8 VAL n 1 9 LYS n 1 10 VAL n 1 11 ALA n 1 12 SER n 1 13 SER n 1 14 GLU n 1 15 ASP n 1 16 VAL n 1 17 ASP n 1 18 LEU n 1 19 PRO n 1 20 CYS n 1 21 THR n 1 22 ALA n 1 23 PRO n 1 24 TRP n 1 25 ASP n 1 26 PRO n 1 27 GLN n 1 28 VAL n 1 29 PRO n 1 30 TYR n 1 31 THR n 1 32 VAL n 1 33 SER n 1 34 TRP n 1 35 VAL n 1 36 LYS n 1 37 LEU n 1 38 LEU n 1 39 GLU n 1 40 GLY n 1 41 GLY n 1 42 GLU n 1 43 GLU n 1 44 ARG n 1 45 MET n 1 46 GLU n 1 47 THR n 1 48 PRO n 1 49 GLN n 1 50 GLU n 1 51 ASP n 1 52 HIS n 1 53 LEU n 1 54 ARG n 1 55 GLY n 1 56 GLN n 1 57 HIS n 1 58 TYR n 1 59 HIS n 1 60 GLN n 1 61 LYS n 1 62 GLY n 1 63 GLN n 1 64 ASN n 1 65 GLY n 1 66 SER n 1 67 PHE n 1 68 ASP n 1 69 ALA n 1 70 PRO n 1 71 ASN n 1 72 GLU n 1 73 ARG n 1 74 PRO n 1 75 TYR n 1 76 SER n 1 77 LEU n 1 78 LYS n 1 79 ILE n 1 80 ARG n 1 81 ASN n 1 82 THR n 1 83 THR n 1 84 SER n 1 85 SER n 1 86 ASN n 1 87 SER n 1 88 GLY n 1 89 THR n 1 90 TYR n 1 91 ARG n 1 92 CYS n 1 93 THR n 1 94 LEU n 1 95 GLN n 1 96 ASP n 1 97 PRO n 1 98 ASP n 1 99 GLY n 1 100 GLN n 1 101 ARG n 1 102 ASN n 1 103 LEU n 1 104 SER n 1 105 GLY n 1 106 LYS n 1 107 VAL n 1 108 ILE n 1 109 LEU n 1 110 ARG n 1 111 VAL n 1 112 THR n 1 113 GLY n 1 114 SER n 1 115 PRO n 1 116 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 116 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CD83 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell 'Dendritic cells' _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ; Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX-2T _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CD83_HUMAN _struct_ref.pdbx_db_accession Q01151 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;APATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRN TTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPA ; _struct_ref.pdbx_align_begin 17 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5MJ0 A 2 ? 116 ? Q01151 17 ? 131 ? 17 131 2 1 5MJ0 B 2 ? 116 ? Q01151 17 ? 131 ? 17 131 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5MJ0 GLY A 1 ? UNP Q01151 ? ? 'expression tag' 16 1 1 5MJ0 SER A 2 ? UNP Q01151 ALA 17 'expression tag' 17 2 1 5MJ0 GLY A 4 ? UNP Q01151 ALA 19 'expression tag' 19 3 1 5MJ0 SER A 12 ? UNP Q01151 CYS 27 'engineered mutation' 27 4 1 5MJ0 SER A 85 ? UNP Q01151 CYS 100 'engineered mutation' 100 5 1 5MJ0 SER A 114 ? UNP Q01151 CYS 129 'engineered mutation' 129 6 2 5MJ0 GLY B 1 ? UNP Q01151 ? ? 'expression tag' 16 7 2 5MJ0 SER B 2 ? UNP Q01151 ALA 17 'expression tag' 17 8 2 5MJ0 GLY B 4 ? UNP Q01151 ALA 19 'expression tag' 19 9 2 5MJ0 SER B 12 ? UNP Q01151 CYS 27 'engineered mutation' 27 10 2 5MJ0 SER B 85 ? UNP Q01151 CYS 100 'engineered mutation' 100 11 2 5MJ0 SER B 114 ? UNP Q01151 CYS 129 'engineered mutation' 129 12 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5MJ0 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.73 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 54.94 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.2 microliter protein (21 mg/ml in 25 mM Tris-HCl (pH 7.2) buffer) were mixed with 0.2 microliter reservoir solution (0.2 M L-proline, 0.1 M HEPES (pH 7.5), 24% w/v PEG 1500) and equilibrated against 70 microliter of reservoir solution Crystals appeared after ~ 10 months ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-04-06 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.918007 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'BESSY BEAMLINE 14.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.918007 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 14.1 _diffrn_source.pdbx_synchrotron_site BESSY # _reflns.B_iso_Wilson_estimate 103.8 _reflns.entry_id 5MJ0 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.20 _reflns.d_resolution_low 47.30 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 4984 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.6 _reflns.pdbx_Rmerge_I_obs 0.078 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 25.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 3.20 _reflns_shell.d_res_low 3.39 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.0 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 99.2 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.353 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 13.0 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5MJ0 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.20 _refine.ls_d_res_low 47.296 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 4982 _refine.ls_number_reflns_R_free 250 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.70 _refine.ls_percent_reflns_R_free 5.02 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2388 _refine.ls_R_factor_R_free 0.2636 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2373 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 31.83 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.52 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1222 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1222 _refine_hist.d_res_high 3.20 _refine_hist.d_res_low 47.296 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? 1250 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.345 ? 1705 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 13.733 ? 468 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.053 ? 199 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 218 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.1974 4.0281 . . 122 2302 100.00 . . . 0.3419 . 0.3115 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.0281 47.3014 . . 128 2430 100.00 . . . 0.2436 . 0.2179 . . . . . . . . . . # _struct.entry_id 5MJ0 _struct.title 'Extracellular domain of human CD83 - cubic crystal form' _struct.pdbx_descriptor 'CD83 antigen' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5MJ0 _struct_keywords.text 'Dendritic cell, receptor, immunoglobulin, immune system' _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 83 ? SER A 87 ? THR A 98 SER A 102 5 ? 5 HELX_P HELX_P2 AA2 THR B 83 ? SER B 87 ? THR B 98 SER B 102 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 20 SG ? ? ? 1_555 A CYS 92 SG ? ? A CYS 35 A CYS 107 1_555 ? ? ? ? ? ? ? 2.038 ? disulf2 disulf ? ? B CYS 20 SG ? ? ? 1_555 B CYS 92 SG ? ? B CYS 35 B CYS 107 1_555 ? ? ? ? ? ? ? 2.036 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 8 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 7 ? ALA A 11 ? GLU A 22 ALA A 26 AA1 2 ASN A 102 ? THR A 112 ? ASN A 117 THR A 127 AA1 3 GLY A 88 ? GLN A 95 ? GLY A 103 GLN A 110 AA1 4 THR A 31 ? LEU A 37 ? THR A 46 LEU A 52 AA1 5 THR B 31 ? LEU B 38 ? THR B 46 LEU B 53 AA1 6 GLY B 88 ? GLN B 95 ? GLY B 103 GLN B 110 AA1 7 ASN B 102 ? THR B 112 ? ASN B 117 THR B 127 AA1 8 GLU B 7 ? ALA B 11 ? GLU B 22 ALA B 26 AA2 1 VAL A 16 ? LEU A 18 ? VAL A 31 LEU A 33 AA2 2 LEU A 77 ? ILE A 79 ? LEU A 92 ILE A 94 AA3 1 VAL B 16 ? LEU B 18 ? VAL B 31 LEU B 33 AA3 2 LEU B 77 ? ILE B 79 ? LEU B 92 ILE B 94 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 8 ? N VAL A 23 O ILE A 108 ? O ILE A 123 AA1 2 3 O LEU A 103 ? O LEU A 118 N LEU A 94 ? N LEU A 109 AA1 3 4 O THR A 89 ? O THR A 104 N LEU A 37 ? N LEU A 52 AA1 4 5 N TRP A 34 ? N TRP A 49 O LEU B 38 ? O LEU B 53 AA1 5 6 N VAL B 35 ? N VAL B 50 O ARG B 91 ? O ARG B 106 AA1 6 7 N TYR B 90 ? N TYR B 105 O VAL B 107 ? O VAL B 122 AA1 7 8 O ILE B 108 ? O ILE B 123 N VAL B 8 ? N VAL B 23 AA2 1 2 N VAL A 16 ? N VAL A 31 O ILE A 79 ? O ILE A 94 AA3 1 2 N LEU B 18 ? N LEU B 33 O LEU B 77 ? O LEU B 92 # _atom_sites.entry_id 5MJ0 _atom_sites.fract_transf_matrix[1][1] 0.006686 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006686 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006686 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 16 ? ? ? A . n A 1 2 SER 2 17 ? ? ? A . n A 1 3 PRO 3 18 18 PRO PRO A . n A 1 4 GLY 4 19 19 GLY GLY A . n A 1 5 THR 5 20 20 THR THR A . n A 1 6 PRO 6 21 21 PRO PRO A . n A 1 7 GLU 7 22 22 GLU GLU A . n A 1 8 VAL 8 23 23 VAL VAL A . n A 1 9 LYS 9 24 24 LYS LYS A . n A 1 10 VAL 10 25 25 VAL VAL A . n A 1 11 ALA 11 26 26 ALA ALA A . n A 1 12 SER 12 27 27 SER SER A . n A 1 13 SER 13 28 28 SER SER A . n A 1 14 GLU 14 29 29 GLU GLU A . n A 1 15 ASP 15 30 30 ASP ASP A . n A 1 16 VAL 16 31 31 VAL VAL A . n A 1 17 ASP 17 32 32 ASP ASP A . n A 1 18 LEU 18 33 33 LEU LEU A . n A 1 19 PRO 19 34 34 PRO PRO A . n A 1 20 CYS 20 35 35 CYS CYS A . n A 1 21 THR 21 36 36 THR THR A . n A 1 22 ALA 22 37 37 ALA ALA A . n A 1 23 PRO 23 38 38 PRO PRO A . n A 1 24 TRP 24 39 39 TRP TRP A . n A 1 25 ASP 25 40 40 ASP ASP A . n A 1 26 PRO 26 41 41 PRO PRO A . n A 1 27 GLN 27 42 42 GLN GLN A . n A 1 28 VAL 28 43 43 VAL VAL A . n A 1 29 PRO 29 44 44 PRO PRO A . n A 1 30 TYR 30 45 45 TYR TYR A . n A 1 31 THR 31 46 46 THR THR A . n A 1 32 VAL 32 47 47 VAL VAL A . n A 1 33 SER 33 48 48 SER SER A . n A 1 34 TRP 34 49 49 TRP TRP A . n A 1 35 VAL 35 50 50 VAL VAL A . n A 1 36 LYS 36 51 51 LYS LYS A . n A 1 37 LEU 37 52 52 LEU LEU A . n A 1 38 LEU 38 53 53 LEU LEU A . n A 1 39 GLU 39 54 ? ? ? A . n A 1 40 GLY 40 55 ? ? ? A . n A 1 41 GLY 41 56 ? ? ? A . n A 1 42 GLU 42 57 ? ? ? A . n A 1 43 GLU 43 58 ? ? ? A . n A 1 44 ARG 44 59 ? ? ? A . n A 1 45 MET 45 60 ? ? ? A . n A 1 46 GLU 46 61 ? ? ? A . n A 1 47 THR 47 62 ? ? ? A . n A 1 48 PRO 48 63 ? ? ? A . n A 1 49 GLN 49 64 ? ? ? A . n A 1 50 GLU 50 65 ? ? ? A . n A 1 51 ASP 51 66 ? ? ? A . n A 1 52 HIS 52 67 ? ? ? A . n A 1 53 LEU 53 68 ? ? ? A . n A 1 54 ARG 54 69 ? ? ? A . n A 1 55 GLY 55 70 ? ? ? A . n A 1 56 GLN 56 71 ? ? ? A . n A 1 57 HIS 57 72 ? ? ? A . n A 1 58 TYR 58 73 ? ? ? A . n A 1 59 HIS 59 74 ? ? ? A . n A 1 60 GLN 60 75 ? ? ? A . n A 1 61 LYS 61 76 ? ? ? A . n A 1 62 GLY 62 77 ? ? ? A . n A 1 63 GLN 63 78 ? ? ? A . n A 1 64 ASN 64 79 ? ? ? A . n A 1 65 GLY 65 80 ? ? ? A . n A 1 66 SER 66 81 ? ? ? A . n A 1 67 PHE 67 82 ? ? ? A . n A 1 68 ASP 68 83 ? ? ? A . n A 1 69 ALA 69 84 ? ? ? A . n A 1 70 PRO 70 85 ? ? ? A . n A 1 71 ASN 71 86 86 ASN ASN A . n A 1 72 GLU 72 87 87 GLU GLU A . n A 1 73 ARG 73 88 88 ARG ARG A . n A 1 74 PRO 74 89 89 PRO PRO A . n A 1 75 TYR 75 90 90 TYR TYR A . n A 1 76 SER 76 91 91 SER SER A . n A 1 77 LEU 77 92 92 LEU LEU A . n A 1 78 LYS 78 93 93 LYS LYS A . n A 1 79 ILE 79 94 94 ILE ILE A . n A 1 80 ARG 80 95 95 ARG ARG A . n A 1 81 ASN 81 96 96 ASN ASN A . n A 1 82 THR 82 97 97 THR THR A . n A 1 83 THR 83 98 98 THR THR A . n A 1 84 SER 84 99 99 SER SER A . n A 1 85 SER 85 100 100 SER SER A . n A 1 86 ASN 86 101 101 ASN ASN A . n A 1 87 SER 87 102 102 SER SER A . n A 1 88 GLY 88 103 103 GLY GLY A . n A 1 89 THR 89 104 104 THR THR A . n A 1 90 TYR 90 105 105 TYR TYR A . n A 1 91 ARG 91 106 106 ARG ARG A . n A 1 92 CYS 92 107 107 CYS CYS A . n A 1 93 THR 93 108 108 THR THR A . n A 1 94 LEU 94 109 109 LEU LEU A . n A 1 95 GLN 95 110 110 GLN GLN A . n A 1 96 ASP 96 111 111 ASP ASP A . n A 1 97 PRO 97 112 112 PRO PRO A . n A 1 98 ASP 98 113 113 ASP ASP A . n A 1 99 GLY 99 114 114 GLY GLY A . n A 1 100 GLN 100 115 115 GLN GLN A . n A 1 101 ARG 101 116 116 ARG ARG A . n A 1 102 ASN 102 117 117 ASN ASN A . n A 1 103 LEU 103 118 118 LEU LEU A . n A 1 104 SER 104 119 119 SER SER A . n A 1 105 GLY 105 120 120 GLY GLY A . n A 1 106 LYS 106 121 121 LYS LYS A . n A 1 107 VAL 107 122 122 VAL VAL A . n A 1 108 ILE 108 123 123 ILE ILE A . n A 1 109 LEU 109 124 124 LEU LEU A . n A 1 110 ARG 110 125 125 ARG ARG A . n A 1 111 VAL 111 126 126 VAL VAL A . n A 1 112 THR 112 127 127 THR THR A . n A 1 113 GLY 113 128 128 GLY GLY A . n A 1 114 SER 114 129 129 SER SER A . n A 1 115 PRO 115 130 ? ? ? A . n A 1 116 ALA 116 131 ? ? ? A . n B 1 1 GLY 1 16 ? ? ? B . n B 1 2 SER 2 17 ? ? ? B . n B 1 3 PRO 3 18 ? ? ? B . n B 1 4 GLY 4 19 19 GLY GLY B . n B 1 5 THR 5 20 20 THR THR B . n B 1 6 PRO 6 21 21 PRO PRO B . n B 1 7 GLU 7 22 22 GLU GLU B . n B 1 8 VAL 8 23 23 VAL VAL B . n B 1 9 LYS 9 24 24 LYS LYS B . n B 1 10 VAL 10 25 25 VAL VAL B . n B 1 11 ALA 11 26 26 ALA ALA B . n B 1 12 SER 12 27 27 SER SER B . n B 1 13 SER 13 28 28 SER SER B . n B 1 14 GLU 14 29 29 GLU GLU B . n B 1 15 ASP 15 30 30 ASP ASP B . n B 1 16 VAL 16 31 31 VAL VAL B . n B 1 17 ASP 17 32 32 ASP ASP B . n B 1 18 LEU 18 33 33 LEU LEU B . n B 1 19 PRO 19 34 34 PRO PRO B . n B 1 20 CYS 20 35 35 CYS CYS B . n B 1 21 THR 21 36 36 THR THR B . n B 1 22 ALA 22 37 37 ALA ALA B . n B 1 23 PRO 23 38 38 PRO PRO B . n B 1 24 TRP 24 39 39 TRP TRP B . n B 1 25 ASP 25 40 40 ASP ASP B . n B 1 26 PRO 26 41 41 PRO PRO B . n B 1 27 GLN 27 42 42 GLN GLN B . n B 1 28 VAL 28 43 43 VAL VAL B . n B 1 29 PRO 29 44 44 PRO PRO B . n B 1 30 TYR 30 45 45 TYR TYR B . n B 1 31 THR 31 46 46 THR THR B . n B 1 32 VAL 32 47 47 VAL VAL B . n B 1 33 SER 33 48 48 SER SER B . n B 1 34 TRP 34 49 49 TRP TRP B . n B 1 35 VAL 35 50 50 VAL VAL B . n B 1 36 LYS 36 51 51 LYS LYS B . n B 1 37 LEU 37 52 52 LEU LEU B . n B 1 38 LEU 38 53 53 LEU LEU B . n B 1 39 GLU 39 54 ? ? ? B . n B 1 40 GLY 40 55 ? ? ? B . n B 1 41 GLY 41 56 ? ? ? B . n B 1 42 GLU 42 57 ? ? ? B . n B 1 43 GLU 43 58 ? ? ? B . n B 1 44 ARG 44 59 ? ? ? B . n B 1 45 MET 45 60 ? ? ? B . n B 1 46 GLU 46 61 ? ? ? B . n B 1 47 THR 47 62 ? ? ? B . n B 1 48 PRO 48 63 ? ? ? B . n B 1 49 GLN 49 64 ? ? ? B . n B 1 50 GLU 50 65 ? ? ? B . n B 1 51 ASP 51 66 ? ? ? B . n B 1 52 HIS 52 67 ? ? ? B . n B 1 53 LEU 53 68 ? ? ? B . n B 1 54 ARG 54 69 ? ? ? B . n B 1 55 GLY 55 70 ? ? ? B . n B 1 56 GLN 56 71 ? ? ? B . n B 1 57 HIS 57 72 ? ? ? B . n B 1 58 TYR 58 73 ? ? ? B . n B 1 59 HIS 59 74 ? ? ? B . n B 1 60 GLN 60 75 ? ? ? B . n B 1 61 LYS 61 76 ? ? ? B . n B 1 62 GLY 62 77 ? ? ? B . n B 1 63 GLN 63 78 ? ? ? B . n B 1 64 ASN 64 79 ? ? ? B . n B 1 65 GLY 65 80 ? ? ? B . n B 1 66 SER 66 81 ? ? ? B . n B 1 67 PHE 67 82 ? ? ? B . n B 1 68 ASP 68 83 ? ? ? B . n B 1 69 ALA 69 84 ? ? ? B . n B 1 70 PRO 70 85 ? ? ? B . n B 1 71 ASN 71 86 ? ? ? B . n B 1 72 GLU 72 87 87 GLU GLU B . n B 1 73 ARG 73 88 88 ARG ARG B . n B 1 74 PRO 74 89 89 PRO PRO B . n B 1 75 TYR 75 90 90 TYR TYR B . n B 1 76 SER 76 91 91 SER SER B . n B 1 77 LEU 77 92 92 LEU LEU B . n B 1 78 LYS 78 93 93 LYS LYS B . n B 1 79 ILE 79 94 94 ILE ILE B . n B 1 80 ARG 80 95 95 ARG ARG B . n B 1 81 ASN 81 96 96 ASN ASN B . n B 1 82 THR 82 97 97 THR THR B . n B 1 83 THR 83 98 98 THR THR B . n B 1 84 SER 84 99 99 SER SER B . n B 1 85 SER 85 100 100 SER SER B . n B 1 86 ASN 86 101 101 ASN ASN B . n B 1 87 SER 87 102 102 SER SER B . n B 1 88 GLY 88 103 103 GLY GLY B . n B 1 89 THR 89 104 104 THR THR B . n B 1 90 TYR 90 105 105 TYR TYR B . n B 1 91 ARG 91 106 106 ARG ARG B . n B 1 92 CYS 92 107 107 CYS CYS B . n B 1 93 THR 93 108 108 THR THR B . n B 1 94 LEU 94 109 109 LEU LEU B . n B 1 95 GLN 95 110 110 GLN GLN B . n B 1 96 ASP 96 111 111 ASP ASP B . n B 1 97 PRO 97 112 112 PRO PRO B . n B 1 98 ASP 98 113 113 ASP ASP B . n B 1 99 GLY 99 114 114 GLY GLY B . n B 1 100 GLN 100 115 115 GLN GLN B . n B 1 101 ARG 101 116 116 ARG ARG B . n B 1 102 ASN 102 117 117 ASN ASN B . n B 1 103 LEU 103 118 118 LEU LEU B . n B 1 104 SER 104 119 119 SER SER B . n B 1 105 GLY 105 120 120 GLY GLY B . n B 1 106 LYS 106 121 121 LYS LYS B . n B 1 107 VAL 107 122 122 VAL VAL B . n B 1 108 ILE 108 123 123 ILE ILE B . n B 1 109 LEU 109 124 124 LEU LEU B . n B 1 110 ARG 110 125 125 ARG ARG B . n B 1 111 VAL 111 126 126 VAL VAL B . n B 1 112 THR 112 127 127 THR THR B . n B 1 113 GLY 113 128 128 GLY GLY B . n B 1 114 SER 114 129 129 SER SER B . n B 1 115 PRO 115 130 130 PRO PRO B . n B 1 116 ALA 116 131 ? ? ? B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 640 ? 1 MORE -5 ? 1 'SSA (A^2)' 10000 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-03-29 2 'Structure model' 1 1 2017-04-26 3 'Structure model' 1 2 2017-09-06 4 'Structure model' 1 3 2018-03-07 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Author supporting evidence' 3 4 'Structure model' 'Source and taxonomy' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_audit_support 2 4 'Structure model' entity_src_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_audit_support.funding_organization' 2 4 'Structure model' '_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id' 3 4 'Structure model' '_entity_src_gen.pdbx_host_org_scientific_name' 4 4 'Structure model' '_entity_src_gen.pdbx_host_org_variant' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? MxCuBE ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 4 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 C _pdbx_validate_rmsd_angle.auth_asym_id_1 B _pdbx_validate_rmsd_angle.auth_comp_id_1 LEU _pdbx_validate_rmsd_angle.auth_seq_id_1 33 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 N _pdbx_validate_rmsd_angle.auth_asym_id_2 B _pdbx_validate_rmsd_angle.auth_comp_id_2 PRO _pdbx_validate_rmsd_angle.auth_seq_id_2 34 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CA _pdbx_validate_rmsd_angle.auth_asym_id_3 B _pdbx_validate_rmsd_angle.auth_comp_id_3 PRO _pdbx_validate_rmsd_angle.auth_seq_id_3 34 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 128.66 _pdbx_validate_rmsd_angle.angle_target_value 119.30 _pdbx_validate_rmsd_angle.angle_deviation 9.36 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.50 _pdbx_validate_rmsd_angle.linker_flag Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 28 ? ? 76.44 -9.40 2 1 SER B 28 ? ? 75.27 -9.80 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 B GLU 87 ? CG ? B GLU 72 CG 2 1 Y 1 B GLU 87 ? CD ? B GLU 72 CD 3 1 Y 1 B GLU 87 ? OE1 ? B GLU 72 OE1 4 1 Y 1 B GLU 87 ? OE2 ? B GLU 72 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 16 ? A GLY 1 2 1 Y 1 A SER 17 ? A SER 2 3 1 Y 1 A GLU 54 ? A GLU 39 4 1 Y 1 A GLY 55 ? A GLY 40 5 1 Y 1 A GLY 56 ? A GLY 41 6 1 Y 1 A GLU 57 ? A GLU 42 7 1 Y 1 A GLU 58 ? A GLU 43 8 1 Y 1 A ARG 59 ? A ARG 44 9 1 Y 1 A MET 60 ? A MET 45 10 1 Y 1 A GLU 61 ? A GLU 46 11 1 Y 1 A THR 62 ? A THR 47 12 1 Y 1 A PRO 63 ? A PRO 48 13 1 Y 1 A GLN 64 ? A GLN 49 14 1 Y 1 A GLU 65 ? A GLU 50 15 1 Y 1 A ASP 66 ? A ASP 51 16 1 Y 1 A HIS 67 ? A HIS 52 17 1 Y 1 A LEU 68 ? A LEU 53 18 1 Y 1 A ARG 69 ? A ARG 54 19 1 Y 1 A GLY 70 ? A GLY 55 20 1 Y 1 A GLN 71 ? A GLN 56 21 1 Y 1 A HIS 72 ? A HIS 57 22 1 Y 1 A TYR 73 ? A TYR 58 23 1 Y 1 A HIS 74 ? A HIS 59 24 1 Y 1 A GLN 75 ? A GLN 60 25 1 Y 1 A LYS 76 ? A LYS 61 26 1 Y 1 A GLY 77 ? A GLY 62 27 1 Y 1 A GLN 78 ? A GLN 63 28 1 Y 1 A ASN 79 ? A ASN 64 29 1 Y 1 A GLY 80 ? A GLY 65 30 1 Y 1 A SER 81 ? A SER 66 31 1 Y 1 A PHE 82 ? A PHE 67 32 1 Y 1 A ASP 83 ? A ASP 68 33 1 Y 1 A ALA 84 ? A ALA 69 34 1 Y 1 A PRO 85 ? A PRO 70 35 1 Y 1 A PRO 130 ? A PRO 115 36 1 Y 1 A ALA 131 ? A ALA 116 37 1 Y 1 B GLY 16 ? B GLY 1 38 1 Y 1 B SER 17 ? B SER 2 39 1 Y 1 B PRO 18 ? B PRO 3 40 1 Y 1 B GLU 54 ? B GLU 39 41 1 Y 1 B GLY 55 ? B GLY 40 42 1 Y 1 B GLY 56 ? B GLY 41 43 1 Y 1 B GLU 57 ? B GLU 42 44 1 Y 1 B GLU 58 ? B GLU 43 45 1 Y 1 B ARG 59 ? B ARG 44 46 1 Y 1 B MET 60 ? B MET 45 47 1 Y 1 B GLU 61 ? B GLU 46 48 1 Y 1 B THR 62 ? B THR 47 49 1 Y 1 B PRO 63 ? B PRO 48 50 1 Y 1 B GLN 64 ? B GLN 49 51 1 Y 1 B GLU 65 ? B GLU 50 52 1 Y 1 B ASP 66 ? B ASP 51 53 1 Y 1 B HIS 67 ? B HIS 52 54 1 Y 1 B LEU 68 ? B LEU 53 55 1 Y 1 B ARG 69 ? B ARG 54 56 1 Y 1 B GLY 70 ? B GLY 55 57 1 Y 1 B GLN 71 ? B GLN 56 58 1 Y 1 B HIS 72 ? B HIS 57 59 1 Y 1 B TYR 73 ? B TYR 58 60 1 Y 1 B HIS 74 ? B HIS 59 61 1 Y 1 B GLN 75 ? B GLN 60 62 1 Y 1 B LYS 76 ? B LYS 61 63 1 Y 1 B GLY 77 ? B GLY 62 64 1 Y 1 B GLN 78 ? B GLN 63 65 1 Y 1 B ASN 79 ? B ASN 64 66 1 Y 1 B GLY 80 ? B GLY 65 67 1 Y 1 B SER 81 ? B SER 66 68 1 Y 1 B PHE 82 ? B PHE 67 69 1 Y 1 B ASP 83 ? B ASP 68 70 1 Y 1 B ALA 84 ? B ALA 69 71 1 Y 1 B PRO 85 ? B PRO 70 72 1 Y 1 B ASN 86 ? B ASN 71 73 1 Y 1 B ALA 131 ? B ALA 116 # _pdbx_audit_support.funding_organization 'German Research Foundation' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number SFB796 _pdbx_audit_support.ordinal 1 #