data_5MO0 # _entry.id 5MO0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5MO0 pdb_00005mo0 10.2210/pdb5mo0/pdb WWPDB D_1200002715 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-02-28 2 'Structure model' 1 1 2018-09-12 3 'Structure model' 1 2 2018-11-14 4 'Structure model' 2 0 2021-08-04 5 'Structure model' 2 1 2024-01-17 6 'Structure model' 2 2 2024-10-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 4 'Structure model' 'Atomic model' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Derived calculations' 7 4 'Structure model' 'Non-polymer description' 8 4 'Structure model' 'Structure summary' 9 5 'Structure model' 'Data collection' 10 5 'Structure model' 'Database references' 11 5 'Structure model' 'Refinement description' 12 6 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' diffrn_source 4 4 'Structure model' atom_site 5 4 'Structure model' chem_comp 6 4 'Structure model' entity 7 4 'Structure model' pdbx_entity_nonpoly 8 4 'Structure model' pdbx_nonpoly_scheme 9 4 'Structure model' struct_site 10 5 'Structure model' chem_comp_atom 11 5 'Structure model' chem_comp_bond 12 5 'Structure model' database_2 13 5 'Structure model' pdbx_initial_refinement_model 14 6 'Structure model' pdbx_entry_details 15 6 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 3 'Structure model' '_diffrn_source.pdbx_synchrotron_beamline' 13 3 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 14 4 'Structure model' '_atom_site.B_iso_or_equiv' 15 4 'Structure model' '_atom_site.Cartn_x' 16 4 'Structure model' '_atom_site.Cartn_y' 17 4 'Structure model' '_atom_site.Cartn_z' 18 4 'Structure model' '_atom_site.auth_atom_id' 19 4 'Structure model' '_atom_site.auth_comp_id' 20 4 'Structure model' '_atom_site.label_atom_id' 21 4 'Structure model' '_atom_site.label_comp_id' 22 4 'Structure model' '_atom_site.pdbx_formal_charge' 23 4 'Structure model' '_chem_comp.formula' 24 4 'Structure model' '_chem_comp.formula_weight' 25 4 'Structure model' '_chem_comp.id' 26 4 'Structure model' '_entity.formula_weight' 27 4 'Structure model' '_pdbx_entity_nonpoly.comp_id' 28 4 'Structure model' '_pdbx_nonpoly_scheme.mon_id' 29 4 'Structure model' '_pdbx_nonpoly_scheme.pdb_mon_id' 30 4 'Structure model' '_struct_site.details' 31 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 32 5 'Structure model' '_database_2.pdbx_DOI' 33 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5MO0 _pdbx_database_status.recvd_initial_deposition_date 2016-12-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Schiebel, J.' 1 ? 'Schrader, T.E.' 2 ? 'Ostermann, A.' 3 ? 'Heine, A.' 4 ? 'Klebe, G.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 9 _citation.language ? _citation.page_first 3559 _citation.page_last 3559 _citation.title 'Intriguing role of water in protein-ligand binding studied by neutron crystallography on trypsin complexes.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-018-05769-2 _citation.pdbx_database_id_PubMed 30177695 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Schiebel, J.' 1 ? primary 'Gaspari, R.' 2 ? primary 'Wulsdorf, T.' 3 ? primary 'Ngo, K.' 4 ? primary 'Sohn, C.' 5 ? primary 'Schrader, T.E.' 6 0000-0001-5159-0846 primary 'Cavalli, A.' 7 ? primary 'Ostermann, A.' 8 0000-0002-1477-5590 primary 'Heine, A.' 9 ? primary 'Klebe, G.' 10 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'Cationic trypsin' 23324.287 1 3.4.21.4 ? ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 3 non-polymer syn BENZAMIDINE 120.152 1 ? ? ? ? 4 water nat water 18.015 144 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Beta-trypsin # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNT LNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNM FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN ; _entity_poly.pdbx_seq_one_letter_code_can ;IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNT LNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNM FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 BENZAMIDINE BEN 4 water DOD # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 VAL n 1 3 GLY n 1 4 GLY n 1 5 TYR n 1 6 THR n 1 7 CYS n 1 8 GLY n 1 9 ALA n 1 10 ASN n 1 11 THR n 1 12 VAL n 1 13 PRO n 1 14 TYR n 1 15 GLN n 1 16 VAL n 1 17 SER n 1 18 LEU n 1 19 ASN n 1 20 SER n 1 21 GLY n 1 22 TYR n 1 23 HIS n 1 24 PHE n 1 25 CYS n 1 26 GLY n 1 27 GLY n 1 28 SER n 1 29 LEU n 1 30 ILE n 1 31 ASN n 1 32 SER n 1 33 GLN n 1 34 TRP n 1 35 VAL n 1 36 VAL n 1 37 SER n 1 38 ALA n 1 39 ALA n 1 40 HIS n 1 41 CYS n 1 42 TYR n 1 43 LYS n 1 44 SER n 1 45 GLY n 1 46 ILE n 1 47 GLN n 1 48 VAL n 1 49 ARG n 1 50 LEU n 1 51 GLY n 1 52 GLU n 1 53 ASP n 1 54 ASN n 1 55 ILE n 1 56 ASN n 1 57 VAL n 1 58 VAL n 1 59 GLU n 1 60 GLY n 1 61 ASN n 1 62 GLU n 1 63 GLN n 1 64 PHE n 1 65 ILE n 1 66 SER n 1 67 ALA n 1 68 SER n 1 69 LYS n 1 70 SER n 1 71 ILE n 1 72 VAL n 1 73 HIS n 1 74 PRO n 1 75 SER n 1 76 TYR n 1 77 ASN n 1 78 SER n 1 79 ASN n 1 80 THR n 1 81 LEU n 1 82 ASN n 1 83 ASN n 1 84 ASP n 1 85 ILE n 1 86 MET n 1 87 LEU n 1 88 ILE n 1 89 LYS n 1 90 LEU n 1 91 LYS n 1 92 SER n 1 93 ALA n 1 94 ALA n 1 95 SER n 1 96 LEU n 1 97 ASN n 1 98 SER n 1 99 ARG n 1 100 VAL n 1 101 ALA n 1 102 SER n 1 103 ILE n 1 104 SER n 1 105 LEU n 1 106 PRO n 1 107 THR n 1 108 SER n 1 109 CYS n 1 110 ALA n 1 111 SER n 1 112 ALA n 1 113 GLY n 1 114 THR n 1 115 GLN n 1 116 CYS n 1 117 LEU n 1 118 ILE n 1 119 SER n 1 120 GLY n 1 121 TRP n 1 122 GLY n 1 123 ASN n 1 124 THR n 1 125 LYS n 1 126 SER n 1 127 SER n 1 128 GLY n 1 129 THR n 1 130 SER n 1 131 TYR n 1 132 PRO n 1 133 ASP n 1 134 VAL n 1 135 LEU n 1 136 LYS n 1 137 CYS n 1 138 LEU n 1 139 LYS n 1 140 ALA n 1 141 PRO n 1 142 ILE n 1 143 LEU n 1 144 SER n 1 145 ASP n 1 146 SER n 1 147 SER n 1 148 CYS n 1 149 LYS n 1 150 SER n 1 151 ALA n 1 152 TYR n 1 153 PRO n 1 154 GLY n 1 155 GLN n 1 156 ILE n 1 157 THR n 1 158 SER n 1 159 ASN n 1 160 MET n 1 161 PHE n 1 162 CYS n 1 163 ALA n 1 164 GLY n 1 165 TYR n 1 166 LEU n 1 167 GLU n 1 168 GLY n 1 169 GLY n 1 170 LYS n 1 171 ASP n 1 172 SER n 1 173 CYS n 1 174 GLN n 1 175 GLY n 1 176 ASP n 1 177 SER n 1 178 GLY n 1 179 GLY n 1 180 PRO n 1 181 VAL n 1 182 VAL n 1 183 CYS n 1 184 SER n 1 185 GLY n 1 186 LYS n 1 187 LEU n 1 188 GLN n 1 189 GLY n 1 190 ILE n 1 191 VAL n 1 192 SER n 1 193 TRP n 1 194 GLY n 1 195 SER n 1 196 GLY n 1 197 CYS n 1 198 ALA n 1 199 GLN n 1 200 LYS n 1 201 ASN n 1 202 LYS n 1 203 PRO n 1 204 GLY n 1 205 VAL n 1 206 TYR n 1 207 THR n 1 208 LYS n 1 209 VAL n 1 210 CYS n 1 211 ASN n 1 212 TYR n 1 213 VAL n 1 214 SER n 1 215 TRP n 1 216 ILE n 1 217 LYS n 1 218 GLN n 1 219 THR n 1 220 ILE n 1 221 ALA n 1 222 SER n 1 223 ASN n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num 1 _entity_src_nat.pdbx_end_seq_num 223 _entity_src_nat.common_name Bovine _entity_src_nat.pdbx_organism_scientific 'Bos taurus' _entity_src_nat.pdbx_ncbi_taxonomy_id 9913 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BEN non-polymer . BENZAMIDINE ? 'C7 H8 N2' 120.152 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DOD non-polymer . 'DEUTERATED WATER' ? 'D2 O' 20.028 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 16 16 ILE ILE A . n A 1 2 VAL 2 17 17 VAL VAL A . n A 1 3 GLY 3 18 18 GLY GLY A . n A 1 4 GLY 4 19 19 GLY GLY A . n A 1 5 TYR 5 20 20 TYR TYR A . n A 1 6 THR 6 21 21 THR THR A . n A 1 7 CYS 7 22 22 CYS CYS A . n A 1 8 GLY 8 23 23 GLY GLY A . n A 1 9 ALA 9 24 24 ALA ALA A . n A 1 10 ASN 10 25 25 ASN ASN A . n A 1 11 THR 11 26 26 THR THR A . n A 1 12 VAL 12 27 27 VAL VAL A . n A 1 13 PRO 13 28 28 PRO PRO A . n A 1 14 TYR 14 29 29 TYR TYR A . n A 1 15 GLN 15 30 30 GLN GLN A . n A 1 16 VAL 16 31 31 VAL VAL A . n A 1 17 SER 17 32 32 SER SER A . n A 1 18 LEU 18 33 33 LEU LEU A . n A 1 19 ASN 19 34 34 ASN ASN A . n A 1 20 SER 20 37 37 SER SER A . n A 1 21 GLY 21 38 38 GLY GLY A . n A 1 22 TYR 22 39 39 TYR TYR A . n A 1 23 HIS 23 40 40 HIS HIS A . n A 1 24 PHE 24 41 41 PHE PHE A . n A 1 25 CYS 25 42 42 CYS CYS A . n A 1 26 GLY 26 43 43 GLY GLY A . n A 1 27 GLY 27 44 44 GLY GLY A . n A 1 28 SER 28 45 45 SER SER A . n A 1 29 LEU 29 46 46 LEU LEU A . n A 1 30 ILE 30 47 47 ILE ILE A . n A 1 31 ASN 31 48 48 ASN ASN A . n A 1 32 SER 32 49 49 SER SER A . n A 1 33 GLN 33 50 50 GLN GLN A . n A 1 34 TRP 34 51 51 TRP TRP A . n A 1 35 VAL 35 52 52 VAL VAL A . n A 1 36 VAL 36 53 53 VAL VAL A . n A 1 37 SER 37 54 54 SER SER A . n A 1 38 ALA 38 55 55 ALA ALA A . n A 1 39 ALA 39 56 56 ALA ALA A . n A 1 40 HIS 40 57 57 HIS HIS A . n A 1 41 CYS 41 58 58 CYS CYS A . n A 1 42 TYR 42 59 59 TYR TYR A . n A 1 43 LYS 43 60 60 LYS LYS A . n A 1 44 SER 44 61 61 SER SER A . n A 1 45 GLY 45 62 62 GLY GLY A . n A 1 46 ILE 46 63 63 ILE ILE A . n A 1 47 GLN 47 64 64 GLN GLN A . n A 1 48 VAL 48 65 65 VAL VAL A . n A 1 49 ARG 49 66 66 ARG ARG A . n A 1 50 LEU 50 67 67 LEU LEU A . n A 1 51 GLY 51 69 69 GLY GLY A . n A 1 52 GLU 52 70 70 GLU GLU A . n A 1 53 ASP 53 71 71 ASP ASP A . n A 1 54 ASN 54 72 72 ASN ASN A . n A 1 55 ILE 55 73 73 ILE ILE A . n A 1 56 ASN 56 74 74 ASN ASN A . n A 1 57 VAL 57 75 75 VAL VAL A . n A 1 58 VAL 58 76 76 VAL VAL A . n A 1 59 GLU 59 77 77 GLU GLU A . n A 1 60 GLY 60 78 78 GLY GLY A . n A 1 61 ASN 61 79 79 ASN ASN A . n A 1 62 GLU 62 80 80 GLU GLU A . n A 1 63 GLN 63 81 81 GLN GLN A . n A 1 64 PHE 64 82 82 PHE PHE A . n A 1 65 ILE 65 83 83 ILE ILE A . n A 1 66 SER 66 84 84 SER SER A . n A 1 67 ALA 67 85 85 ALA ALA A . n A 1 68 SER 68 86 86 SER SER A . n A 1 69 LYS 69 87 87 LYS LYS A . n A 1 70 SER 70 88 88 SER SER A . n A 1 71 ILE 71 89 89 ILE ILE A . n A 1 72 VAL 72 90 90 VAL VAL A . n A 1 73 HIS 73 91 91 HIS HIS A . n A 1 74 PRO 74 92 92 PRO PRO A . n A 1 75 SER 75 93 93 SER SER A . n A 1 76 TYR 76 94 94 TYR TYR A . n A 1 77 ASN 77 95 95 ASN ASN A . n A 1 78 SER 78 96 96 SER SER A . n A 1 79 ASN 79 97 97 ASN ASN A . n A 1 80 THR 80 98 98 THR THR A . n A 1 81 LEU 81 99 99 LEU LEU A . n A 1 82 ASN 82 100 100 ASN ASN A . n A 1 83 ASN 83 101 101 ASN ASN A . n A 1 84 ASP 84 102 102 ASP ASP A . n A 1 85 ILE 85 103 103 ILE ILE A . n A 1 86 MET 86 104 104 MET MET A . n A 1 87 LEU 87 105 105 LEU LEU A . n A 1 88 ILE 88 106 106 ILE ILE A . n A 1 89 LYS 89 107 107 LYS LYS A . n A 1 90 LEU 90 108 108 LEU LEU A . n A 1 91 LYS 91 109 109 LYS LYS A . n A 1 92 SER 92 110 110 SER SER A . n A 1 93 ALA 93 111 111 ALA ALA A . n A 1 94 ALA 94 112 112 ALA ALA A . n A 1 95 SER 95 113 113 SER SER A . n A 1 96 LEU 96 114 114 LEU LEU A . n A 1 97 ASN 97 115 115 ASN ASN A . n A 1 98 SER 98 116 116 SER SER A . n A 1 99 ARG 99 117 117 ARG ARG A . n A 1 100 VAL 100 118 118 VAL VAL A . n A 1 101 ALA 101 119 119 ALA ALA A . n A 1 102 SER 102 120 120 SER SER A . n A 1 103 ILE 103 121 121 ILE ILE A . n A 1 104 SER 104 122 122 SER SER A . n A 1 105 LEU 105 123 123 LEU LEU A . n A 1 106 PRO 106 124 124 PRO PRO A . n A 1 107 THR 107 125 125 THR THR A . n A 1 108 SER 108 127 127 SER SER A . n A 1 109 CYS 109 128 128 CYS CYS A . n A 1 110 ALA 110 129 129 ALA ALA A . n A 1 111 SER 111 130 130 SER SER A . n A 1 112 ALA 112 132 132 ALA ALA A . n A 1 113 GLY 113 133 133 GLY GLY A . n A 1 114 THR 114 134 134 THR THR A . n A 1 115 GLN 115 135 135 GLN GLN A . n A 1 116 CYS 116 136 136 CYS CYS A . n A 1 117 LEU 117 137 137 LEU LEU A . n A 1 118 ILE 118 138 138 ILE ILE A . n A 1 119 SER 119 139 139 SER SER A . n A 1 120 GLY 120 140 140 GLY GLY A . n A 1 121 TRP 121 141 141 TRP TRP A . n A 1 122 GLY 122 142 142 GLY GLY A . n A 1 123 ASN 123 143 143 ASN ASN A . n A 1 124 THR 124 144 144 THR THR A . n A 1 125 LYS 125 145 145 LYS LYS A . n A 1 126 SER 126 146 146 SER SER A . n A 1 127 SER 127 147 147 SER SER A . n A 1 128 GLY 128 148 148 GLY GLY A . n A 1 129 THR 129 149 149 THR THR A . n A 1 130 SER 130 150 150 SER SER A . n A 1 131 TYR 131 151 151 TYR TYR A . n A 1 132 PRO 132 152 152 PRO PRO A . n A 1 133 ASP 133 153 153 ASP ASP A . n A 1 134 VAL 134 154 154 VAL VAL A . n A 1 135 LEU 135 155 155 LEU LEU A . n A 1 136 LYS 136 156 156 LYS LYS A . n A 1 137 CYS 137 157 157 CYS CYS A . n A 1 138 LEU 138 158 158 LEU LEU A . n A 1 139 LYS 139 159 159 LYS LYS A . n A 1 140 ALA 140 160 160 ALA ALA A . n A 1 141 PRO 141 161 161 PRO PRO A . n A 1 142 ILE 142 162 162 ILE ILE A . n A 1 143 LEU 143 163 163 LEU LEU A . n A 1 144 SER 144 164 164 SER SER A . n A 1 145 ASP 145 165 165 ASP ASP A . n A 1 146 SER 146 166 166 SER SER A . n A 1 147 SER 147 167 167 SER SER A . n A 1 148 CYS 148 168 168 CYS CYS A . n A 1 149 LYS 149 169 169 LYS LYS A . n A 1 150 SER 150 170 170 SER SER A . n A 1 151 ALA 151 171 171 ALA ALA A . n A 1 152 TYR 152 172 172 TYR TYR A . n A 1 153 PRO 153 173 173 PRO PRO A . n A 1 154 GLY 154 174 174 GLY GLY A . n A 1 155 GLN 155 175 175 GLN GLN A . n A 1 156 ILE 156 176 176 ILE ILE A . n A 1 157 THR 157 177 177 THR THR A . n A 1 158 SER 158 178 178 SER SER A . n A 1 159 ASN 159 179 179 ASN ASN A . n A 1 160 MET 160 180 180 MET MET A . n A 1 161 PHE 161 181 181 PHE PHE A . n A 1 162 CYS 162 182 182 CYS CYS A . n A 1 163 ALA 163 183 183 ALA ALA A . n A 1 164 GLY 164 184 184 GLY GLY A . n A 1 165 TYR 165 184 184 TYR TYR A A n A 1 166 LEU 166 185 185 LEU LEU A . n A 1 167 GLU 167 186 186 GLU GLU A . n A 1 168 GLY 168 187 187 GLY GLY A . n A 1 169 GLY 169 188 188 GLY GLY A . n A 1 170 LYS 170 188 188 LYS LYS A A n A 1 171 ASP 171 189 189 ASP ASP A . n A 1 172 SER 172 190 190 SER SER A . n A 1 173 CYS 173 191 191 CYS CYS A . n A 1 174 GLN 174 192 192 GLN GLN A . n A 1 175 GLY 175 193 193 GLY GLY A . n A 1 176 ASP 176 194 194 ASP ASP A . n A 1 177 SER 177 195 195 SER SER A . n A 1 178 GLY 178 196 196 GLY GLY A . n A 1 179 GLY 179 197 197 GLY GLY A . n A 1 180 PRO 180 198 198 PRO PRO A . n A 1 181 VAL 181 199 199 VAL VAL A . n A 1 182 VAL 182 200 200 VAL VAL A . n A 1 183 CYS 183 201 201 CYS CYS A . n A 1 184 SER 184 202 202 SER SER A . n A 1 185 GLY 185 203 203 GLY GLY A . n A 1 186 LYS 186 204 204 LYS LYS A . n A 1 187 LEU 187 209 209 LEU LEU A . n A 1 188 GLN 188 210 210 GLN GLN A . n A 1 189 GLY 189 211 211 GLY GLY A . n A 1 190 ILE 190 212 212 ILE ILE A . n A 1 191 VAL 191 213 213 VAL VAL A . n A 1 192 SER 192 214 214 SER SER A . n A 1 193 TRP 193 215 215 TRP TRP A . n A 1 194 GLY 194 216 216 GLY GLY A . n A 1 195 SER 195 217 217 SER SER A . n A 1 196 GLY 196 219 219 GLY GLY A . n A 1 197 CYS 197 220 220 CYS CYS A . n A 1 198 ALA 198 221 221 ALA ALA A . n A 1 199 GLN 199 221 221 GLN GLN A A n A 1 200 LYS 200 222 222 LYS LYS A . n A 1 201 ASN 201 223 223 ASN ASN A . n A 1 202 LYS 202 224 224 LYS LYS A . n A 1 203 PRO 203 225 225 PRO PRO A . n A 1 204 GLY 204 226 226 GLY GLY A . n A 1 205 VAL 205 227 227 VAL VAL A . n A 1 206 TYR 206 228 228 TYR TYR A . n A 1 207 THR 207 229 229 THR THR A . n A 1 208 LYS 208 230 230 LYS LYS A . n A 1 209 VAL 209 231 231 VAL VAL A . n A 1 210 CYS 210 232 232 CYS CYS A . n A 1 211 ASN 211 233 233 ASN ASN A . n A 1 212 TYR 212 234 234 TYR TYR A . n A 1 213 VAL 213 235 235 VAL VAL A . n A 1 214 SER 214 236 236 SER SER A . n A 1 215 TRP 215 237 237 TRP TRP A . n A 1 216 ILE 216 238 238 ILE ILE A . n A 1 217 LYS 217 239 239 LYS LYS A . n A 1 218 GLN 218 240 240 GLN GLN A . n A 1 219 THR 219 241 241 THR THR A . n A 1 220 ILE 220 242 242 ILE ILE A . n A 1 221 ALA 221 243 243 ALA ALA A . n A 1 222 SER 222 244 244 SER SER A . n A 1 223 ASN 223 245 245 ASN ASN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 301 1 CA CA A . C 3 BEN 1 302 1 BEN BAM A . D 4 DOD 1 401 80 DOD DOD A . D 4 DOD 2 402 46 DOD DOD A . D 4 DOD 3 403 47 DOD DOD A . D 4 DOD 4 404 3 DOD DOD A . D 4 DOD 5 405 101 DOD DOD A . D 4 DOD 6 406 54 DOD DOD A . D 4 DOD 7 407 120 DOD DOD A . D 4 DOD 8 408 125 DOD DOD A . D 4 DOD 9 409 67 DOD DOD A . D 4 DOD 10 410 69 DOD DOD A . D 4 DOD 11 411 6 DOD DOD A . D 4 DOD 12 412 60 DOD DOD A . D 4 DOD 13 413 42 DOD DOD A . D 4 DOD 14 414 148 DOD DOD A . D 4 DOD 15 415 51 DOD DOD A . D 4 DOD 16 416 8 DOD DOD A . D 4 DOD 17 417 24 DOD DOD A . D 4 DOD 18 418 75 DOD DOD A . D 4 DOD 19 419 38 DOD DOD A . D 4 DOD 20 420 25 DOD DOD A . D 4 DOD 21 421 21 DOD DOD A . D 4 DOD 22 422 5 DOD DOD A . D 4 DOD 23 423 32 DOD DOD A . D 4 DOD 24 424 94 DOD DOD A . D 4 DOD 25 425 22 DOD DOD A . D 4 DOD 26 426 115 DOD DOD A . D 4 DOD 27 427 27 DOD DOD A . D 4 DOD 28 428 78 DOD DOD A . D 4 DOD 29 429 39 DOD DOD A . D 4 DOD 30 430 44 DOD DOD A . D 4 DOD 31 431 12 DOD DOD A . D 4 DOD 32 432 106 DOD DOD A . D 4 DOD 33 433 1 DOD DOD A . D 4 DOD 34 434 63 DOD DOD A . D 4 DOD 35 435 20 DOD DOD A . D 4 DOD 36 436 9 DOD DOD A . D 4 DOD 37 437 11 DOD DOD A . D 4 DOD 38 438 123 DOD DOD A . D 4 DOD 39 439 113 DOD DOD A . D 4 DOD 40 440 43 DOD DOD A . D 4 DOD 41 441 79 DOD DOD A . D 4 DOD 42 442 139 DOD DOD A . D 4 DOD 43 443 119 DOD DOD A . D 4 DOD 44 444 156 DOD DOD A . D 4 DOD 45 445 45 DOD DOD A . D 4 DOD 46 446 2 DOD DOD A . D 4 DOD 47 447 96 DOD DOD A . D 4 DOD 48 448 104 DOD DOD A . D 4 DOD 49 449 18 DOD DOD A . D 4 DOD 50 450 34 DOD DOD A . D 4 DOD 51 451 33 DOD DOD A . D 4 DOD 52 452 7 DOD DOD A . D 4 DOD 53 453 16 DOD DOD A . D 4 DOD 54 454 159 DOD DOD A . D 4 DOD 55 455 17 DOD DOD A . D 4 DOD 56 456 15 DOD DOD A . D 4 DOD 57 457 64 DOD DOD A . D 4 DOD 58 458 144 DOD DOD A . D 4 DOD 59 459 72 DOD DOD A . D 4 DOD 60 460 157 DOD DOD A . D 4 DOD 61 461 127 DOD DOD A . D 4 DOD 62 462 136 DOD DOD A . D 4 DOD 63 463 10 DOD DOD A . D 4 DOD 64 464 87 DOD DOD A . D 4 DOD 65 465 19 DOD DOD A . D 4 DOD 66 466 48 DOD DOD A . D 4 DOD 67 467 28 DOD DOD A . D 4 DOD 68 468 86 DOD DOD A . D 4 DOD 69 469 147 DOD DOD A . D 4 DOD 70 470 116 DOD DOD A . D 4 DOD 71 471 71 DOD DOD A . D 4 DOD 72 472 53 DOD DOD A . D 4 DOD 73 473 105 DOD DOD A . D 4 DOD 74 474 143 DOD DOD A . D 4 DOD 75 475 13 DOD DOD A . D 4 DOD 76 476 84 DOD DOD A . D 4 DOD 77 477 14 DOD DOD A . D 4 DOD 78 478 40 DOD DOD A . D 4 DOD 79 479 153 DOD DOD A . D 4 DOD 80 480 98 DOD DOD A . D 4 DOD 81 481 35 DOD DOD A . D 4 DOD 82 482 29 DOD DOD A . D 4 DOD 83 483 4 DOD DOD A . D 4 DOD 84 484 70 DOD DOD A . D 4 DOD 85 485 141 DOD DOD A . D 4 DOD 86 486 30 DOD DOD A . D 4 DOD 87 487 142 DOD DOD A . D 4 DOD 88 488 99 DOD DOD A . D 4 DOD 89 489 23 DOD DOD A . D 4 DOD 90 490 26 DOD DOD A . D 4 DOD 91 491 58 DOD DOD A . D 4 DOD 92 492 65 DOD DOD A . D 4 DOD 93 493 74 DOD DOD A . D 4 DOD 94 494 31 DOD DOD A . D 4 DOD 95 495 77 DOD DOD A . D 4 DOD 96 496 121 DOD DOD A . D 4 DOD 97 497 49 DOD DOD A . D 4 DOD 98 498 137 DOD DOD A . D 4 DOD 99 499 90 DOD DOD A . D 4 DOD 100 500 126 DOD DOD A . D 4 DOD 101 501 61 DOD DOD A . D 4 DOD 102 502 50 DOD DOD A . D 4 DOD 103 503 117 DOD DOD A . D 4 DOD 104 504 97 DOD DOD A . D 4 DOD 105 505 112 DOD DOD A . D 4 DOD 106 506 36 DOD DOD A . D 4 DOD 107 507 92 DOD DOD A . D 4 DOD 108 508 91 DOD DOD A . D 4 DOD 109 509 73 DOD DOD A . D 4 DOD 110 510 57 DOD DOD A . D 4 DOD 111 511 37 DOD DOD A . D 4 DOD 112 512 52 DOD DOD A . D 4 DOD 113 513 100 DOD DOD A . D 4 DOD 114 514 107 DOD DOD A . D 4 DOD 115 515 111 DOD DOD A . D 4 DOD 116 516 85 DOD DOD A . D 4 DOD 117 517 131 DOD DOD A . D 4 DOD 118 518 56 DOD DOD A . D 4 DOD 119 519 134 DOD DOD A . D 4 DOD 120 520 150 DOD DOD A . D 4 DOD 121 521 41 DOD DOD A . D 4 DOD 122 522 158 DOD DOD A . D 4 DOD 123 523 145 DOD DOD A . D 4 DOD 124 524 128 DOD DOD A . D 4 DOD 125 525 109 DOD DOD A . D 4 DOD 126 526 108 DOD DOD A . D 4 DOD 127 527 82 DOD DOD A . D 4 DOD 128 528 130 DOD DOD A . D 4 DOD 129 529 81 DOD DOD A . D 4 DOD 130 530 88 DOD DOD A . D 4 DOD 131 531 129 DOD DOD A . D 4 DOD 132 532 83 DOD DOD A . D 4 DOD 133 533 68 DOD DOD A . D 4 DOD 134 534 146 DOD DOD A . D 4 DOD 135 535 110 DOD DOD A . D 4 DOD 136 536 132 DOD DOD A . D 4 DOD 137 537 133 DOD DOD A . D 4 DOD 138 538 149 DOD DOD A . D 4 DOD 139 539 155 DOD DOD A . D 4 DOD 140 540 62 DOD DOD A . D 4 DOD 141 541 76 DOD DOD A . D 4 DOD 142 542 114 DOD DOD A . D 4 DOD 143 543 66 DOD DOD A . D 4 DOD 144 544 93 DOD DOD A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A SER 61 ? CB ? A SER 44 CB 2 1 Y 1 A SER 61 ? OG ? A SER 44 OG 3 1 Y 1 A LYS 109 ? CG ? A LYS 91 CG 4 1 Y 1 A LYS 109 ? CD ? A LYS 91 CD 5 1 Y 1 A LYS 109 ? CE ? A LYS 91 CE 6 1 Y 1 A LYS 109 ? NZ ? A LYS 91 NZ 7 1 Y 1 A SER 113 ? OG ? A SER 95 OG 8 1 Y 1 A SER 122 ? OG ? A SER 104 OG 9 1 Y 1 A SER 127 ? OG ? A SER 108 OG 10 1 Y 1 A LYS 145 ? CD ? A LYS 125 CD 11 1 Y 1 A LYS 145 ? CE ? A LYS 125 CE 12 1 Y 1 A LYS 145 ? NZ ? A LYS 125 NZ 13 1 Y 1 A SER 146 ? OG ? A SER 126 OG 14 1 Y 1 A THR 149 ? OG1 ? A THR 129 OG1 15 1 Y 1 A THR 149 ? CG2 ? A THR 129 CG2 16 1 Y 1 A SER 166 ? OG ? A SER 146 OG 17 1 Y 1 A SER 167 ? OG ? A SER 147 OG 18 1 Y 1 A LYS 169 ? CE ? A LYS 149 CE 19 1 Y 1 A LYS 169 ? NZ ? A LYS 149 NZ 20 1 Y 1 A SER 170 ? OG ? A SER 150 OG 21 1 Y 1 A GLU 186 ? CG ? A GLU 167 CG 22 1 Y 1 A GLU 186 ? CD ? A GLU 167 CD 23 1 Y 1 A GLU 186 ? OE1 ? A GLU 167 OE1 24 1 Y 1 A GLU 186 ? OE2 ? A GLU 167 OE2 25 1 Y 1 A LYS 188 A CE ? A LYS 170 CE 26 1 Y 1 A LYS 188 A NZ ? A LYS 170 NZ 27 1 Y 1 A GLN 192 ? CG ? A GLN 174 CG 28 1 Y 1 A GLN 192 ? CD ? A GLN 174 CD 29 1 Y 1 A GLN 192 ? OE1 ? A GLN 174 OE1 30 1 Y 1 A GLN 192 ? NE2 ? A GLN 174 NE2 31 1 Y 1 A LYS 204 ? CE ? A LYS 186 CE 32 1 Y 1 A LYS 204 ? NZ ? A LYS 186 NZ 33 1 Y 1 A SER 217 ? OG ? A SER 195 OG 34 1 Y 1 A LYS 222 ? CG ? A LYS 200 CG 35 1 Y 1 A LYS 222 ? CD ? A LYS 200 CD 36 1 Y 1 A LYS 222 ? CE ? A LYS 200 CE 37 1 Y 1 A LYS 222 ? NZ ? A LYS 200 NZ 38 1 Y 1 A SER 236 ? OG ? A SER 214 OG 39 1 Y 1 A LYS 239 ? CE ? A LYS 217 CE 40 1 Y 1 A LYS 239 ? NZ ? A LYS 217 NZ 41 1 Y 1 A GLN 240 ? CG ? A GLN 218 CG 42 1 Y 1 A GLN 240 ? CD ? A GLN 218 CD 43 1 Y 1 A GLN 240 ? OE1 ? A GLN 218 OE1 44 1 Y 1 A GLN 240 ? NE2 ? A GLN 218 NE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(dev_2429)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5MO0 _cell.details ? _cell.formula_units_Z ? _cell.length_a 54.912 _cell.length_a_esd ? _cell.length_b 58.686 _cell.length_b_esd ? _cell.length_c 67.516 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5MO0 _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5MO0 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'NEUTRON DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M ammonium sulfate, 0.1 M Hepes pH 7.5, 13% (w/v) PEG 8000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 295 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment ? # _diffrn_detector.details ? _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MAATEL BIODIFF' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-09-27 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type neutron # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 2.673 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'NUCLEAR REACTOR' _diffrn_source.target ? _diffrn_source.type 'FRM II BEAMLINE BIODIFF' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 2.673 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BIODIFF _diffrn_source.pdbx_synchrotron_site 'FRM II' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5MO0 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.5 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 31713 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 89.4 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.4 _reflns.pdbx_Rmerge_I_obs 0.071 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.197 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.5 _reflns_shell.d_res_low 1.53 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.244 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 69.6 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.267 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 1.7 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5MO0 _refine.pdbx_refine_id 'NEUTRON DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.502 _refine.ls_d_res_low 25.433 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 31693 _refine.ls_number_reflns_R_free 1573 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 89.45 _refine.ls_percent_reflns_R_free 4.96 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1489 _refine.ls_R_factor_R_free 0.1850 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1470 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4I8H _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 15.96 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.14 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'NEUTRON DIFFRACTION' ? 0.004 ? 3696 ? f_bond_d ? ? 'NEUTRON DIFFRACTION' ? 0.945 ? 6306 ? f_angle_d ? ? 'NEUTRON DIFFRACTION' ? 11.791 ? 1341 ? f_dihedral_angle_d ? ? 'NEUTRON DIFFRACTION' ? 0.060 ? 260 ? f_chiral_restr ? ? 'NEUTRON DIFFRACTION' ? 0.005 ? 796 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'NEUTRON DIFFRACTION' 1.5022 1.5507 . . 125 2101 71.00 . . . 0.2739 . 0.2224 . . . . . . . . . . 'NEUTRON DIFFRACTION' 1.5507 1.6061 . . 138 2431 81.00 . . . 0.2432 . 0.1837 . . . . . . . . . . 'NEUTRON DIFFRACTION' 1.6061 1.6704 . . 139 2573 85.00 . . . 0.2331 . 0.1681 . . . . . . . . . . 'NEUTRON DIFFRACTION' 1.6704 1.7464 . . 122 2694 89.00 . . . 0.1947 . 0.1528 . . . . . . . . . . 'NEUTRON DIFFRACTION' 1.7464 1.8385 . . 165 2744 91.00 . . . 0.2104 . 0.1490 . . . . . . . . . . 'NEUTRON DIFFRACTION' 1.8385 1.9536 . . 155 2824 93.00 . . . 0.1842 . 0.1412 . . . . . . . . . . 'NEUTRON DIFFRACTION' 1.9536 2.1044 . . 153 2870 94.00 . . . 0.1779 . 0.1295 . . . . . . . . . . 'NEUTRON DIFFRACTION' 2.1044 2.3160 . . 136 2756 90.00 . . . 0.1677 . 0.1239 . . . . . . . . . . 'NEUTRON DIFFRACTION' 2.3160 2.6508 . . 150 2896 94.00 . . . 0.1413 . 0.1262 . . . . . . . . . . 'NEUTRON DIFFRACTION' 2.6508 3.3386 . . 137 3093 98.00 . . . 0.1568 . 0.1526 . . . . . . . . . . 'NEUTRON DIFFRACTION' 3.3386 25.4371 . . 153 3138 96.00 . . . 0.1714 . 0.1432 . . . . . . . . . . # _struct.entry_id 5MO0 _struct.title 'Neutron structure of cationic trypsin in complex with benzamidine' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5MO0 _struct_keywords.text 'hydrogen bonding, protonation, protein-ligand interaction, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TRY1_BOVIN _struct_ref.pdbx_db_accession P00760 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNT LNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNM FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN ; _struct_ref.pdbx_align_begin 24 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5MO0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 223 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00760 _struct_ref_seq.db_align_beg 24 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 246 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 16 _struct_ref_seq.pdbx_auth_seq_align_end 245 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 38 ? TYR A 42 ? ALA A 55 TYR A 59 5 ? 5 HELX_P HELX_P2 AA2 SER A 144 ? TYR A 152 ? SER A 164 TYR A 172 1 ? 9 HELX_P HELX_P3 AA3 TYR A 212 ? SER A 222 ? TYR A 234 SER A 244 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 7 SG ? ? ? 1_555 A CYS 137 SG ? ? A CYS 22 A CYS 157 1_555 ? ? ? ? ? ? ? 2.027 ? ? disulf2 disulf ? ? A CYS 25 SG ? ? ? 1_555 A CYS 41 SG ? ? A CYS 42 A CYS 58 1_555 ? ? ? ? ? ? ? 2.028 ? ? disulf3 disulf ? ? A CYS 109 SG ? ? ? 1_555 A CYS 210 SG ? ? A CYS 128 A CYS 232 1_555 ? ? ? ? ? ? ? 2.033 ? ? disulf4 disulf ? ? A CYS 116 SG ? ? ? 1_555 A CYS 183 SG ? ? A CYS 136 A CYS 201 1_555 ? ? ? ? ? ? ? 2.034 ? ? disulf5 disulf ? ? A CYS 148 SG ? ? ? 1_555 A CYS 162 SG ? ? A CYS 168 A CYS 182 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf6 disulf ? ? A CYS 173 SG ? ? ? 1_555 A CYS 197 SG ? ? A CYS 191 A CYS 220 1_555 ? ? ? ? ? ? ? 2.028 ? ? metalc1 metalc ? ? A GLU 52 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 70 A CA 301 1_555 ? ? ? ? ? ? ? 2.257 ? ? metalc2 metalc ? ? A ASN 54 O ? ? ? 1_555 B CA . CA ? ? A ASN 72 A CA 301 1_555 ? ? ? ? ? ? ? 2.308 ? ? metalc3 metalc ? ? A VAL 57 O ? ? ? 1_555 B CA . CA ? ? A VAL 75 A CA 301 1_555 ? ? ? ? ? ? ? 2.209 ? ? metalc4 metalc ? ? A GLU 62 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 80 A CA 301 1_555 ? ? ? ? ? ? ? 2.350 ? ? metalc5 metalc ? ? B CA . CA ? ? ? 1_555 D DOD . O ? ? A CA 301 A DOD 404 1_555 ? ? ? ? ? ? ? 2.382 ? ? metalc6 metalc ? ? B CA . CA ? ? ? 1_555 D DOD . O ? ? A CA 301 A DOD 436 1_555 ? ? ? ? ? ? ? 2.332 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 52 ? A GLU 70 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? A ASN 54 ? A ASN 72 ? 1_555 91.9 ? 2 OE1 ? A GLU 52 ? A GLU 70 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? A VAL 57 ? A VAL 75 ? 1_555 166.4 ? 3 O ? A ASN 54 ? A ASN 72 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? A VAL 57 ? A VAL 75 ? 1_555 82.1 ? 4 OE1 ? A GLU 52 ? A GLU 70 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 OE2 ? A GLU 62 ? A GLU 80 ? 1_555 99.3 ? 5 O ? A ASN 54 ? A ASN 72 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 OE2 ? A GLU 62 ? A GLU 80 ? 1_555 160.6 ? 6 O ? A VAL 57 ? A VAL 75 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 OE2 ? A GLU 62 ? A GLU 80 ? 1_555 89.9 ? 7 OE1 ? A GLU 52 ? A GLU 70 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? D DOD . ? A DOD 404 ? 1_555 83.8 ? 8 O ? A ASN 54 ? A ASN 72 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? D DOD . ? A DOD 404 ? 1_555 90.5 ? 9 O ? A VAL 57 ? A VAL 75 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? D DOD . ? A DOD 404 ? 1_555 108.4 ? 10 OE2 ? A GLU 62 ? A GLU 80 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? D DOD . ? A DOD 404 ? 1_555 75.1 ? 11 OE1 ? A GLU 52 ? A GLU 70 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? D DOD . ? A DOD 436 ? 1_555 79.7 ? 12 O ? A ASN 54 ? A ASN 72 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? D DOD . ? A DOD 436 ? 1_555 99.7 ? 13 O ? A VAL 57 ? A VAL 75 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? D DOD . ? A DOD 436 ? 1_555 89.2 ? 14 OE2 ? A GLU 62 ? A GLU 80 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? D DOD . ? A DOD 436 ? 1_555 97.9 ? 15 O ? D DOD . ? A DOD 404 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? D DOD . ? A DOD 436 ? 1_555 160.8 ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 7 ? CYS A 137 ? CYS A 22 ? 1_555 CYS A 157 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 25 ? CYS A 41 ? CYS A 42 ? 1_555 CYS A 58 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 109 ? CYS A 210 ? CYS A 128 ? 1_555 CYS A 232 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 116 ? CYS A 183 ? CYS A 136 ? 1_555 CYS A 201 ? 1_555 SG SG . . . None 'Disulfide bridge' 5 CYS A 148 ? CYS A 162 ? CYS A 168 ? 1_555 CYS A 182 ? 1_555 SG SG . . . None 'Disulfide bridge' 6 CYS A 173 ? CYS A 197 ? CYS A 191 ? 1_555 CYS A 220 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 5 ? THR A 6 ? TYR A 20 THR A 21 AA1 2 LYS A 136 ? PRO A 141 ? LYS A 156 PRO A 161 AA1 3 GLN A 115 ? GLY A 120 ? GLN A 135 GLY A 140 AA1 4 PRO A 180 ? CYS A 183 ? PRO A 198 CYS A 201 AA1 5 LYS A 186 ? TRP A 193 ? LYS A 204 TRP A 215 AA1 6 GLY A 204 ? LYS A 208 ? GLY A 226 LYS A 230 AA1 7 MET A 160 ? ALA A 163 ? MET A 180 ALA A 183 AA2 1 GLN A 15 ? ASN A 19 ? GLN A 30 ASN A 34 AA2 2 HIS A 23 ? ASN A 31 ? HIS A 40 ASN A 48 AA2 3 TRP A 34 ? SER A 37 ? TRP A 51 SER A 54 AA2 4 MET A 86 ? LEU A 90 ? MET A 104 LEU A 108 AA2 5 GLN A 63 ? VAL A 72 ? GLN A 81 VAL A 90 AA2 6 GLN A 47 ? LEU A 50 ? GLN A 64 LEU A 67 AA2 7 GLN A 15 ? ASN A 19 ? GLN A 30 ASN A 34 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TYR A 5 ? N TYR A 20 O CYS A 137 ? O CYS A 157 AA1 2 3 O LEU A 138 ? O LEU A 158 N ILE A 118 ? N ILE A 138 AA1 3 4 N LEU A 117 ? N LEU A 137 O VAL A 182 ? O VAL A 200 AA1 4 5 N CYS A 183 ? N CYS A 201 O LYS A 186 ? O LYS A 204 AA1 5 6 N TRP A 193 ? N TRP A 215 O VAL A 205 ? O VAL A 227 AA1 6 7 O TYR A 206 ? O TYR A 228 N PHE A 161 ? N PHE A 181 AA2 1 2 N LEU A 18 ? N LEU A 33 O CYS A 25 ? O CYS A 42 AA2 2 3 N SER A 28 ? N SER A 45 O VAL A 36 ? O VAL A 53 AA2 3 4 N VAL A 35 ? N VAL A 52 O ILE A 88 ? O ILE A 106 AA2 4 5 O LEU A 87 ? O LEU A 105 N ILE A 71 ? N ILE A 89 AA2 5 6 O GLN A 63 ? O GLN A 81 N LEU A 50 ? N LEU A 67 AA2 6 7 O ARG A 49 ? O ARG A 66 N SER A 17 ? N SER A 32 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 301 ? 6 'binding site for residue CA A 301' AC2 Software A BEN 302 ? 7 'binding site for residue BEN A 302' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 GLU A 52 ? GLU A 70 . ? 1_555 ? 2 AC1 6 ASN A 54 ? ASN A 72 . ? 1_555 ? 3 AC1 6 VAL A 57 ? VAL A 75 . ? 1_555 ? 4 AC1 6 GLU A 62 ? GLU A 80 . ? 1_555 ? 5 AC1 6 DOD D . ? DOD A 404 . ? 1_555 ? 6 AC1 6 DOD D . ? DOD A 436 . ? 1_555 ? 7 AC2 7 ASP A 171 ? ASP A 189 . ? 1_555 ? 8 AC2 7 SER A 172 ? SER A 190 . ? 1_555 ? 9 AC2 7 SER A 177 ? SER A 195 . ? 1_555 ? 10 AC2 7 GLY A 194 ? GLY A 216 . ? 1_555 ? 11 AC2 7 GLY A 196 ? GLY A 219 . ? 1_555 ? 12 AC2 7 GLY A 204 ? GLY A 226 . ? 1_555 ? 13 AC2 7 DOD D . ? DOD A 456 . ? 1_555 ? # _pdbx_entry_details.entry_id 5MO0 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HZ3 A LYS 87 ? A O A DOD 405 ? ? 1.58 2 1 DZ3 A LYS 87 ? B O A DOD 405 ? ? 1.58 3 1 O A DOD 481 ? ? O A DOD 536 ? ? 2.16 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 48 ? ? -170.08 -178.64 2 1 ASP A 71 ? ? -119.62 -75.98 3 1 SER A 214 ? ? -120.24 -65.15 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BEN C1 C Y N 74 BEN C2 C Y N 75 BEN C3 C Y N 76 BEN C4 C Y N 77 BEN C5 C Y N 78 BEN C6 C Y N 79 BEN C C N N 80 BEN N1 N N N 81 BEN N2 N N N 82 BEN H2 H N N 83 BEN H3 H N N 84 BEN H4 H N N 85 BEN H5 H N N 86 BEN H6 H N N 87 BEN HN1 H N N 88 BEN HN21 H N N 89 BEN HN22 H N N 90 CA CA CA N N 91 CYS N N N N 92 CYS CA C N R 93 CYS C C N N 94 CYS O O N N 95 CYS CB C N N 96 CYS SG S N N 97 CYS OXT O N N 98 CYS H H N N 99 CYS H2 H N N 100 CYS HA H N N 101 CYS HB2 H N N 102 CYS HB3 H N N 103 CYS HG H N N 104 CYS HXT H N N 105 DOD O O N N 106 DOD D1 D N N 107 DOD D2 D N N 108 GLN N N N N 109 GLN CA C N S 110 GLN C C N N 111 GLN O O N N 112 GLN CB C N N 113 GLN CG C N N 114 GLN CD C N N 115 GLN OE1 O N N 116 GLN NE2 N N N 117 GLN OXT O N N 118 GLN H H N N 119 GLN H2 H N N 120 GLN HA H N N 121 GLN HB2 H N N 122 GLN HB3 H N N 123 GLN HG2 H N N 124 GLN HG3 H N N 125 GLN HE21 H N N 126 GLN HE22 H N N 127 GLN HXT H N N 128 GLU N N N N 129 GLU CA C N S 130 GLU C C N N 131 GLU O O N N 132 GLU CB C N N 133 GLU CG C N N 134 GLU CD C N N 135 GLU OE1 O N N 136 GLU OE2 O N N 137 GLU OXT O N N 138 GLU H H N N 139 GLU H2 H N N 140 GLU HA H N N 141 GLU HB2 H N N 142 GLU HB3 H N N 143 GLU HG2 H N N 144 GLU HG3 H N N 145 GLU HE2 H N N 146 GLU HXT H N N 147 GLY N N N N 148 GLY CA C N N 149 GLY C C N N 150 GLY O O N N 151 GLY OXT O N N 152 GLY H H N N 153 GLY H2 H N N 154 GLY HA2 H N N 155 GLY HA3 H N N 156 GLY HXT H N N 157 HIS N N N N 158 HIS CA C N S 159 HIS C C N N 160 HIS O O N N 161 HIS CB C N N 162 HIS CG C Y N 163 HIS ND1 N Y N 164 HIS CD2 C Y N 165 HIS CE1 C Y N 166 HIS NE2 N Y N 167 HIS OXT O N N 168 HIS H H N N 169 HIS H2 H N N 170 HIS HA H N N 171 HIS HB2 H N N 172 HIS HB3 H N N 173 HIS HD1 H N N 174 HIS HD2 H N N 175 HIS HE1 H N N 176 HIS HE2 H N N 177 HIS HXT H N N 178 ILE N N N N 179 ILE CA C N S 180 ILE C C N N 181 ILE O O N N 182 ILE CB C N S 183 ILE CG1 C N N 184 ILE CG2 C N N 185 ILE CD1 C N N 186 ILE OXT O N N 187 ILE H H N N 188 ILE H2 H N N 189 ILE HA H N N 190 ILE HB H N N 191 ILE HG12 H N N 192 ILE HG13 H N N 193 ILE HG21 H N N 194 ILE HG22 H N N 195 ILE HG23 H N N 196 ILE HD11 H N N 197 ILE HD12 H N N 198 ILE HD13 H N N 199 ILE HXT H N N 200 LEU N N N N 201 LEU CA C N S 202 LEU C C N N 203 LEU O O N N 204 LEU CB C N N 205 LEU CG C N N 206 LEU CD1 C N N 207 LEU CD2 C N N 208 LEU OXT O N N 209 LEU H H N N 210 LEU H2 H N N 211 LEU HA H N N 212 LEU HB2 H N N 213 LEU HB3 H N N 214 LEU HG H N N 215 LEU HD11 H N N 216 LEU HD12 H N N 217 LEU HD13 H N N 218 LEU HD21 H N N 219 LEU HD22 H N N 220 LEU HD23 H N N 221 LEU HXT H N N 222 LYS N N N N 223 LYS CA C N S 224 LYS C C N N 225 LYS O O N N 226 LYS CB C N N 227 LYS CG C N N 228 LYS CD C N N 229 LYS CE C N N 230 LYS NZ N N N 231 LYS OXT O N N 232 LYS H H N N 233 LYS H2 H N N 234 LYS HA H N N 235 LYS HB2 H N N 236 LYS HB3 H N N 237 LYS HG2 H N N 238 LYS HG3 H N N 239 LYS HD2 H N N 240 LYS HD3 H N N 241 LYS HE2 H N N 242 LYS HE3 H N N 243 LYS HZ1 H N N 244 LYS HZ2 H N N 245 LYS HZ3 H N N 246 LYS HXT H N N 247 MET N N N N 248 MET CA C N S 249 MET C C N N 250 MET O O N N 251 MET CB C N N 252 MET CG C N N 253 MET SD S N N 254 MET CE C N N 255 MET OXT O N N 256 MET H H N N 257 MET H2 H N N 258 MET HA H N N 259 MET HB2 H N N 260 MET HB3 H N N 261 MET HG2 H N N 262 MET HG3 H N N 263 MET HE1 H N N 264 MET HE2 H N N 265 MET HE3 H N N 266 MET HXT H N N 267 PHE N N N N 268 PHE CA C N S 269 PHE C C N N 270 PHE O O N N 271 PHE CB C N N 272 PHE CG C Y N 273 PHE CD1 C Y N 274 PHE CD2 C Y N 275 PHE CE1 C Y N 276 PHE CE2 C Y N 277 PHE CZ C Y N 278 PHE OXT O N N 279 PHE H H N N 280 PHE H2 H N N 281 PHE HA H N N 282 PHE HB2 H N N 283 PHE HB3 H N N 284 PHE HD1 H N N 285 PHE HD2 H N N 286 PHE HE1 H N N 287 PHE HE2 H N N 288 PHE HZ H N N 289 PHE HXT H N N 290 PRO N N N N 291 PRO CA C N S 292 PRO C C N N 293 PRO O O N N 294 PRO CB C N N 295 PRO CG C N N 296 PRO CD C N N 297 PRO OXT O N N 298 PRO H H N N 299 PRO HA H N N 300 PRO HB2 H N N 301 PRO HB3 H N N 302 PRO HG2 H N N 303 PRO HG3 H N N 304 PRO HD2 H N N 305 PRO HD3 H N N 306 PRO HXT H N N 307 SER N N N N 308 SER CA C N S 309 SER C C N N 310 SER O O N N 311 SER CB C N N 312 SER OG O N N 313 SER OXT O N N 314 SER H H N N 315 SER H2 H N N 316 SER HA H N N 317 SER HB2 H N N 318 SER HB3 H N N 319 SER HG H N N 320 SER HXT H N N 321 THR N N N N 322 THR CA C N S 323 THR C C N N 324 THR O O N N 325 THR CB C N R 326 THR OG1 O N N 327 THR CG2 C N N 328 THR OXT O N N 329 THR H H N N 330 THR H2 H N N 331 THR HA H N N 332 THR HB H N N 333 THR HG1 H N N 334 THR HG21 H N N 335 THR HG22 H N N 336 THR HG23 H N N 337 THR HXT H N N 338 TRP N N N N 339 TRP CA C N S 340 TRP C C N N 341 TRP O O N N 342 TRP CB C N N 343 TRP CG C Y N 344 TRP CD1 C Y N 345 TRP CD2 C Y N 346 TRP NE1 N Y N 347 TRP CE2 C Y N 348 TRP CE3 C Y N 349 TRP CZ2 C Y N 350 TRP CZ3 C Y N 351 TRP CH2 C Y N 352 TRP OXT O N N 353 TRP H H N N 354 TRP H2 H N N 355 TRP HA H N N 356 TRP HB2 H N N 357 TRP HB3 H N N 358 TRP HD1 H N N 359 TRP HE1 H N N 360 TRP HE3 H N N 361 TRP HZ2 H N N 362 TRP HZ3 H N N 363 TRP HH2 H N N 364 TRP HXT H N N 365 TYR N N N N 366 TYR CA C N S 367 TYR C C N N 368 TYR O O N N 369 TYR CB C N N 370 TYR CG C Y N 371 TYR CD1 C Y N 372 TYR CD2 C Y N 373 TYR CE1 C Y N 374 TYR CE2 C Y N 375 TYR CZ C Y N 376 TYR OH O N N 377 TYR OXT O N N 378 TYR H H N N 379 TYR H2 H N N 380 TYR HA H N N 381 TYR HB2 H N N 382 TYR HB3 H N N 383 TYR HD1 H N N 384 TYR HD2 H N N 385 TYR HE1 H N N 386 TYR HE2 H N N 387 TYR HH H N N 388 TYR HXT H N N 389 VAL N N N N 390 VAL CA C N S 391 VAL C C N N 392 VAL O O N N 393 VAL CB C N N 394 VAL CG1 C N N 395 VAL CG2 C N N 396 VAL OXT O N N 397 VAL H H N N 398 VAL H2 H N N 399 VAL HA H N N 400 VAL HB H N N 401 VAL HG11 H N N 402 VAL HG12 H N N 403 VAL HG13 H N N 404 VAL HG21 H N N 405 VAL HG22 H N N 406 VAL HG23 H N N 407 VAL HXT H N N 408 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 BEN C1 C2 doub Y N 70 BEN C1 C6 sing Y N 71 BEN C1 C sing N N 72 BEN C2 C3 sing Y N 73 BEN C2 H2 sing N N 74 BEN C3 C4 doub Y N 75 BEN C3 H3 sing N N 76 BEN C4 C5 sing Y N 77 BEN C4 H4 sing N N 78 BEN C5 C6 doub Y N 79 BEN C5 H5 sing N N 80 BEN C6 H6 sing N N 81 BEN C N1 doub N E 82 BEN C N2 sing N N 83 BEN N1 HN1 sing N N 84 BEN N2 HN21 sing N N 85 BEN N2 HN22 sing N N 86 CYS N CA sing N N 87 CYS N H sing N N 88 CYS N H2 sing N N 89 CYS CA C sing N N 90 CYS CA CB sing N N 91 CYS CA HA sing N N 92 CYS C O doub N N 93 CYS C OXT sing N N 94 CYS CB SG sing N N 95 CYS CB HB2 sing N N 96 CYS CB HB3 sing N N 97 CYS SG HG sing N N 98 CYS OXT HXT sing N N 99 DOD O D1 sing N N 100 DOD O D2 sing N N 101 GLN N CA sing N N 102 GLN N H sing N N 103 GLN N H2 sing N N 104 GLN CA C sing N N 105 GLN CA CB sing N N 106 GLN CA HA sing N N 107 GLN C O doub N N 108 GLN C OXT sing N N 109 GLN CB CG sing N N 110 GLN CB HB2 sing N N 111 GLN CB HB3 sing N N 112 GLN CG CD sing N N 113 GLN CG HG2 sing N N 114 GLN CG HG3 sing N N 115 GLN CD OE1 doub N N 116 GLN CD NE2 sing N N 117 GLN NE2 HE21 sing N N 118 GLN NE2 HE22 sing N N 119 GLN OXT HXT sing N N 120 GLU N CA sing N N 121 GLU N H sing N N 122 GLU N H2 sing N N 123 GLU CA C sing N N 124 GLU CA CB sing N N 125 GLU CA HA sing N N 126 GLU C O doub N N 127 GLU C OXT sing N N 128 GLU CB CG sing N N 129 GLU CB HB2 sing N N 130 GLU CB HB3 sing N N 131 GLU CG CD sing N N 132 GLU CG HG2 sing N N 133 GLU CG HG3 sing N N 134 GLU CD OE1 doub N N 135 GLU CD OE2 sing N N 136 GLU OE2 HE2 sing N N 137 GLU OXT HXT sing N N 138 GLY N CA sing N N 139 GLY N H sing N N 140 GLY N H2 sing N N 141 GLY CA C sing N N 142 GLY CA HA2 sing N N 143 GLY CA HA3 sing N N 144 GLY C O doub N N 145 GLY C OXT sing N N 146 GLY OXT HXT sing N N 147 HIS N CA sing N N 148 HIS N H sing N N 149 HIS N H2 sing N N 150 HIS CA C sing N N 151 HIS CA CB sing N N 152 HIS CA HA sing N N 153 HIS C O doub N N 154 HIS C OXT sing N N 155 HIS CB CG sing N N 156 HIS CB HB2 sing N N 157 HIS CB HB3 sing N N 158 HIS CG ND1 sing Y N 159 HIS CG CD2 doub Y N 160 HIS ND1 CE1 doub Y N 161 HIS ND1 HD1 sing N N 162 HIS CD2 NE2 sing Y N 163 HIS CD2 HD2 sing N N 164 HIS CE1 NE2 sing Y N 165 HIS CE1 HE1 sing N N 166 HIS NE2 HE2 sing N N 167 HIS OXT HXT sing N N 168 ILE N CA sing N N 169 ILE N H sing N N 170 ILE N H2 sing N N 171 ILE CA C sing N N 172 ILE CA CB sing N N 173 ILE CA HA sing N N 174 ILE C O doub N N 175 ILE C OXT sing N N 176 ILE CB CG1 sing N N 177 ILE CB CG2 sing N N 178 ILE CB HB sing N N 179 ILE CG1 CD1 sing N N 180 ILE CG1 HG12 sing N N 181 ILE CG1 HG13 sing N N 182 ILE CG2 HG21 sing N N 183 ILE CG2 HG22 sing N N 184 ILE CG2 HG23 sing N N 185 ILE CD1 HD11 sing N N 186 ILE CD1 HD12 sing N N 187 ILE CD1 HD13 sing N N 188 ILE OXT HXT sing N N 189 LEU N CA sing N N 190 LEU N H sing N N 191 LEU N H2 sing N N 192 LEU CA C sing N N 193 LEU CA CB sing N N 194 LEU CA HA sing N N 195 LEU C O doub N N 196 LEU C OXT sing N N 197 LEU CB CG sing N N 198 LEU CB HB2 sing N N 199 LEU CB HB3 sing N N 200 LEU CG CD1 sing N N 201 LEU CG CD2 sing N N 202 LEU CG HG sing N N 203 LEU CD1 HD11 sing N N 204 LEU CD1 HD12 sing N N 205 LEU CD1 HD13 sing N N 206 LEU CD2 HD21 sing N N 207 LEU CD2 HD22 sing N N 208 LEU CD2 HD23 sing N N 209 LEU OXT HXT sing N N 210 LYS N CA sing N N 211 LYS N H sing N N 212 LYS N H2 sing N N 213 LYS CA C sing N N 214 LYS CA CB sing N N 215 LYS CA HA sing N N 216 LYS C O doub N N 217 LYS C OXT sing N N 218 LYS CB CG sing N N 219 LYS CB HB2 sing N N 220 LYS CB HB3 sing N N 221 LYS CG CD sing N N 222 LYS CG HG2 sing N N 223 LYS CG HG3 sing N N 224 LYS CD CE sing N N 225 LYS CD HD2 sing N N 226 LYS CD HD3 sing N N 227 LYS CE NZ sing N N 228 LYS CE HE2 sing N N 229 LYS CE HE3 sing N N 230 LYS NZ HZ1 sing N N 231 LYS NZ HZ2 sing N N 232 LYS NZ HZ3 sing N N 233 LYS OXT HXT sing N N 234 MET N CA sing N N 235 MET N H sing N N 236 MET N H2 sing N N 237 MET CA C sing N N 238 MET CA CB sing N N 239 MET CA HA sing N N 240 MET C O doub N N 241 MET C OXT sing N N 242 MET CB CG sing N N 243 MET CB HB2 sing N N 244 MET CB HB3 sing N N 245 MET CG SD sing N N 246 MET CG HG2 sing N N 247 MET CG HG3 sing N N 248 MET SD CE sing N N 249 MET CE HE1 sing N N 250 MET CE HE2 sing N N 251 MET CE HE3 sing N N 252 MET OXT HXT sing N N 253 PHE N CA sing N N 254 PHE N H sing N N 255 PHE N H2 sing N N 256 PHE CA C sing N N 257 PHE CA CB sing N N 258 PHE CA HA sing N N 259 PHE C O doub N N 260 PHE C OXT sing N N 261 PHE CB CG sing N N 262 PHE CB HB2 sing N N 263 PHE CB HB3 sing N N 264 PHE CG CD1 doub Y N 265 PHE CG CD2 sing Y N 266 PHE CD1 CE1 sing Y N 267 PHE CD1 HD1 sing N N 268 PHE CD2 CE2 doub Y N 269 PHE CD2 HD2 sing N N 270 PHE CE1 CZ doub Y N 271 PHE CE1 HE1 sing N N 272 PHE CE2 CZ sing Y N 273 PHE CE2 HE2 sing N N 274 PHE CZ HZ sing N N 275 PHE OXT HXT sing N N 276 PRO N CA sing N N 277 PRO N CD sing N N 278 PRO N H sing N N 279 PRO CA C sing N N 280 PRO CA CB sing N N 281 PRO CA HA sing N N 282 PRO C O doub N N 283 PRO C OXT sing N N 284 PRO CB CG sing N N 285 PRO CB HB2 sing N N 286 PRO CB HB3 sing N N 287 PRO CG CD sing N N 288 PRO CG HG2 sing N N 289 PRO CG HG3 sing N N 290 PRO CD HD2 sing N N 291 PRO CD HD3 sing N N 292 PRO OXT HXT sing N N 293 SER N CA sing N N 294 SER N H sing N N 295 SER N H2 sing N N 296 SER CA C sing N N 297 SER CA CB sing N N 298 SER CA HA sing N N 299 SER C O doub N N 300 SER C OXT sing N N 301 SER CB OG sing N N 302 SER CB HB2 sing N N 303 SER CB HB3 sing N N 304 SER OG HG sing N N 305 SER OXT HXT sing N N 306 THR N CA sing N N 307 THR N H sing N N 308 THR N H2 sing N N 309 THR CA C sing N N 310 THR CA CB sing N N 311 THR CA HA sing N N 312 THR C O doub N N 313 THR C OXT sing N N 314 THR CB OG1 sing N N 315 THR CB CG2 sing N N 316 THR CB HB sing N N 317 THR OG1 HG1 sing N N 318 THR CG2 HG21 sing N N 319 THR CG2 HG22 sing N N 320 THR CG2 HG23 sing N N 321 THR OXT HXT sing N N 322 TRP N CA sing N N 323 TRP N H sing N N 324 TRP N H2 sing N N 325 TRP CA C sing N N 326 TRP CA CB sing N N 327 TRP CA HA sing N N 328 TRP C O doub N N 329 TRP C OXT sing N N 330 TRP CB CG sing N N 331 TRP CB HB2 sing N N 332 TRP CB HB3 sing N N 333 TRP CG CD1 doub Y N 334 TRP CG CD2 sing Y N 335 TRP CD1 NE1 sing Y N 336 TRP CD1 HD1 sing N N 337 TRP CD2 CE2 doub Y N 338 TRP CD2 CE3 sing Y N 339 TRP NE1 CE2 sing Y N 340 TRP NE1 HE1 sing N N 341 TRP CE2 CZ2 sing Y N 342 TRP CE3 CZ3 doub Y N 343 TRP CE3 HE3 sing N N 344 TRP CZ2 CH2 doub Y N 345 TRP CZ2 HZ2 sing N N 346 TRP CZ3 CH2 sing Y N 347 TRP CZ3 HZ3 sing N N 348 TRP CH2 HH2 sing N N 349 TRP OXT HXT sing N N 350 TYR N CA sing N N 351 TYR N H sing N N 352 TYR N H2 sing N N 353 TYR CA C sing N N 354 TYR CA CB sing N N 355 TYR CA HA sing N N 356 TYR C O doub N N 357 TYR C OXT sing N N 358 TYR CB CG sing N N 359 TYR CB HB2 sing N N 360 TYR CB HB3 sing N N 361 TYR CG CD1 doub Y N 362 TYR CG CD2 sing Y N 363 TYR CD1 CE1 sing Y N 364 TYR CD1 HD1 sing N N 365 TYR CD2 CE2 doub Y N 366 TYR CD2 HD2 sing N N 367 TYR CE1 CZ doub Y N 368 TYR CE1 HE1 sing N N 369 TYR CE2 CZ sing Y N 370 TYR CE2 HE2 sing N N 371 TYR CZ OH sing N N 372 TYR OH HH sing N N 373 TYR OXT HXT sing N N 374 VAL N CA sing N N 375 VAL N H sing N N 376 VAL N H2 sing N N 377 VAL CA C sing N N 378 VAL CA CB sing N N 379 VAL CA HA sing N N 380 VAL C O doub N N 381 VAL C OXT sing N N 382 VAL CB CG1 sing N N 383 VAL CB CG2 sing N N 384 VAL CB HB sing N N 385 VAL CG1 HG11 sing N N 386 VAL CG1 HG12 sing N N 387 VAL CG1 HG13 sing N N 388 VAL CG2 HG21 sing N N 389 VAL CG2 HG22 sing N N 390 VAL CG2 HG23 sing N N 391 VAL OXT HXT sing N N 392 # _pdbx_audit_support.funding_organization 'European Research Council' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number 268145-DrugProfilBind268145-DrugProfilBind _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4I8H _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 5MO0 _atom_sites.fract_transf_matrix[1][1] 0.018211 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017040 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014811 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA D H N O S # loop_