data_5MOR # _entry.id 5MOR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.299 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5MOR WWPDB D_1200002719 # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'Refinement against only the X-ray diffraction data resulted in this structure' 5MNM unspecified PDB 'Refinement against only the neutron diffraction data resulted in this structure' 5MO1 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5MOR _pdbx_database_status.recvd_initial_deposition_date 2016-12-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Schiebel, J.' 1 ? 'Schrader, T.E.' 2 ? 'Ostermann, A.' 3 ? 'Heine, A.' 4 ? 'Klebe, G.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'to be published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Joint X-ray/neutron structure of cationic trypsin in complex with benzylamine' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Schiebel, J.' 1 ? primary 'Heine, A.' 2 ? primary 'Klebe, G.' 3 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5MOR _cell.details ? _cell.formula_units_Z ? _cell.length_a 54.841 _cell.length_a_esd ? _cell.length_b 58.334 _cell.length_b_esd ? _cell.length_c 67.781 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5MOR _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'Cationic trypsin' 23324.287 1 3.4.21.4 ? ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 3 non-polymer syn '(phenylmethyl)azanium' 108.161 1 ? ? ? ? 4 non-polymer syn 'SULFATE ION' 96.063 3 ? ? ? ? 5 water nat water 18.015 146 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Beta-trypsin # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNT LNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNM FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN ; _entity_poly.pdbx_seq_one_letter_code_can ;IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNT LNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNM FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 VAL n 1 3 GLY n 1 4 GLY n 1 5 TYR n 1 6 THR n 1 7 CYS n 1 8 GLY n 1 9 ALA n 1 10 ASN n 1 11 THR n 1 12 VAL n 1 13 PRO n 1 14 TYR n 1 15 GLN n 1 16 VAL n 1 17 SER n 1 18 LEU n 1 19 ASN n 1 20 SER n 1 21 GLY n 1 22 TYR n 1 23 HIS n 1 24 PHE n 1 25 CYS n 1 26 GLY n 1 27 GLY n 1 28 SER n 1 29 LEU n 1 30 ILE n 1 31 ASN n 1 32 SER n 1 33 GLN n 1 34 TRP n 1 35 VAL n 1 36 VAL n 1 37 SER n 1 38 ALA n 1 39 ALA n 1 40 HIS n 1 41 CYS n 1 42 TYR n 1 43 LYS n 1 44 SER n 1 45 GLY n 1 46 ILE n 1 47 GLN n 1 48 VAL n 1 49 ARG n 1 50 LEU n 1 51 GLY n 1 52 GLU n 1 53 ASP n 1 54 ASN n 1 55 ILE n 1 56 ASN n 1 57 VAL n 1 58 VAL n 1 59 GLU n 1 60 GLY n 1 61 ASN n 1 62 GLU n 1 63 GLN n 1 64 PHE n 1 65 ILE n 1 66 SER n 1 67 ALA n 1 68 SER n 1 69 LYS n 1 70 SER n 1 71 ILE n 1 72 VAL n 1 73 HIS n 1 74 PRO n 1 75 SER n 1 76 TYR n 1 77 ASN n 1 78 SER n 1 79 ASN n 1 80 THR n 1 81 LEU n 1 82 ASN n 1 83 ASN n 1 84 ASP n 1 85 ILE n 1 86 MET n 1 87 LEU n 1 88 ILE n 1 89 LYS n 1 90 LEU n 1 91 LYS n 1 92 SER n 1 93 ALA n 1 94 ALA n 1 95 SER n 1 96 LEU n 1 97 ASN n 1 98 SER n 1 99 ARG n 1 100 VAL n 1 101 ALA n 1 102 SER n 1 103 ILE n 1 104 SER n 1 105 LEU n 1 106 PRO n 1 107 THR n 1 108 SER n 1 109 CYS n 1 110 ALA n 1 111 SER n 1 112 ALA n 1 113 GLY n 1 114 THR n 1 115 GLN n 1 116 CYS n 1 117 LEU n 1 118 ILE n 1 119 SER n 1 120 GLY n 1 121 TRP n 1 122 GLY n 1 123 ASN n 1 124 THR n 1 125 LYS n 1 126 SER n 1 127 SER n 1 128 GLY n 1 129 THR n 1 130 SER n 1 131 TYR n 1 132 PRO n 1 133 ASP n 1 134 VAL n 1 135 LEU n 1 136 LYS n 1 137 CYS n 1 138 LEU n 1 139 LYS n 1 140 ALA n 1 141 PRO n 1 142 ILE n 1 143 LEU n 1 144 SER n 1 145 ASP n 1 146 SER n 1 147 SER n 1 148 CYS n 1 149 LYS n 1 150 SER n 1 151 ALA n 1 152 TYR n 1 153 PRO n 1 154 GLY n 1 155 GLN n 1 156 ILE n 1 157 THR n 1 158 SER n 1 159 ASN n 1 160 MET n 1 161 PHE n 1 162 CYS n 1 163 ALA n 1 164 GLY n 1 165 TYR n 1 166 LEU n 1 167 GLU n 1 168 GLY n 1 169 GLY n 1 170 LYS n 1 171 ASP n 1 172 SER n 1 173 CYS n 1 174 GLN n 1 175 GLY n 1 176 ASP n 1 177 SER n 1 178 GLY n 1 179 GLY n 1 180 PRO n 1 181 VAL n 1 182 VAL n 1 183 CYS n 1 184 SER n 1 185 GLY n 1 186 LYS n 1 187 LEU n 1 188 GLN n 1 189 GLY n 1 190 ILE n 1 191 VAL n 1 192 SER n 1 193 TRP n 1 194 GLY n 1 195 SER n 1 196 GLY n 1 197 CYS n 1 198 ALA n 1 199 GLN n 1 200 LYS n 1 201 ASN n 1 202 LYS n 1 203 PRO n 1 204 GLY n 1 205 VAL n 1 206 TYR n 1 207 THR n 1 208 LYS n 1 209 VAL n 1 210 CYS n 1 211 ASN n 1 212 TYR n 1 213 VAL n 1 214 SER n 1 215 TRP n 1 216 ILE n 1 217 LYS n 1 218 GLN n 1 219 THR n 1 220 ILE n 1 221 ALA n 1 222 SER n 1 223 ASN n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num 1 _entity_src_nat.pdbx_end_seq_num 223 _entity_src_nat.common_name Bovine _entity_src_nat.pdbx_organism_scientific 'Bos taurus' _entity_src_nat.pdbx_ncbi_taxonomy_id 9913 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TRY1_BOVIN _struct_ref.pdbx_db_accession P00760 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNT LNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNM FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN ; _struct_ref.pdbx_align_begin 24 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5MOR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 223 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00760 _struct_ref_seq.db_align_beg 24 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 246 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 16 _struct_ref_seq.pdbx_auth_seq_align_end 245 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DOD non-polymer . 'DEUTERATED WATER' ? 'D2 O' 20.028 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 UFZ non-polymer . '(phenylmethyl)azanium' ? 'C7 H10 N 1' 108.161 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _exptl.absorpt_coefficient_mu _exptl.absorpt_correction_T_max _exptl.absorpt_correction_T_min _exptl.absorpt_correction_type _exptl.absorpt_process_details _exptl.entry_id _exptl.crystals_number _exptl.details _exptl.method _exptl.method_details ? ? ? ? ? 5MOR 1 ? 'X-RAY DIFFRACTION' ? ? ? ? ? ? 5MOR ? ? 'NEUTRON DIFFRACTION' ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.32 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.08 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M ammonium sulfate, 0.1 M Hepes pH 7.5, 15.0-16.5% (w/v) PEG 8000' _exptl_crystal_grow.pdbx_pH_range ? # loop_ _diffrn.ambient_environment _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.ambient_temp_esd _diffrn.crystal_id _diffrn.crystal_support _diffrn.crystal_treatment _diffrn.details _diffrn.id _diffrn.ambient_pressure _diffrn.ambient_pressure_esd _diffrn.ambient_pressure_gt _diffrn.ambient_pressure_lt _diffrn.ambient_temp_gt _diffrn.ambient_temp_lt _diffrn.pdbx_serial_crystal_experiment ? 295 ? ? 1 ? ? ? 1 ? ? ? ? ? ? ? ? 295 ? ? 1 ? ? ? 2 ? ? ? ? ? ? ? # loop_ _diffrn_detector.details _diffrn_detector.detector _diffrn_detector.diffrn_id _diffrn_detector.type _diffrn_detector.area_resol_mean _diffrn_detector.dtime _diffrn_detector.pdbx_frames_total _diffrn_detector.pdbx_collection_time_total _diffrn_detector.pdbx_collection_date ? PIXEL 1 'DECTRIS PILATUS 6M' ? ? ? ? 2015-06-10 ? 'IMAGE PLATE' 2 'MAATEL BIODIFF' ? ? ? ? 2016-08-10 # loop_ _diffrn_radiation.collimation _diffrn_radiation.diffrn_id _diffrn_radiation.filter_edge _diffrn_radiation.inhomogeneity _diffrn_radiation.monochromator _diffrn_radiation.polarisn_norm _diffrn_radiation.polarisn_ratio _diffrn_radiation.probe _diffrn_radiation.type _diffrn_radiation.xray_symbol _diffrn_radiation.wavelength_id _diffrn_radiation.pdbx_monochromatic_or_laue_m_l _diffrn_radiation.pdbx_wavelength_list _diffrn_radiation.pdbx_wavelength _diffrn_radiation.pdbx_diffrn_protocol _diffrn_radiation.pdbx_analyzer _diffrn_radiation.pdbx_scattering_type ? 1 ? ? ? ? ? ? ? ? 1 M ? ? 'SINGLE WAVELENGTH' ? x-ray ? 2 ? ? ? ? ? ? ? ? 2 M ? ? 'SINGLE WAVELENGTH' ? neutron # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.8266 1.0 2 2.673 1.0 # loop_ _diffrn_source.current _diffrn_source.details _diffrn_source.diffrn_id _diffrn_source.power _diffrn_source.size _diffrn_source.source _diffrn_source.target _diffrn_source.type _diffrn_source.voltage _diffrn_source.take-off_angle _diffrn_source.pdbx_wavelength_list _diffrn_source.pdbx_wavelength _diffrn_source.pdbx_synchrotron_beamline _diffrn_source.pdbx_synchrotron_site ? ? 1 ? ? SYNCHROTRON ? 'PETRA III, EMBL c/o DESY BEAMLINE P14 (MX2)' ? ? 0.8266 ? 'P14 (MX2)' 'PETRA III, EMBL c/o DESY' ? ? 2 ? ? 'NUCLEAR REACTOR' ? 'FRM II BEAMLINE BIODIFF' ? ? 2.673 ? BIODIFF 'FRM II' # loop_ _reflns.B_iso_Wilson_estimate _reflns.entry_id _reflns.data_reduction_details _reflns.data_reduction_method _reflns.d_resolution_high _reflns.d_resolution_low _reflns.details _reflns.limit_h_max _reflns.limit_h_min _reflns.limit_k_max _reflns.limit_k_min _reflns.limit_l_max _reflns.limit_l_min _reflns.number_all _reflns.number_obs _reflns.observed_criterion _reflns.observed_criterion_F_max _reflns.observed_criterion_F_min _reflns.observed_criterion_I_max _reflns.observed_criterion_I_min _reflns.observed_criterion_sigma_F _reflns.observed_criterion_sigma_I _reflns.percent_possible_obs _reflns.R_free_details _reflns.Rmerge_F_all _reflns.Rmerge_F_obs _reflns.Friedel_coverage _reflns.number_gt _reflns.threshold_expression _reflns.pdbx_redundancy _reflns.pdbx_Rmerge_I_obs _reflns.pdbx_Rmerge_I_all _reflns.pdbx_Rsym_value _reflns.pdbx_netI_over_av_sigmaI _reflns.pdbx_netI_over_sigmaI _reflns.pdbx_res_netI_over_av_sigmaI_2 _reflns.pdbx_res_netI_over_sigmaI_2 _reflns.pdbx_chi_squared _reflns.pdbx_scaling_rejects _reflns.pdbx_d_res_high_opt _reflns.pdbx_d_res_low_opt _reflns.pdbx_d_res_opt_method _reflns.phase_calculation_details _reflns.pdbx_Rrim_I_all _reflns.pdbx_Rpim_I_all _reflns.pdbx_d_opt _reflns.pdbx_number_measured_all _reflns.pdbx_diffrn_id _reflns.pdbx_ordinal _reflns.pdbx_CC_half _reflns.pdbx_R_split ? 5MOR ? ? 0.98 44.215 ? ? ? ? ? ? ? ? 124579 ? ? ? ? ? ? ? 99.6 ? ? ? ? ? ? 6.403 0.052 ? ? ? 19.99 ? ? ? ? ? ? ? ? ? ? ? ? 1 1 ? ? ? 5MOR ? ? 1.49 50 ? ? ? ? ? ? ? ? 34022 ? ? ? ? ? ? ? 93.7 ? ? ? ? ? ? 2.8 0.129 ? ? ? 5.866 ? ? ? ? ? ? ? ? ? ? ? ? 2 2 ? ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 0.98 1.04 ? 4.18 ? ? ? ? ? 98.7 ? ? ? ? 0.562 ? ? ? ? ? ? ? ? 6.184 ? ? ? ? ? ? ? 1 1 ? ? 1.49 1.52 ? 1.954 ? ? ? ? ? 90.4 ? ? ? ? 0.445 ? ? ? ? ? ? ? ? 2.1 ? ? ? ? ? ? ? 2 2 ? ? # loop_ _refine.aniso_B[1][1] _refine.aniso_B[1][2] _refine.aniso_B[1][3] _refine.aniso_B[2][2] _refine.aniso_B[2][3] _refine.aniso_B[3][3] _refine.B_iso_max _refine.B_iso_mean _refine.B_iso_min _refine.correlation_coeff_Fo_to_Fc _refine.correlation_coeff_Fo_to_Fc_free _refine.details _refine.diff_density_max _refine.diff_density_max_esd _refine.diff_density_min _refine.diff_density_min_esd _refine.diff_density_rms _refine.diff_density_rms_esd _refine.entry_id _refine.pdbx_refine_id _refine.ls_abs_structure_details _refine.ls_abs_structure_Flack _refine.ls_abs_structure_Flack_esd _refine.ls_abs_structure_Rogers _refine.ls_abs_structure_Rogers_esd _refine.ls_d_res_high _refine.ls_d_res_low _refine.ls_extinction_coef _refine.ls_extinction_coef_esd _refine.ls_extinction_expression _refine.ls_extinction_method _refine.ls_goodness_of_fit_all _refine.ls_goodness_of_fit_all_esd _refine.ls_goodness_of_fit_obs _refine.ls_goodness_of_fit_obs_esd _refine.ls_hydrogen_treatment _refine.ls_matrix_type _refine.ls_number_constraints _refine.ls_number_parameters _refine.ls_number_reflns_all _refine.ls_number_reflns_obs _refine.ls_number_reflns_R_free _refine.ls_number_reflns_R_work _refine.ls_number_restraints _refine.ls_percent_reflns_obs _refine.ls_percent_reflns_R_free _refine.ls_R_factor_all _refine.ls_R_factor_obs _refine.ls_R_factor_R_free _refine.ls_R_factor_R_free_error _refine.ls_R_factor_R_free_error_details _refine.ls_R_factor_R_work _refine.ls_R_Fsqd_factor_obs _refine.ls_R_I_factor_obs _refine.ls_redundancy_reflns_all _refine.ls_redundancy_reflns_obs _refine.ls_restrained_S_all _refine.ls_restrained_S_obs _refine.ls_shift_over_esd_max _refine.ls_shift_over_esd_mean _refine.ls_structure_factor_coef _refine.ls_weighting_details _refine.ls_weighting_scheme _refine.ls_wR_factor_all _refine.ls_wR_factor_obs _refine.ls_wR_factor_R_free _refine.ls_wR_factor_R_work _refine.occupancy_max _refine.occupancy_min _refine.solvent_model_details _refine.solvent_model_param_bsol _refine.solvent_model_param_ksol _refine.ls_R_factor_gt _refine.ls_goodness_of_fit_gt _refine.ls_goodness_of_fit_ref _refine.ls_shift_over_su_max _refine.ls_shift_over_su_max_lt _refine.ls_shift_over_su_mean _refine.ls_shift_over_su_mean_lt _refine.pdbx_ls_sigma_I _refine.pdbx_ls_sigma_F _refine.pdbx_ls_sigma_Fsqd _refine.pdbx_data_cutoff_high_absF _refine.pdbx_data_cutoff_high_rms_absF _refine.pdbx_data_cutoff_low_absF _refine.pdbx_isotropic_thermal_model _refine.pdbx_ls_cross_valid_method _refine.pdbx_method_to_determine_struct _refine.pdbx_starting_model _refine.pdbx_stereochemistry_target_values _refine.pdbx_R_Free_selection_details _refine.pdbx_stereochem_target_val_spec_case _refine.pdbx_overall_ESU_R _refine.pdbx_overall_ESU_R_Free _refine.pdbx_solvent_vdw_probe_radii _refine.pdbx_solvent_ion_probe_radii _refine.pdbx_solvent_shrinkage_radii _refine.pdbx_real_space_R _refine.pdbx_density_correlation _refine.pdbx_pd_number_of_powder_patterns _refine.pdbx_pd_number_of_points _refine.pdbx_pd_meas_number_of_points _refine.pdbx_pd_proc_ls_prof_R_factor _refine.pdbx_pd_proc_ls_prof_wR_factor _refine.pdbx_pd_Marquardt_correlation_coeff _refine.pdbx_pd_Fsqrd_R_factor _refine.pdbx_pd_ls_matrix_band_width _refine.pdbx_overall_phase_error _refine.pdbx_overall_SU_R_free_Cruickshank_DPI _refine.pdbx_overall_SU_R_free_Blow_DPI _refine.pdbx_overall_SU_R_Blow_DPI _refine.pdbx_TLS_residual_ADP_flag _refine.pdbx_diffrn_id _refine.overall_SU_B _refine.overall_SU_ML _refine.overall_SU_R_Cruickshank_DPI _refine.overall_SU_R_free _refine.overall_FOM_free_R_set _refine.overall_FOM_work_R_set _refine.pdbx_average_fsc_overall _refine.pdbx_average_fsc_work _refine.pdbx_average_fsc_free ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 5MOR 'X-RAY DIFFRACTION' ? ? ? ? ? 0.980 17.437 ? ? ? ? ? ? ? ? ? ? ? ? ? 124484 6242 ? ? 99.61 5.01 ? 0.0999 0.1077 ? ? 0.0995 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1.36 ? ? ? ? ? THROUGHOUT 'MOLECULAR REPLACEMENT' 4I8H ? 'Random selection' ? ? ? 1.11 ? 0.90 ? ? ? ? ? ? ? ? ? ? 7.89 ? ? ? ? 1 ? 0.06 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 5MOR 'NEUTRON DIFFRACTION' ? ? ? ? ? 1.49 19.667 ? ? ? ? ? ? ? ? ? ? ? ? ? 34004 1713 ? ? 93.67 5.04 ? 0.1968 0.2074 ? ? 0.1962 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? THROUGHOUT 'MOLECULAR REPLACEMENT' 4I8H ? 'Random selection' ? ? ? 1.11 ? 0.90 ? ? ? ? ? ? ? ? ? ? 7.89 ? ? ? ? 2 ? 0.06 ? ? ? ? ? ? ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1613 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 24 _refine_hist.number_atoms_solvent 146 _refine_hist.number_atoms_total 1783 _refine_hist.d_res_high 0.980 _refine_hist.d_res_low 17.437 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? 3746 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.261 ? 6426 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 14.535 ? 975 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.098 ? 279 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 ? 794 ? f_plane_restr ? ? 'NEUTRON DIFFRACTION' ? 0.006 ? 3746 ? f_bond_d ? ? 'NEUTRON DIFFRACTION' ? 1.261 ? 6426 ? f_angle_d ? ? 'NEUTRON DIFFRACTION' ? 14.535 ? 975 ? f_dihedral_angle_d ? ? 'NEUTRON DIFFRACTION' ? 0.098 ? 279 ? f_chiral_restr ? ? 'NEUTRON DIFFRACTION' ? 0.008 ? 794 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 0.9800 0.9912 . . 199 3718 95.00 . . . 0.2096 . 0.2045 . . . . . . . . . . 'X-RAY DIFFRACTION' 0.9912 1.0028 . . 225 3860 100.00 . . . 0.1993 . 0.1914 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.0028 1.0151 . . 202 3917 100.00 . . . 0.1869 . 0.1746 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.0151 1.0279 . . 216 3913 100.00 . . . 0.1453 . 0.1544 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.0279 1.0414 . . 211 3880 100.00 . . . 0.1601 . 0.1356 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.0414 1.0557 . . 226 3902 100.00 . . . 0.1268 . 0.1233 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.0557 1.0708 . . 198 3903 100.00 . . . 0.1197 . 0.1114 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.0708 1.0867 . . 198 3889 100.00 . . . 0.1071 . 0.1034 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.0867 1.1037 . . 197 3947 100.00 . . . 0.0962 . 0.0921 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.1037 1.1218 . . 197 3903 100.00 . . . 0.1092 . 0.0831 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.1218 1.1412 . . 218 3932 100.00 . . . 0.1053 . 0.0773 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.1412 1.1619 . . 225 3888 100.00 . . . 0.0848 . 0.0730 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.1619 1.1842 . . 188 3908 100.00 . . . 0.0835 . 0.0742 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.1842 1.2084 . . 215 3946 100.00 . . . 0.0930 . 0.0714 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.2084 1.2347 . . 186 3922 100.00 . . . 0.0877 . 0.0726 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.2347 1.2634 . . 211 3945 100.00 . . . 0.0867 . 0.0699 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.2634 1.2950 . . 188 3949 100.00 . . . 0.0864 . 0.0717 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.2950 1.3300 . . 206 3932 100.00 . . . 0.0788 . 0.0691 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.3300 1.3691 . . 203 3935 100.00 . . . 0.0839 . 0.0711 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.3691 1.4133 . . 195 3968 100.00 . . . 0.0802 . 0.0709 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4133 1.4638 . . 217 3935 100.00 . . . 0.0785 . 0.0695 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4638 1.5223 . . 236 3944 100.00 . . . 0.0773 . 0.0670 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5223 1.5916 . . 218 3931 100.00 . . . 0.0832 . 0.0703 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5916 1.6754 . . 216 3981 100.00 . . . 0.0798 . 0.0710 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6754 1.7803 . . 191 4011 100.00 . . . 0.0781 . 0.0760 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7803 1.9176 . . 233 3930 100.00 . . . 0.0824 . 0.0821 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9176 2.1103 . . 223 4018 100.00 . . . 0.0942 . 0.0852 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1103 2.4150 . . 208 4021 100.00 . . . 0.1103 . 0.0962 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4150 3.0400 . . 190 4083 100.00 . . . 0.1305 . 0.1249 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0400 17.4397 . . 206 4231 100.00 . . . 0.1386 . 0.1340 . . . . . . . . . . 'NEUTRON DIFFRACTION' 1.4886 1.5323 . . 155 2503 89.00 . . . 0.2854 . 0.2971 . . . . . . . . . . 'NEUTRON DIFFRACTION' 1.5323 1.5818 . . 143 2667 95.00 . . . 0.2750 . 0.2630 . . . . . . . . . . 'NEUTRON DIFFRACTION' 1.5818 1.6383 . . 144 2739 96.00 . . . 0.2373 . 0.2481 . . . . . . . . . . 'NEUTRON DIFFRACTION' 1.6383 1.7038 . . 150 2759 97.00 . . . 0.2469 . 0.2304 . . . . . . . . . . 'NEUTRON DIFFRACTION' 1.7038 1.7813 . . 137 2797 98.00 . . . 0.2560 . 0.2205 . . . . . . . . . . 'NEUTRON DIFFRACTION' 1.7813 1.8752 . . 153 2760 97.00 . . . 0.2082 . 0.2045 . . . . . . . . . . 'NEUTRON DIFFRACTION' 1.8752 1.9926 . . 163 2757 97.00 . . . 0.2135 . 0.1877 . . . . . . . . . . 'NEUTRON DIFFRACTION' 1.9926 2.1462 . . 142 2725 95.00 . . . 0.1895 . 0.1804 . . . . . . . . . . 'NEUTRON DIFFRACTION' 2.1462 2.3619 . . 127 2359 82.00 . . . 0.2024 . 0.1885 . . . . . . . . . . 'NEUTRON DIFFRACTION' 2.3619 2.7029 . . 133 2564 89.00 . . . 0.1829 . 0.1655 . . . . . . . . . . 'NEUTRON DIFFRACTION' 2.7029 3.4025 . . 125 2756 93.00 . . . 0.1751 . 0.1646 . . . . . . . . . . 'NEUTRON DIFFRACTION' 3.4025 19.6689 . . 141 2905 95.00 . . . 0.1594 . 0.1584 . . . . . . . . . . # _struct.entry_id 5MOR _struct.title 'Joint X-ray/neutron structure of cationic trypsin in complex with benzylamine' _struct.pdbx_descriptor 'Cationic trypsin (E.C.3.4.21.4)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5MOR _struct_keywords.text 'hydrogen bonding, protonation, protein-ligand interaction, hydrolase' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 4 ? G N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 38 ? TYR A 42 ? ALA A 55 TYR A 59 5 ? 5 HELX_P HELX_P2 AA2 SER A 144 ? TYR A 152 ? SER A 164 TYR A 172 1 ? 9 HELX_P HELX_P3 AA3 TYR A 212 ? ASN A 223 ? TYR A 234 ASN A 245 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 7 SG ? ? ? 1_555 A CYS 137 SG ? ? A CYS 22 A CYS 157 1_555 ? ? ? ? ? ? ? 2.040 ? disulf2 disulf ? ? A CYS 25 SG ? ? ? 1_555 A CYS 41 SG ? ? A CYS 42 A CYS 58 1_555 ? ? ? ? ? ? ? 2.033 ? disulf3 disulf ? ? A CYS 109 SG ? ? ? 1_555 A CYS 210 SG ? ? A CYS 128 A CYS 232 1_555 ? ? ? ? ? ? ? 2.034 ? disulf4 disulf ? ? A CYS 116 SG ? ? ? 1_555 A CYS 183 SG ? ? A CYS 136 A CYS 201 1_555 ? ? ? ? ? ? ? 2.019 ? disulf5 disulf ? ? A CYS 148 SG ? ? ? 1_555 A CYS 162 SG ? ? A CYS 168 A CYS 182 1_555 ? ? ? ? ? ? ? 2.023 ? disulf6 disulf ? ? A CYS 173 SG ? ? ? 1_555 A CYS 197 SG ? ? A CYS 191 A CYS 220 1_555 ? ? ? ? ? ? ? 2.033 ? metalc1 metalc ? ? A GLU 52 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 70 A CA 301 1_555 ? ? ? ? ? ? ? 2.272 ? metalc2 metalc ? ? A ASN 54 O ? ? ? 1_555 B CA . CA ? ? A ASN 72 A CA 301 1_555 ? ? ? ? ? ? ? 2.331 ? metalc3 metalc ? ? A VAL 57 O ? ? ? 1_555 B CA . CA ? ? A VAL 75 A CA 301 1_555 ? ? ? ? ? ? ? 2.277 ? metalc4 metalc ? ? A GLU 62 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 80 A CA 301 1_555 ? ? ? ? ? ? ? 2.336 ? metalc5 metalc ? ? B CA . CA ? ? ? 1_555 G DOD . O ? ? A CA 301 A DOD 403 1_555 ? ? ? ? ? ? ? 2.375 ? metalc6 metalc ? ? B CA . CA ? ? ? 1_555 G DOD . O ? ? A CA 301 A DOD 449 1_555 ? ? ? ? ? ? ? 2.347 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 5 ? THR A 6 ? TYR A 20 THR A 21 AA1 2 LYS A 136 ? PRO A 141 ? LYS A 156 PRO A 161 AA1 3 GLN A 115 ? GLY A 120 ? GLN A 135 GLY A 140 AA1 4 PRO A 180 ? CYS A 183 ? PRO A 198 CYS A 201 AA1 5 LYS A 186 ? TRP A 193 ? LYS A 204 TRP A 215 AA1 6 GLY A 204 ? LYS A 208 ? GLY A 226 LYS A 230 AA1 7 MET A 160 ? ALA A 163 ? MET A 180 ALA A 183 AA2 1 GLN A 15 ? ASN A 19 ? GLN A 30 ASN A 34 AA2 2 HIS A 23 ? ASN A 31 ? HIS A 40 ASN A 48 AA2 3 TRP A 34 ? SER A 37 ? TRP A 51 SER A 54 AA2 4 MET A 86 ? LEU A 90 ? MET A 104 LEU A 108 AA2 5 GLN A 63 ? VAL A 72 ? GLN A 81 VAL A 90 AA2 6 GLN A 47 ? LEU A 50 ? GLN A 64 LEU A 67 AA2 7 GLN A 15 ? ASN A 19 ? GLN A 30 ASN A 34 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TYR A 5 ? N TYR A 20 O CYS A 137 ? O CYS A 157 AA1 2 3 O LEU A 138 ? O LEU A 158 N ILE A 118 ? N ILE A 138 AA1 3 4 N LEU A 117 ? N LEU A 137 O VAL A 182 ? O VAL A 200 AA1 4 5 N CYS A 183 ? N CYS A 201 O LYS A 186 ? O LYS A 204 AA1 5 6 N TRP A 193 ? N TRP A 215 O VAL A 205 ? O VAL A 227 AA1 6 7 O TYR A 206 ? O TYR A 228 N PHE A 161 ? N PHE A 181 AA2 1 2 N LEU A 18 ? N LEU A 33 O CYS A 25 ? O CYS A 42 AA2 2 3 N SER A 28 ? N SER A 45 O VAL A 36 ? O VAL A 53 AA2 3 4 N VAL A 35 ? N VAL A 52 O ILE A 88 ? O ILE A 106 AA2 4 5 O LEU A 87 ? O LEU A 105 N ILE A 71 ? N ILE A 89 AA2 5 6 O GLN A 63 ? O GLN A 81 N LEU A 50 ? N LEU A 67 AA2 6 7 O GLN A 47 ? O GLN A 64 N ASN A 19 ? N ASN A 34 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 301 ? 6 'binding site for residue CA A 301' AC2 Software A UFZ 302 ? 8 'binding site for residue UFZ A 302' AC3 Software A SO4 303 ? 4 'binding site for residue SO4 A 303' AC4 Software A SO4 304 ? 6 'binding site for residue SO4 A 304' AC5 Software A SO4 305 ? 2 'binding site for residue SO4 A 305' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 GLU A 52 ? GLU A 70 . ? 1_555 ? 2 AC1 6 ASN A 54 ? ASN A 72 . ? 1_555 ? 3 AC1 6 VAL A 57 ? VAL A 75 . ? 1_555 ? 4 AC1 6 GLU A 62 ? GLU A 80 . ? 1_555 ? 5 AC1 6 DOD G . ? DOD A 403 . ? 1_555 ? 6 AC1 6 DOD G . ? DOD A 449 . ? 1_555 ? 7 AC2 8 ASP A 171 ? ASP A 189 . ? 1_555 ? 8 AC2 8 SER A 172 ? SER A 190 . ? 1_555 ? 9 AC2 8 CYS A 173 ? CYS A 191 . ? 1_555 ? 10 AC2 8 SER A 177 ? SER A 195 . ? 1_555 ? 11 AC2 8 TRP A 193 ? TRP A 215 . ? 1_555 ? 12 AC2 8 GLY A 194 ? GLY A 216 . ? 1_555 ? 13 AC2 8 GLY A 196 ? GLY A 219 . ? 1_555 ? 14 AC2 8 DOD G . ? DOD A 502 . ? 1_555 ? 15 AC3 4 HIS A 40 ? HIS A 57 . ? 1_555 ? 16 AC3 4 GLN A 174 ? GLN A 192 . ? 1_555 ? 17 AC3 4 GLY A 175 ? GLY A 193 . ? 1_555 ? 18 AC3 4 SER A 177 ? SER A 195 . ? 1_555 ? 19 AC4 6 PRO A 106 ? PRO A 124 . ? 1_555 ? 20 AC4 6 THR A 107 ? THR A 125 . ? 1_555 ? 21 AC4 6 SER A 108 ? SER A 127 . ? 1_555 ? 22 AC4 6 LYS A 186 ? LYS A 204 . ? 1_555 ? 23 AC4 6 DOD G . ? DOD A 441 . ? 1_555 ? 24 AC4 6 DOD G . ? DOD A 455 . ? 1_555 ? 25 AC5 2 LYS A 89 ? LYS A 107 . ? 1_555 ? 26 AC5 2 DOD G . ? DOD A 408 . ? 1_555 ? # _atom_sites.entry_id 5MOR _atom_sites.fract_transf_matrix[1][1] 0.018235 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017143 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014753 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA D H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 16 16 ILE ILE A . n A 1 2 VAL 2 17 17 VAL VAL A . n A 1 3 GLY 3 18 18 GLY GLY A . n A 1 4 GLY 4 19 19 GLY GLY A . n A 1 5 TYR 5 20 20 TYR TYR A . n A 1 6 THR 6 21 21 THR THR A . n A 1 7 CYS 7 22 22 CYS CYS A . n A 1 8 GLY 8 23 23 GLY GLY A . n A 1 9 ALA 9 24 24 ALA ALA A . n A 1 10 ASN 10 25 25 ASN ASN A . n A 1 11 THR 11 26 26 THR THR A . n A 1 12 VAL 12 27 27 VAL VAL A . n A 1 13 PRO 13 28 28 PRO PRO A . n A 1 14 TYR 14 29 29 TYR TYR A . n A 1 15 GLN 15 30 30 GLN GLN A . n A 1 16 VAL 16 31 31 VAL VAL A . n A 1 17 SER 17 32 32 SER SER A . n A 1 18 LEU 18 33 33 LEU LEU A . n A 1 19 ASN 19 34 34 ASN ASN A . n A 1 20 SER 20 37 37 SER SER A . n A 1 21 GLY 21 38 38 GLY GLY A . n A 1 22 TYR 22 39 39 TYR TYR A . n A 1 23 HIS 23 40 40 HIS HIS A . n A 1 24 PHE 24 41 41 PHE PHE A . n A 1 25 CYS 25 42 42 CYS CYS A . n A 1 26 GLY 26 43 43 GLY GLY A . n A 1 27 GLY 27 44 44 GLY GLY A . n A 1 28 SER 28 45 45 SER SER A . n A 1 29 LEU 29 46 46 LEU LEU A . n A 1 30 ILE 30 47 47 ILE ILE A . n A 1 31 ASN 31 48 48 ASN ASN A . n A 1 32 SER 32 49 49 SER SER A . n A 1 33 GLN 33 50 50 GLN GLN A . n A 1 34 TRP 34 51 51 TRP TRP A . n A 1 35 VAL 35 52 52 VAL VAL A . n A 1 36 VAL 36 53 53 VAL VAL A . n A 1 37 SER 37 54 54 SER SER A . n A 1 38 ALA 38 55 55 ALA ALA A . n A 1 39 ALA 39 56 56 ALA ALA A . n A 1 40 HIS 40 57 57 HIS HIS A . n A 1 41 CYS 41 58 58 CYS CYS A . n A 1 42 TYR 42 59 59 TYR TYR A . n A 1 43 LYS 43 60 60 LYS LYS A . n A 1 44 SER 44 61 61 SER SER A . n A 1 45 GLY 45 62 62 GLY GLY A . n A 1 46 ILE 46 63 63 ILE ILE A . n A 1 47 GLN 47 64 64 GLN GLN A . n A 1 48 VAL 48 65 65 VAL VAL A . n A 1 49 ARG 49 66 66 ARG ARG A . n A 1 50 LEU 50 67 67 LEU LEU A . n A 1 51 GLY 51 69 69 GLY GLY A . n A 1 52 GLU 52 70 70 GLU GLU A . n A 1 53 ASP 53 71 71 ASP ASP A . n A 1 54 ASN 54 72 72 ASN ASN A . n A 1 55 ILE 55 73 73 ILE ILE A . n A 1 56 ASN 56 74 74 ASN ASN A . n A 1 57 VAL 57 75 75 VAL VAL A . n A 1 58 VAL 58 76 76 VAL VAL A . n A 1 59 GLU 59 77 77 GLU GLU A . n A 1 60 GLY 60 78 78 GLY GLY A . n A 1 61 ASN 61 79 79 ASN ASN A . n A 1 62 GLU 62 80 80 GLU GLU A . n A 1 63 GLN 63 81 81 GLN GLN A . n A 1 64 PHE 64 82 82 PHE PHE A . n A 1 65 ILE 65 83 83 ILE ILE A . n A 1 66 SER 66 84 84 SER SER A . n A 1 67 ALA 67 85 85 ALA ALA A . n A 1 68 SER 68 86 86 SER SER A . n A 1 69 LYS 69 87 87 LYS LYS A . n A 1 70 SER 70 88 88 SER SER A . n A 1 71 ILE 71 89 89 ILE ILE A . n A 1 72 VAL 72 90 90 VAL VAL A . n A 1 73 HIS 73 91 91 HIS HIS A . n A 1 74 PRO 74 92 92 PRO PRO A . n A 1 75 SER 75 93 93 SER SER A . n A 1 76 TYR 76 94 94 TYR TYR A . n A 1 77 ASN 77 95 95 ASN ASN A . n A 1 78 SER 78 96 96 SER SER A . n A 1 79 ASN 79 97 97 ASN ASN A . n A 1 80 THR 80 98 98 THR THR A . n A 1 81 LEU 81 99 99 LEU LEU A . n A 1 82 ASN 82 100 100 ASN ASN A . n A 1 83 ASN 83 101 101 ASN ASN A . n A 1 84 ASP 84 102 102 ASP ASP A . n A 1 85 ILE 85 103 103 ILE ILE A . n A 1 86 MET 86 104 104 MET MET A . n A 1 87 LEU 87 105 105 LEU LEU A . n A 1 88 ILE 88 106 106 ILE ILE A . n A 1 89 LYS 89 107 107 LYS LYS A . n A 1 90 LEU 90 108 108 LEU LEU A . n A 1 91 LYS 91 109 109 LYS LYS A . n A 1 92 SER 92 110 110 SER SER A . n A 1 93 ALA 93 111 111 ALA ALA A . n A 1 94 ALA 94 112 112 ALA ALA A . n A 1 95 SER 95 113 113 SER SER A . n A 1 96 LEU 96 114 114 LEU LEU A . n A 1 97 ASN 97 115 115 ASN ASN A . n A 1 98 SER 98 116 116 SER SER A . n A 1 99 ARG 99 117 117 ARG ARG A . n A 1 100 VAL 100 118 118 VAL VAL A . n A 1 101 ALA 101 119 119 ALA ALA A . n A 1 102 SER 102 120 120 SER SER A . n A 1 103 ILE 103 121 121 ILE ILE A . n A 1 104 SER 104 122 122 SER SER A . n A 1 105 LEU 105 123 123 LEU LEU A . n A 1 106 PRO 106 124 124 PRO PRO A . n A 1 107 THR 107 125 125 THR THR A . n A 1 108 SER 108 127 127 SER SER A . n A 1 109 CYS 109 128 128 CYS CYS A . n A 1 110 ALA 110 129 129 ALA ALA A . n A 1 111 SER 111 130 130 SER SER A . n A 1 112 ALA 112 132 132 ALA ALA A . n A 1 113 GLY 113 133 133 GLY GLY A . n A 1 114 THR 114 134 134 THR THR A . n A 1 115 GLN 115 135 135 GLN GLN A . n A 1 116 CYS 116 136 136 CYS CYS A . n A 1 117 LEU 117 137 137 LEU LEU A . n A 1 118 ILE 118 138 138 ILE ILE A . n A 1 119 SER 119 139 139 SER SER A . n A 1 120 GLY 120 140 140 GLY GLY A . n A 1 121 TRP 121 141 141 TRP TRP A . n A 1 122 GLY 122 142 142 GLY GLY A . n A 1 123 ASN 123 143 143 ASN ASN A . n A 1 124 THR 124 144 144 THR THR A . n A 1 125 LYS 125 145 145 LYS LYS A . n A 1 126 SER 126 146 146 SER SER A . n A 1 127 SER 127 147 147 SER SER A . n A 1 128 GLY 128 148 148 GLY GLY A . n A 1 129 THR 129 149 149 THR THR A . n A 1 130 SER 130 150 150 SER SER A . n A 1 131 TYR 131 151 151 TYR TYR A . n A 1 132 PRO 132 152 152 PRO PRO A . n A 1 133 ASP 133 153 153 ASP ASP A . n A 1 134 VAL 134 154 154 VAL VAL A . n A 1 135 LEU 135 155 155 LEU LEU A . n A 1 136 LYS 136 156 156 LYS LYS A . n A 1 137 CYS 137 157 157 CYS CYS A . n A 1 138 LEU 138 158 158 LEU LEU A . n A 1 139 LYS 139 159 159 LYS LYS A . n A 1 140 ALA 140 160 160 ALA ALA A . n A 1 141 PRO 141 161 161 PRO PRO A . n A 1 142 ILE 142 162 162 ILE ILE A . n A 1 143 LEU 143 163 163 LEU LEU A . n A 1 144 SER 144 164 164 SER SER A . n A 1 145 ASP 145 165 165 ASP ASP A . n A 1 146 SER 146 166 166 SER SER A . n A 1 147 SER 147 167 167 SER SER A . n A 1 148 CYS 148 168 168 CYS CYS A . n A 1 149 LYS 149 169 169 LYS LYS A . n A 1 150 SER 150 170 170 SER SER A . n A 1 151 ALA 151 171 171 ALA ALA A . n A 1 152 TYR 152 172 172 TYR TYR A . n A 1 153 PRO 153 173 173 PRO PRO A . n A 1 154 GLY 154 174 174 GLY GLY A . n A 1 155 GLN 155 175 175 GLN GLN A . n A 1 156 ILE 156 176 176 ILE ILE A . n A 1 157 THR 157 177 177 THR THR A . n A 1 158 SER 158 178 178 SER SER A . n A 1 159 ASN 159 179 179 ASN ASN A . n A 1 160 MET 160 180 180 MET MET A . n A 1 161 PHE 161 181 181 PHE PHE A . n A 1 162 CYS 162 182 182 CYS CYS A . n A 1 163 ALA 163 183 183 ALA ALA A . n A 1 164 GLY 164 184 184 GLY GLY A . n A 1 165 TYR 165 184 184 TYR TYR A A n A 1 166 LEU 166 185 185 LEU LEU A . n A 1 167 GLU 167 186 186 GLU GLU A . n A 1 168 GLY 168 187 187 GLY GLY A . n A 1 169 GLY 169 188 188 GLY GLY A . n A 1 170 LYS 170 188 188 LYS LYS A A n A 1 171 ASP 171 189 189 ASP ASP A . n A 1 172 SER 172 190 190 SER SER A . n A 1 173 CYS 173 191 191 CYS CYS A . n A 1 174 GLN 174 192 192 GLN GLN A . n A 1 175 GLY 175 193 193 GLY GLY A . n A 1 176 ASP 176 194 194 ASP ASP A . n A 1 177 SER 177 195 195 SER SER A . n A 1 178 GLY 178 196 196 GLY GLY A . n A 1 179 GLY 179 197 197 GLY GLY A . n A 1 180 PRO 180 198 198 PRO PRO A . n A 1 181 VAL 181 199 199 VAL VAL A . n A 1 182 VAL 182 200 200 VAL VAL A . n A 1 183 CYS 183 201 201 CYS CYS A . n A 1 184 SER 184 202 202 SER SER A . n A 1 185 GLY 185 203 203 GLY GLY A . n A 1 186 LYS 186 204 204 LYS LYS A . n A 1 187 LEU 187 209 209 LEU LEU A . n A 1 188 GLN 188 210 210 GLN GLN A . n A 1 189 GLY 189 211 211 GLY GLY A . n A 1 190 ILE 190 212 212 ILE ILE A . n A 1 191 VAL 191 213 213 VAL VAL A . n A 1 192 SER 192 214 214 SER SER A . n A 1 193 TRP 193 215 215 TRP TRP A . n A 1 194 GLY 194 216 216 GLY GLY A . n A 1 195 SER 195 217 217 SER SER A . n A 1 196 GLY 196 219 219 GLY GLY A . n A 1 197 CYS 197 220 220 CYS CYS A . n A 1 198 ALA 198 221 221 ALA ALA A . n A 1 199 GLN 199 221 221 GLN GLN A A n A 1 200 LYS 200 222 222 LYS LYS A . n A 1 201 ASN 201 223 223 ASN ASN A . n A 1 202 LYS 202 224 224 LYS LYS A . n A 1 203 PRO 203 225 225 PRO PRO A . n A 1 204 GLY 204 226 226 GLY GLY A . n A 1 205 VAL 205 227 227 VAL VAL A . n A 1 206 TYR 206 228 228 TYR TYR A . n A 1 207 THR 207 229 229 THR THR A . n A 1 208 LYS 208 230 230 LYS LYS A . n A 1 209 VAL 209 231 231 VAL VAL A . n A 1 210 CYS 210 232 232 CYS CYS A . n A 1 211 ASN 211 233 233 ASN ASN A . n A 1 212 TYR 212 234 234 TYR TYR A . n A 1 213 VAL 213 235 235 VAL VAL A . n A 1 214 SER 214 236 236 SER SER A . n A 1 215 TRP 215 237 237 TRP TRP A . n A 1 216 ILE 216 238 238 ILE ILE A . n A 1 217 LYS 217 239 239 LYS LYS A . n A 1 218 GLN 218 240 240 GLN GLN A . n A 1 219 THR 219 241 241 THR THR A . n A 1 220 ILE 220 242 242 ILE ILE A . n A 1 221 ALA 221 243 243 ALA ALA A . n A 1 222 SER 222 244 244 SER SER A . n A 1 223 ASN 223 245 245 ASN ASN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 301 1 CA CA A . C 3 UFZ 1 302 1 UFZ XXX A . D 4 SO4 1 303 1 SO4 SO4 A . E 4 SO4 1 304 2 SO4 SO4 A . F 4 SO4 1 305 3 SO4 SO4 A . G 5 DOD 1 401 204 DOD DOD A . G 5 DOD 2 402 163 DOD DOD A . G 5 DOD 3 403 3 DOD DOD A . G 5 DOD 4 404 37 DOD DOD A . G 5 DOD 5 405 60 DOD DOD A . G 5 DOD 6 406 47 DOD DOD A . G 5 DOD 7 407 123 DOD DOD A . G 5 DOD 8 408 101 DOD DOD A . G 5 DOD 9 409 136 DOD DOD A . G 5 DOD 10 410 8 DOD DOD A . G 5 DOD 11 411 200 DOD DOD A . G 5 DOD 12 412 78 DOD DOD A . G 5 DOD 13 413 156 DOD DOD A . G 5 DOD 14 414 125 DOD DOD A . G 5 DOD 15 415 203 DOD DOD A . G 5 DOD 16 416 196 DOD DOD A . G 5 DOD 17 417 67 DOD DOD A . G 5 DOD 18 418 84 DOD DOD A . G 5 DOD 19 419 6 DOD DOD A . G 5 DOD 20 420 20 DOD DOD A . G 5 DOD 21 421 42 DOD DOD A . G 5 DOD 22 422 36 DOD DOD A . G 5 DOD 23 423 51 DOD DOD A . G 5 DOD 24 424 44 DOD DOD A . G 5 DOD 25 425 24 DOD DOD A . G 5 DOD 26 426 69 DOD DOD A . G 5 DOD 27 427 40 DOD DOD A . G 5 DOD 28 428 27 DOD DOD A . G 5 DOD 29 429 191 DOD DOD A . G 5 DOD 30 430 179 DOD DOD A . G 5 DOD 31 431 11 DOD DOD A . G 5 DOD 32 432 63 DOD DOD A . G 5 DOD 33 433 12 DOD DOD A . G 5 DOD 34 434 206 DOD DOD A . G 5 DOD 35 435 72 DOD DOD A . G 5 DOD 36 436 5 DOD DOD A . G 5 DOD 37 437 144 DOD DOD A . G 5 DOD 38 438 2 DOD DOD A . G 5 DOD 39 439 1 DOD DOD A . G 5 DOD 40 440 16 DOD DOD A . G 5 DOD 41 441 171 DOD DOD A . G 5 DOD 42 442 38 DOD DOD A . G 5 DOD 43 443 190 DOD DOD A . G 5 DOD 44 444 192 DOD DOD A . G 5 DOD 45 445 70 DOD DOD A . G 5 DOD 46 446 18 DOD DOD A . G 5 DOD 47 447 114 DOD DOD A . G 5 DOD 48 448 10 DOD DOD A . G 5 DOD 49 449 9 DOD DOD A . G 5 DOD 50 450 194 DOD DOD A . G 5 DOD 51 451 165 DOD DOD A . G 5 DOD 52 452 22 DOD DOD A . G 5 DOD 53 453 33 DOD DOD A . G 5 DOD 54 454 177 DOD DOD A . G 5 DOD 55 455 210 DOD DOD A . G 5 DOD 56 456 46 DOD DOD A . G 5 DOD 57 457 34 DOD DOD A . G 5 DOD 58 458 180 DOD DOD A . G 5 DOD 59 459 21 DOD DOD A . G 5 DOD 60 460 29 DOD DOD A . G 5 DOD 61 461 71 DOD DOD A . G 5 DOD 62 462 7 DOD DOD A . G 5 DOD 63 463 17 DOD DOD A . G 5 DOD 64 464 25 DOD DOD A . G 5 DOD 65 465 45 DOD DOD A . G 5 DOD 66 466 13 DOD DOD A . G 5 DOD 67 467 4 DOD DOD A . G 5 DOD 68 468 207 DOD DOD A . G 5 DOD 69 469 186 DOD DOD A . G 5 DOD 70 470 41 DOD DOD A . G 5 DOD 71 471 50 DOD DOD A . G 5 DOD 72 472 30 DOD DOD A . G 5 DOD 73 473 195 DOD DOD A . G 5 DOD 74 474 87 DOD DOD A . G 5 DOD 75 475 115 DOD DOD A . G 5 DOD 76 476 170 DOD DOD A . G 5 DOD 77 477 15 DOD DOD A . G 5 DOD 78 478 90 DOD DOD A . G 5 DOD 79 479 145 DOD DOD A . G 5 DOD 80 480 201 DOD DOD A . G 5 DOD 81 481 19 DOD DOD A . G 5 DOD 82 482 181 DOD DOD A . G 5 DOD 83 483 39 DOD DOD A . G 5 DOD 84 484 65 DOD DOD A . G 5 DOD 85 485 52 DOD DOD A . G 5 DOD 86 486 58 DOD DOD A . G 5 DOD 87 487 54 DOD DOD A . G 5 DOD 88 488 175 DOD DOD A . G 5 DOD 89 489 64 DOD DOD A . G 5 DOD 90 490 28 DOD DOD A . G 5 DOD 91 491 94 DOD DOD A . G 5 DOD 92 492 56 DOD DOD A . G 5 DOD 93 493 77 DOD DOD A . G 5 DOD 94 494 31 DOD DOD A . G 5 DOD 95 495 35 DOD DOD A . G 5 DOD 96 496 49 DOD DOD A . G 5 DOD 97 497 79 DOD DOD A . G 5 DOD 98 498 197 DOD DOD A . G 5 DOD 99 499 91 DOD DOD A . G 5 DOD 100 500 126 DOD DOD A . G 5 DOD 101 501 166 DOD DOD A . G 5 DOD 102 502 161 DOD DOD A . G 5 DOD 103 503 14 DOD DOD A . G 5 DOD 104 504 100 DOD DOD A . G 5 DOD 105 505 88 DOD DOD A . G 5 DOD 106 506 107 DOD DOD A . G 5 DOD 107 507 159 DOD DOD A . G 5 DOD 108 508 134 DOD DOD A . G 5 DOD 109 509 113 DOD DOD A . G 5 DOD 110 510 208 DOD DOD A . G 5 DOD 111 511 167 DOD DOD A . G 5 DOD 112 512 158 DOD DOD A . G 5 DOD 113 513 32 DOD DOD A . G 5 DOD 114 514 193 DOD DOD A . G 5 DOD 115 515 143 DOD DOD A . G 5 DOD 116 516 202 DOD DOD A . G 5 DOD 117 517 61 DOD DOD A . G 5 DOD 118 518 199 DOD DOD A . G 5 DOD 119 519 85 DOD DOD A . G 5 DOD 120 520 211 DOD DOD A . G 5 DOD 121 521 172 DOD DOD A . G 5 DOD 122 522 26 DOD DOD A . G 5 DOD 123 523 68 DOD DOD A . G 5 DOD 124 524 127 DOD DOD A . G 5 DOD 125 525 110 DOD DOD A . G 5 DOD 126 526 185 DOD DOD A . G 5 DOD 127 527 131 DOD DOD A . G 5 DOD 128 528 209 DOD DOD A . G 5 DOD 129 529 198 DOD DOD A . G 5 DOD 130 530 146 DOD DOD A . G 5 DOD 131 531 160 DOD DOD A . G 5 DOD 132 532 169 DOD DOD A . G 5 DOD 133 533 182 DOD DOD A . G 5 DOD 134 534 187 DOD DOD A . G 5 DOD 135 535 62 DOD DOD A . G 5 DOD 136 536 178 DOD DOD A . G 5 DOD 137 537 132 DOD DOD A . G 5 DOD 138 538 76 DOD DOD A . G 5 DOD 139 539 133 DOD DOD A . G 5 DOD 140 540 75 DOD DOD A . G 5 DOD 141 541 205 DOD DOD A . G 5 DOD 142 542 164 DOD DOD A . G 5 DOD 143 543 43 DOD DOD A . G 5 DOD 144 544 93 DOD DOD A . G 5 DOD 145 545 66 DOD DOD A . G 5 DOD 146 546 183 DOD DOD A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 17330 ? 1 MORE 4 ? 1 'SSA (A^2)' 9360 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 52 ? A GLU 70 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? A ASN 54 ? A ASN 72 ? 1_555 90.2 ? 2 OE1 ? A GLU 52 ? A GLU 70 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? A VAL 57 ? A VAL 75 ? 1_555 164.2 ? 3 O ? A ASN 54 ? A ASN 72 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? A VAL 57 ? A VAL 75 ? 1_555 81.4 ? 4 OE1 ? A GLU 52 ? A GLU 70 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 OE2 ? A GLU 62 ? A GLU 80 ? 1_555 102.4 ? 5 O ? A ASN 54 ? A ASN 72 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 OE2 ? A GLU 62 ? A GLU 80 ? 1_555 160.5 ? 6 O ? A VAL 57 ? A VAL 75 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 OE2 ? A GLU 62 ? A GLU 80 ? 1_555 89.4 ? 7 OE1 ? A GLU 52 ? A GLU 70 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? G DOD . ? A DOD 403 ? 1_555 87.2 ? 8 O ? A ASN 54 ? A ASN 72 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? G DOD . ? A DOD 403 ? 1_555 88.2 ? 9 O ? A VAL 57 ? A VAL 75 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? G DOD . ? A DOD 403 ? 1_555 105.9 ? 10 OE2 ? A GLU 62 ? A GLU 80 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? G DOD . ? A DOD 403 ? 1_555 77.7 ? 11 OE1 ? A GLU 52 ? A GLU 70 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? G DOD . ? A DOD 449 ? 1_555 79.7 ? 12 O ? A ASN 54 ? A ASN 72 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? G DOD . ? A DOD 449 ? 1_555 102.5 ? 13 O ? A VAL 57 ? A VAL 75 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? G DOD . ? A DOD 449 ? 1_555 89.0 ? 14 OE2 ? A GLU 62 ? A GLU 80 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? G DOD . ? A DOD 449 ? 1_555 94.5 ? 15 O ? G DOD . ? A DOD 403 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? G DOD . ? A DOD 449 ? 1_555 163.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-02-28 2 'Structure model' 1 1 2018-11-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Data collection' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category diffrn_source # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_diffrn_source.pdbx_synchrotron_beamline' 2 2 'Structure model' '_diffrn_source.pdbx_synchrotron_site' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(dev_2429)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 5 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 6 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 7 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 71 ? ? -121.05 -78.65 2 1 SER A 214 ? ? -120.13 -66.31 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id DOD _pdbx_distant_solvent_atoms.auth_seq_id 546 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.47 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 109 ? CD ? A LYS 91 CD 2 1 Y 1 A LYS 109 ? CE ? A LYS 91 CE 3 1 Y 1 A LYS 109 ? NZ ? A LYS 91 NZ 4 1 Y 1 A LYS 145 ? CE ? A LYS 125 CE 5 1 Y 1 A LYS 145 ? NZ ? A LYS 125 NZ 6 1 Y 1 A GLN 192 ? CD ? A GLN 174 CD 7 1 Y 1 A GLN 192 ? OE1 ? A GLN 174 OE1 8 1 Y 1 A GLN 192 ? NE2 ? A GLN 174 NE2 9 1 Y 1 A LYS 222 ? CD ? A LYS 200 CD 10 1 Y 1 A LYS 222 ? CE ? A LYS 200 CE 11 1 Y 1 A LYS 222 ? NZ ? A LYS 200 NZ 12 1 Y 1 A LYS 239 ? CE ? A LYS 217 CE 13 1 Y 1 A LYS 239 ? NZ ? A LYS 217 NZ 14 1 Y 1 A GLN 240 ? CD ? A GLN 218 CD 15 1 Y 1 A GLN 240 ? OE1 ? A GLN 218 OE1 16 1 Y 1 A GLN 240 ? NE2 ? A GLN 218 NE2 # _pdbx_audit_support.funding_organization 'European Research Council' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number 268145-DrugProfilBind _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 '(phenylmethyl)azanium' UFZ 4 'SULFATE ION' SO4 5 water DOD #