data_5MPN # _entry.id 5MPN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.315 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5MPN WWPDB D_1200002811 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5MPN _pdbx_database_status.recvd_initial_deposition_date 2016-12-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zhu, J.' 1 ? 'Caflisch, A.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'ACS Med Chem Lett' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1948-5875 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 9 _citation.language ? _citation.page_first 929 _citation.page_last 934 _citation.title 'Binding Motifs in the CBP Bromodomain: An Analysis of 20 Crystal Structures of Complexes with Small Molecules.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acsmedchemlett.8b00286 _citation.pdbx_database_id_PubMed 30258543 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhu, J.' 1 ? primary 'Dong, J.' 2 ? primary 'Batiste, L.' 3 ? primary 'Unzue, A.' 4 ? primary 'Dolbois, A.' 5 ? primary 'Pascanu, V.' 6 ? primary 'Sledz, P.' 7 ? primary 'Nevado, C.' 8 ? primary 'Caflisch, A.' 9 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5MPN _cell.details ? _cell.formula_units_Z ? _cell.length_a 44.584 _cell.length_a_esd ? _cell.length_b 44.723 _cell.length_b_esd ? _cell.length_c 60.757 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5MPN _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CREB-binding protein' 14223.349 1 2.3.1.48 ? 'bromodomain, UNP residues 1081-1197' ? 2 non-polymer syn '1-[4-ethoxy-3-[3-(2~{H}-1,2,3,4-tetrazol-5-yl)phenyl]phenyl]ethanone' 308.335 2 ? ? ? ? 3 non-polymer syn 1,2-ETHANEDIOL 62.068 2 ? ? ? ? 4 water nat water 18.015 204 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SMRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVW LMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG ; _entity_poly.pdbx_seq_one_letter_code_can ;SMRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVW LMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MET n 1 3 ARG n 1 4 LYS n 1 5 LYS n 1 6 ILE n 1 7 PHE n 1 8 LYS n 1 9 PRO n 1 10 GLU n 1 11 GLU n 1 12 LEU n 1 13 ARG n 1 14 GLN n 1 15 ALA n 1 16 LEU n 1 17 MET n 1 18 PRO n 1 19 THR n 1 20 LEU n 1 21 GLU n 1 22 ALA n 1 23 LEU n 1 24 TYR n 1 25 ARG n 1 26 GLN n 1 27 ASP n 1 28 PRO n 1 29 GLU n 1 30 SER n 1 31 LEU n 1 32 PRO n 1 33 PHE n 1 34 ARG n 1 35 GLN n 1 36 PRO n 1 37 VAL n 1 38 ASP n 1 39 PRO n 1 40 GLN n 1 41 LEU n 1 42 LEU n 1 43 GLY n 1 44 ILE n 1 45 PRO n 1 46 ASP n 1 47 TYR n 1 48 PHE n 1 49 ASP n 1 50 ILE n 1 51 VAL n 1 52 LYS n 1 53 ASN n 1 54 PRO n 1 55 MET n 1 56 ASP n 1 57 LEU n 1 58 SER n 1 59 THR n 1 60 ILE n 1 61 LYS n 1 62 ARG n 1 63 LYS n 1 64 LEU n 1 65 ASP n 1 66 THR n 1 67 GLY n 1 68 GLN n 1 69 TYR n 1 70 GLN n 1 71 GLU n 1 72 PRO n 1 73 TRP n 1 74 GLN n 1 75 TYR n 1 76 VAL n 1 77 ASP n 1 78 ASP n 1 79 VAL n 1 80 TRP n 1 81 LEU n 1 82 MET n 1 83 PHE n 1 84 ASN n 1 85 ASN n 1 86 ALA n 1 87 TRP n 1 88 LEU n 1 89 TYR n 1 90 ASN n 1 91 ARG n 1 92 LYS n 1 93 THR n 1 94 SER n 1 95 ARG n 1 96 VAL n 1 97 TYR n 1 98 LYS n 1 99 PHE n 1 100 CYS n 1 101 SER n 1 102 LYS n 1 103 LEU n 1 104 ALA n 1 105 GLU n 1 106 VAL n 1 107 PHE n 1 108 GLU n 1 109 GLN n 1 110 GLU n 1 111 ILE n 1 112 ASP n 1 113 PRO n 1 114 VAL n 1 115 MET n 1 116 GLN n 1 117 SER n 1 118 LEU n 1 119 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 119 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CREBBP, CBP' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CBP_HUMAN _struct_ref.pdbx_db_accession Q92793 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;RKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLM FNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG ; _struct_ref.pdbx_align_begin 1081 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5MPN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 119 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q92793 _struct_ref_seq.db_align_beg 1081 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1197 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1081 _struct_ref_seq.pdbx_auth_seq_align_end 1197 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5MPN SER A 1 ? UNP Q92793 ? ? 'expression tag' 1079 1 1 5MPN MET A 2 ? UNP Q92793 ? ? 'expression tag' 1080 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 YE5 non-polymer . '1-[4-ethoxy-3-[3-(2~{H}-1,2,3,4-tetrazol-5-yl)phenyl]phenyl]ethanone' ? 'C17 H16 N4 O2' 308.335 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5MPN _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.13 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 42.24 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M MgCl2, 0.1 M Bis-Tris, pH6.5, 5% EG, 23% PEG3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-11-27 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00001 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X06SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00001 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X06SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5MPN _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.23 _reflns.d_resolution_low 44.72 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 34316 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 95.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.8 _reflns.pdbx_Rmerge_I_obs 0.058 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 16.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5MPN _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.230 _refine.ls_d_res_low 36.017 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 34271 _refine.ls_number_reflns_R_free 1999 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 95.22 _refine.ls_percent_reflns_R_free 5.83 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1587 _refine.ls_R_factor_R_free 0.1674 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1582 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 15.18 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.09 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 993 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 54 _refine_hist.number_atoms_solvent 204 _refine_hist.number_atoms_total 1251 _refine_hist.d_res_high 1.230 _refine_hist.d_res_low 36.017 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.014 ? 1101 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.000 ? 1494 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 21.612 ? 443 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.072 ? 149 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 194 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.2300 1.2608 . . 126 2102 88.00 . . . 0.2196 . 0.1922 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.2608 1.2949 . . 129 2098 88.00 . . . 0.1558 . 0.1780 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.2949 1.3330 . . 133 2122 89.00 . . . 0.1779 . 0.1660 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.3330 1.3760 . . 133 2195 92.00 . . . 0.1667 . 0.1603 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.3760 1.4252 . . 139 2257 94.00 . . . 0.1732 . 0.1526 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4252 1.4822 . . 140 2288 95.00 . . . 0.1646 . 0.1541 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4822 1.5497 . . 146 2290 96.00 . . . 0.1682 . 0.1389 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5497 1.6314 . . 146 2349 98.00 . . . 0.1473 . 0.1442 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6314 1.7336 . . 145 2364 98.00 . . . 0.1763 . 0.1501 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7336 1.8675 . . 150 2398 99.00 . . . 0.1728 . 0.1524 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8675 2.0554 . . 145 2375 98.00 . . . 0.1764 . 0.1494 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0554 2.3527 . . 154 2450 99.00 . . . 0.1453 . 0.1531 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3527 2.9640 . . 154 2449 100.00 . . . 0.1750 . 0.1672 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9640 36.0328 . . 159 2535 98.00 . . . 0.1676 . 0.1631 . . . . . . . . . . # _struct.entry_id 5MPN _struct.title 'Crystal structure of CREBBP bromodomain complexed with FA26' _struct.pdbx_descriptor 'CREB-binding protein (E.C.2.3.1.48)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5MPN _struct_keywords.text 'CREBBP bromodomain, Inhibitor, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 8 ? ARG A 25 ? LYS A 1086 ARG A 1103 1 ? 18 HELX_P HELX_P2 AA2 SER A 30 ? ARG A 34 ? SER A 1108 ARG A 1112 5 ? 5 HELX_P HELX_P3 AA3 ASP A 38 ? GLY A 43 ? ASP A 1116 GLY A 1121 1 ? 6 HELX_P HELX_P4 AA4 ASP A 46 ? VAL A 51 ? ASP A 1124 VAL A 1129 1 ? 6 HELX_P HELX_P5 AA5 ASP A 56 ? GLY A 67 ? ASP A 1134 GLY A 1145 1 ? 12 HELX_P HELX_P6 AA6 GLU A 71 ? ASN A 90 ? GLU A 1149 ASN A 1168 1 ? 20 HELX_P HELX_P7 AA7 SER A 94 ? LEU A 118 ? SER A 1172 LEU A 1196 1 ? 25 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASP _struct_mon_prot_cis.label_seq_id 27 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASP _struct_mon_prot_cis.auth_seq_id 1105 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 28 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 1106 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 13.76 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A YE5 1201 ? 10 'binding site for residue YE5 A 1201' AC2 Software A YE5 1202 ? 10 'binding site for residue YE5 A 1202' AC3 Software A EDO 1203 ? 8 'binding site for residue EDO A 1203' AC4 Software A EDO 1204 ? 7 'binding site for residue EDO A 1204' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 10 LEU A 31 ? LEU A 1109 . ? 1_555 ? 2 AC1 10 PRO A 32 ? PRO A 1110 . ? 1_555 ? 3 AC1 10 VAL A 37 ? VAL A 1115 . ? 1_555 ? 4 AC1 10 LYS A 52 ? LYS A 1130 . ? 4_445 ? 5 AC1 10 ASN A 53 ? ASN A 1131 . ? 4_445 ? 6 AC1 10 ASN A 90 ? ASN A 1168 . ? 1_555 ? 7 AC1 10 ARG A 95 ? ARG A 1173 . ? 1_555 ? 8 AC1 10 EDO D . ? EDO A 1203 . ? 1_555 ? 9 AC1 10 HOH F . ? HOH A 1320 . ? 1_555 ? 10 AC1 10 HOH F . ? HOH A 1407 . ? 1_555 ? 11 AC2 10 SER A 1 ? SER A 1079 . ? 4_446 ? 12 AC2 10 GLU A 21 ? GLU A 1099 . ? 1_555 ? 13 AC2 10 TYR A 24 ? TYR A 1102 . ? 1_555 ? 14 AC2 10 ARG A 25 ? ARG A 1103 . ? 1_555 ? 15 AC2 10 ARG A 34 ? ARG A 1112 . ? 1_555 ? 16 AC2 10 TRP A 73 ? TRP A 1151 . ? 3_545 ? 17 AC2 10 HOH F . ? HOH A 1344 . ? 1_555 ? 18 AC2 10 HOH F . ? HOH A 1377 . ? 3_545 ? 19 AC2 10 HOH F . ? HOH A 1414 . ? 1_555 ? 20 AC2 10 HOH F . ? HOH A 1424 . ? 1_555 ? 21 AC3 8 SER A 1 ? SER A 1079 . ? 3_545 ? 22 AC3 8 MET A 2 ? MET A 1080 . ? 3_545 ? 23 AC3 8 LEU A 42 ? LEU A 1120 . ? 1_555 ? 24 AC3 8 ASN A 53 ? ASN A 1131 . ? 4_445 ? 25 AC3 8 YE5 B . ? YE5 A 1201 . ? 1_555 ? 26 AC3 8 HOH F . ? HOH A 1308 . ? 1_555 ? 27 AC3 8 HOH F . ? HOH A 1311 . ? 4_445 ? 28 AC3 8 HOH F . ? HOH A 1427 . ? 1_555 ? 29 AC4 7 PRO A 9 ? PRO A 1087 . ? 1_555 ? 30 AC4 7 GLU A 10 ? GLU A 1088 . ? 1_555 ? 31 AC4 7 TRP A 87 ? TRP A 1165 . ? 3_545 ? 32 AC4 7 TYR A 97 ? TYR A 1175 . ? 3_545 ? 33 AC4 7 HOH F . ? HOH A 1343 . ? 1_555 ? 34 AC4 7 HOH F . ? HOH A 1392 . ? 1_555 ? 35 AC4 7 HOH F . ? HOH A 1410 . ? 1_555 ? # _atom_sites.entry_id 5MPN _atom_sites.fract_transf_matrix[1][1] 0.022430 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022360 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016459 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1079 1079 SER SER A . n A 1 2 MET 2 1080 1080 MET MET A . n A 1 3 ARG 3 1081 1081 ARG ARG A . n A 1 4 LYS 4 1082 1082 LYS LYS A . n A 1 5 LYS 5 1083 1083 LYS LYS A . n A 1 6 ILE 6 1084 1084 ILE ILE A . n A 1 7 PHE 7 1085 1085 PHE PHE A . n A 1 8 LYS 8 1086 1086 LYS LYS A . n A 1 9 PRO 9 1087 1087 PRO PRO A . n A 1 10 GLU 10 1088 1088 GLU GLU A . n A 1 11 GLU 11 1089 1089 GLU GLU A . n A 1 12 LEU 12 1090 1090 LEU LEU A . n A 1 13 ARG 13 1091 1091 ARG ARG A . n A 1 14 GLN 14 1092 1092 GLN GLN A . n A 1 15 ALA 15 1093 1093 ALA ALA A . n A 1 16 LEU 16 1094 1094 LEU LEU A . n A 1 17 MET 17 1095 1095 MET MET A . n A 1 18 PRO 18 1096 1096 PRO PRO A . n A 1 19 THR 19 1097 1097 THR THR A . n A 1 20 LEU 20 1098 1098 LEU LEU A . n A 1 21 GLU 21 1099 1099 GLU GLU A . n A 1 22 ALA 22 1100 1100 ALA ALA A . n A 1 23 LEU 23 1101 1101 LEU LEU A . n A 1 24 TYR 24 1102 1102 TYR TYR A . n A 1 25 ARG 25 1103 1103 ARG ARG A . n A 1 26 GLN 26 1104 1104 GLN GLN A . n A 1 27 ASP 27 1105 1105 ASP ASP A . n A 1 28 PRO 28 1106 1106 PRO PRO A . n A 1 29 GLU 29 1107 1107 GLU GLU A . n A 1 30 SER 30 1108 1108 SER SER A . n A 1 31 LEU 31 1109 1109 LEU LEU A . n A 1 32 PRO 32 1110 1110 PRO PRO A . n A 1 33 PHE 33 1111 1111 PHE PHE A . n A 1 34 ARG 34 1112 1112 ARG ARG A . n A 1 35 GLN 35 1113 1113 GLN GLN A . n A 1 36 PRO 36 1114 1114 PRO PRO A . n A 1 37 VAL 37 1115 1115 VAL VAL A . n A 1 38 ASP 38 1116 1116 ASP ASP A . n A 1 39 PRO 39 1117 1117 PRO PRO A . n A 1 40 GLN 40 1118 1118 GLN GLN A . n A 1 41 LEU 41 1119 1119 LEU LEU A . n A 1 42 LEU 42 1120 1120 LEU LEU A . n A 1 43 GLY 43 1121 1121 GLY GLY A . n A 1 44 ILE 44 1122 1122 ILE ILE A . n A 1 45 PRO 45 1123 1123 PRO PRO A . n A 1 46 ASP 46 1124 1124 ASP ASP A . n A 1 47 TYR 47 1125 1125 TYR TYR A . n A 1 48 PHE 48 1126 1126 PHE PHE A . n A 1 49 ASP 49 1127 1127 ASP ASP A . n A 1 50 ILE 50 1128 1128 ILE ILE A . n A 1 51 VAL 51 1129 1129 VAL VAL A . n A 1 52 LYS 52 1130 1130 LYS LYS A . n A 1 53 ASN 53 1131 1131 ASN ASN A . n A 1 54 PRO 54 1132 1132 PRO PRO A . n A 1 55 MET 55 1133 1133 MET MET A . n A 1 56 ASP 56 1134 1134 ASP ASP A . n A 1 57 LEU 57 1135 1135 LEU LEU A . n A 1 58 SER 58 1136 1136 SER SER A . n A 1 59 THR 59 1137 1137 THR THR A . n A 1 60 ILE 60 1138 1138 ILE ILE A . n A 1 61 LYS 61 1139 1139 LYS LYS A . n A 1 62 ARG 62 1140 1140 ARG ARG A . n A 1 63 LYS 63 1141 1141 LYS LYS A . n A 1 64 LEU 64 1142 1142 LEU LEU A . n A 1 65 ASP 65 1143 1143 ASP ASP A . n A 1 66 THR 66 1144 1144 THR THR A . n A 1 67 GLY 67 1145 1145 GLY GLY A . n A 1 68 GLN 68 1146 1146 GLN GLN A . n A 1 69 TYR 69 1147 1147 TYR TYR A . n A 1 70 GLN 70 1148 1148 GLN GLN A . n A 1 71 GLU 71 1149 1149 GLU GLU A . n A 1 72 PRO 72 1150 1150 PRO PRO A . n A 1 73 TRP 73 1151 1151 TRP TRP A . n A 1 74 GLN 74 1152 1152 GLN GLN A . n A 1 75 TYR 75 1153 1153 TYR TYR A . n A 1 76 VAL 76 1154 1154 VAL VAL A . n A 1 77 ASP 77 1155 1155 ASP ASP A . n A 1 78 ASP 78 1156 1156 ASP ASP A . n A 1 79 VAL 79 1157 1157 VAL VAL A . n A 1 80 TRP 80 1158 1158 TRP TRP A . n A 1 81 LEU 81 1159 1159 LEU LEU A . n A 1 82 MET 82 1160 1160 MET MET A . n A 1 83 PHE 83 1161 1161 PHE PHE A . n A 1 84 ASN 84 1162 1162 ASN ASN A . n A 1 85 ASN 85 1163 1163 ASN ASN A . n A 1 86 ALA 86 1164 1164 ALA ALA A . n A 1 87 TRP 87 1165 1165 TRP TRP A . n A 1 88 LEU 88 1166 1166 LEU LEU A . n A 1 89 TYR 89 1167 1167 TYR TYR A . n A 1 90 ASN 90 1168 1168 ASN ASN A . n A 1 91 ARG 91 1169 1169 ARG ARG A . n A 1 92 LYS 92 1170 1170 LYS LYS A . n A 1 93 THR 93 1171 1171 THR THR A . n A 1 94 SER 94 1172 1172 SER SER A . n A 1 95 ARG 95 1173 1173 ARG ARG A . n A 1 96 VAL 96 1174 1174 VAL VAL A . n A 1 97 TYR 97 1175 1175 TYR TYR A . n A 1 98 LYS 98 1176 1176 LYS LYS A . n A 1 99 PHE 99 1177 1177 PHE PHE A . n A 1 100 CYS 100 1178 1178 CYS CYS A . n A 1 101 SER 101 1179 1179 SER SER A . n A 1 102 LYS 102 1180 1180 LYS LYS A . n A 1 103 LEU 103 1181 1181 LEU LEU A . n A 1 104 ALA 104 1182 1182 ALA ALA A . n A 1 105 GLU 105 1183 1183 GLU GLU A . n A 1 106 VAL 106 1184 1184 VAL VAL A . n A 1 107 PHE 107 1185 1185 PHE PHE A . n A 1 108 GLU 108 1186 1186 GLU GLU A . n A 1 109 GLN 109 1187 1187 GLN GLN A . n A 1 110 GLU 110 1188 1188 GLU GLU A . n A 1 111 ILE 111 1189 1189 ILE ILE A . n A 1 112 ASP 112 1190 1190 ASP ASP A . n A 1 113 PRO 113 1191 1191 PRO PRO A . n A 1 114 VAL 114 1192 1192 VAL VAL A . n A 1 115 MET 115 1193 1193 MET MET A . n A 1 116 GLN 116 1194 1194 GLN GLN A . n A 1 117 SER 117 1195 1195 SER SER A . n A 1 118 LEU 118 1196 1196 LEU LEU A . n A 1 119 GLY 119 1197 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 YE5 1 1201 1 YE5 DRG A . C 2 YE5 1 1202 2 YE5 DRG A . D 3 EDO 1 1203 1 EDO EGG A . E 3 EDO 1 1204 2 EDO EGG A . F 4 HOH 1 1301 184 HOH HOH A . F 4 HOH 2 1302 160 HOH HOH A . F 4 HOH 3 1303 131 HOH HOH A . F 4 HOH 4 1304 81 HOH HOH A . F 4 HOH 5 1305 153 HOH HOH A . F 4 HOH 6 1306 172 HOH HOH A . F 4 HOH 7 1307 16 HOH HOH A . F 4 HOH 8 1308 204 HOH HOH A . F 4 HOH 9 1309 162 HOH HOH A . F 4 HOH 10 1310 121 HOH HOH A . F 4 HOH 11 1311 196 HOH HOH A . F 4 HOH 12 1312 197 HOH HOH A . F 4 HOH 13 1313 62 HOH HOH A . F 4 HOH 14 1314 195 HOH HOH A . F 4 HOH 15 1315 135 HOH HOH A . F 4 HOH 16 1316 48 HOH HOH A . F 4 HOH 17 1317 141 HOH HOH A . F 4 HOH 18 1318 79 HOH HOH A . F 4 HOH 19 1319 112 HOH HOH A . F 4 HOH 20 1320 2 HOH HOH A . F 4 HOH 21 1321 64 HOH HOH A . F 4 HOH 22 1322 25 HOH HOH A . F 4 HOH 23 1323 58 HOH HOH A . F 4 HOH 24 1324 144 HOH HOH A . F 4 HOH 25 1325 171 HOH HOH A . F 4 HOH 26 1326 93 HOH HOH A . F 4 HOH 27 1327 65 HOH HOH A . F 4 HOH 28 1328 150 HOH HOH A . F 4 HOH 29 1329 43 HOH HOH A . F 4 HOH 30 1330 72 HOH HOH A . F 4 HOH 31 1331 51 HOH HOH A . F 4 HOH 32 1332 87 HOH HOH A . F 4 HOH 33 1333 163 HOH HOH A . F 4 HOH 34 1334 129 HOH HOH A . F 4 HOH 35 1335 18 HOH HOH A . F 4 HOH 36 1336 154 HOH HOH A . F 4 HOH 37 1337 169 HOH HOH A . F 4 HOH 38 1338 70 HOH HOH A . F 4 HOH 39 1339 92 HOH HOH A . F 4 HOH 40 1340 17 HOH HOH A . F 4 HOH 41 1341 173 HOH HOH A . F 4 HOH 42 1342 102 HOH HOH A . F 4 HOH 43 1343 152 HOH HOH A . F 4 HOH 44 1344 40 HOH HOH A . F 4 HOH 45 1345 6 HOH HOH A . F 4 HOH 46 1346 13 HOH HOH A . F 4 HOH 47 1347 52 HOH HOH A . F 4 HOH 48 1348 38 HOH HOH A . F 4 HOH 49 1349 190 HOH HOH A . F 4 HOH 50 1350 7 HOH HOH A . F 4 HOH 51 1351 63 HOH HOH A . F 4 HOH 52 1352 19 HOH HOH A . F 4 HOH 53 1353 8 HOH HOH A . F 4 HOH 54 1354 9 HOH HOH A . F 4 HOH 55 1355 29 HOH HOH A . F 4 HOH 56 1356 45 HOH HOH A . F 4 HOH 57 1357 47 HOH HOH A . F 4 HOH 58 1358 39 HOH HOH A . F 4 HOH 59 1359 22 HOH HOH A . F 4 HOH 60 1360 99 HOH HOH A . F 4 HOH 61 1361 28 HOH HOH A . F 4 HOH 62 1362 139 HOH HOH A . F 4 HOH 63 1363 60 HOH HOH A . F 4 HOH 64 1364 136 HOH HOH A . F 4 HOH 65 1365 32 HOH HOH A . F 4 HOH 66 1366 179 HOH HOH A . F 4 HOH 67 1367 21 HOH HOH A . F 4 HOH 68 1368 86 HOH HOH A . F 4 HOH 69 1369 138 HOH HOH A . F 4 HOH 70 1370 156 HOH HOH A . F 4 HOH 71 1371 181 HOH HOH A . F 4 HOH 72 1372 36 HOH HOH A . F 4 HOH 73 1373 5 HOH HOH A . F 4 HOH 74 1374 133 HOH HOH A . F 4 HOH 75 1375 1 HOH HOH A . F 4 HOH 76 1376 59 HOH HOH A . F 4 HOH 77 1377 34 HOH HOH A . F 4 HOH 78 1378 3 HOH HOH A . F 4 HOH 79 1379 176 HOH HOH A . F 4 HOH 80 1380 118 HOH HOH A . F 4 HOH 81 1381 115 HOH HOH A . F 4 HOH 82 1382 145 HOH HOH A . F 4 HOH 83 1383 37 HOH HOH A . F 4 HOH 84 1384 49 HOH HOH A . F 4 HOH 85 1385 194 HOH HOH A . F 4 HOH 86 1386 15 HOH HOH A . F 4 HOH 87 1387 158 HOH HOH A . F 4 HOH 88 1388 68 HOH HOH A . F 4 HOH 89 1389 55 HOH HOH A . F 4 HOH 90 1390 82 HOH HOH A . F 4 HOH 91 1391 27 HOH HOH A . F 4 HOH 92 1392 146 HOH HOH A . F 4 HOH 93 1393 107 HOH HOH A . F 4 HOH 94 1394 20 HOH HOH A . F 4 HOH 95 1395 89 HOH HOH A . F 4 HOH 96 1396 106 HOH HOH A . F 4 HOH 97 1397 170 HOH HOH A . F 4 HOH 98 1398 94 HOH HOH A . F 4 HOH 99 1399 191 HOH HOH A . F 4 HOH 100 1400 109 HOH HOH A . F 4 HOH 101 1401 157 HOH HOH A . F 4 HOH 102 1402 164 HOH HOH A . F 4 HOH 103 1403 46 HOH HOH A . F 4 HOH 104 1404 151 HOH HOH A . F 4 HOH 105 1405 12 HOH HOH A . F 4 HOH 106 1406 31 HOH HOH A . F 4 HOH 107 1407 66 HOH HOH A . F 4 HOH 108 1408 123 HOH HOH A . F 4 HOH 109 1409 168 HOH HOH A . F 4 HOH 110 1410 183 HOH HOH A . F 4 HOH 111 1411 57 HOH HOH A . F 4 HOH 112 1412 30 HOH HOH A . F 4 HOH 113 1413 50 HOH HOH A . F 4 HOH 114 1414 54 HOH HOH A . F 4 HOH 115 1415 104 HOH HOH A . F 4 HOH 116 1416 26 HOH HOH A . F 4 HOH 117 1417 78 HOH HOH A . F 4 HOH 118 1418 101 HOH HOH A . F 4 HOH 119 1419 24 HOH HOH A . F 4 HOH 120 1420 11 HOH HOH A . F 4 HOH 121 1421 73 HOH HOH A . F 4 HOH 122 1422 56 HOH HOH A . F 4 HOH 123 1423 97 HOH HOH A . F 4 HOH 124 1424 177 HOH HOH A . F 4 HOH 125 1425 10 HOH HOH A . F 4 HOH 126 1426 44 HOH HOH A . F 4 HOH 127 1427 134 HOH HOH A . F 4 HOH 128 1428 147 HOH HOH A . F 4 HOH 129 1429 91 HOH HOH A . F 4 HOH 130 1430 193 HOH HOH A . F 4 HOH 131 1431 130 HOH HOH A . F 4 HOH 132 1432 120 HOH HOH A . F 4 HOH 133 1433 201 HOH HOH A . F 4 HOH 134 1434 132 HOH HOH A . F 4 HOH 135 1435 113 HOH HOH A . F 4 HOH 136 1436 161 HOH HOH A . F 4 HOH 137 1437 110 HOH HOH A . F 4 HOH 138 1438 203 HOH HOH A . F 4 HOH 139 1439 126 HOH HOH A . F 4 HOH 140 1440 140 HOH HOH A . F 4 HOH 141 1441 23 HOH HOH A . F 4 HOH 142 1442 178 HOH HOH A . F 4 HOH 143 1443 202 HOH HOH A . F 4 HOH 144 1444 108 HOH HOH A . F 4 HOH 145 1445 14 HOH HOH A . F 4 HOH 146 1446 53 HOH HOH A . F 4 HOH 147 1447 84 HOH HOH A . F 4 HOH 148 1448 4 HOH HOH A . F 4 HOH 149 1449 71 HOH HOH A . F 4 HOH 150 1450 198 HOH HOH A . F 4 HOH 151 1451 103 HOH HOH A . F 4 HOH 152 1452 128 HOH HOH A . F 4 HOH 153 1453 76 HOH HOH A . F 4 HOH 154 1454 187 HOH HOH A . F 4 HOH 155 1455 116 HOH HOH A . F 4 HOH 156 1456 159 HOH HOH A . F 4 HOH 157 1457 180 HOH HOH A . F 4 HOH 158 1458 149 HOH HOH A . F 4 HOH 159 1459 95 HOH HOH A . F 4 HOH 160 1460 185 HOH HOH A . F 4 HOH 161 1461 83 HOH HOH A . F 4 HOH 162 1462 199 HOH HOH A . F 4 HOH 163 1463 148 HOH HOH A . F 4 HOH 164 1464 175 HOH HOH A . F 4 HOH 165 1465 165 HOH HOH A . F 4 HOH 166 1466 119 HOH HOH A . F 4 HOH 167 1467 80 HOH HOH A . F 4 HOH 168 1468 125 HOH HOH A . F 4 HOH 169 1469 166 HOH HOH A . F 4 HOH 170 1470 114 HOH HOH A . F 4 HOH 171 1471 105 HOH HOH A . F 4 HOH 172 1472 117 HOH HOH A . F 4 HOH 173 1473 33 HOH HOH A . F 4 HOH 174 1474 192 HOH HOH A . F 4 HOH 175 1475 96 HOH HOH A . F 4 HOH 176 1476 124 HOH HOH A . F 4 HOH 177 1477 42 HOH HOH A . F 4 HOH 178 1478 100 HOH HOH A . F 4 HOH 179 1479 61 HOH HOH A . F 4 HOH 180 1480 67 HOH HOH A . F 4 HOH 181 1481 200 HOH HOH A . F 4 HOH 182 1482 188 HOH HOH A . F 4 HOH 183 1483 143 HOH HOH A . F 4 HOH 184 1484 189 HOH HOH A . F 4 HOH 185 1485 98 HOH HOH A . F 4 HOH 186 1486 77 HOH HOH A . F 4 HOH 187 1487 69 HOH HOH A . F 4 HOH 188 1488 111 HOH HOH A . F 4 HOH 189 1489 142 HOH HOH A . F 4 HOH 190 1490 186 HOH HOH A . F 4 HOH 191 1491 122 HOH HOH A . F 4 HOH 192 1492 155 HOH HOH A . F 4 HOH 193 1493 85 HOH HOH A . F 4 HOH 194 1494 41 HOH HOH A . F 4 HOH 195 1495 174 HOH HOH A . F 4 HOH 196 1496 74 HOH HOH A . F 4 HOH 197 1497 137 HOH HOH A . F 4 HOH 198 1498 182 HOH HOH A . F 4 HOH 199 1499 167 HOH HOH A . F 4 HOH 200 1500 88 HOH HOH A . F 4 HOH 201 1501 35 HOH HOH A . F 4 HOH 202 1502 127 HOH HOH A . F 4 HOH 203 1503 75 HOH HOH A . F 4 HOH 204 1504 90 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 250 ? 1 MORE 3 ? 1 'SSA (A^2)' 7730 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-01-17 2 'Structure model' 1 1 2018-08-29 3 'Structure model' 1 2 2018-10-10 4 'Structure model' 1 3 2019-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' reflns_shell # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.title' 7 2 'Structure model' '_citation.year' 8 3 'Structure model' '_citation.journal_abbrev' 9 3 'Structure model' '_citation.journal_volume' 10 3 'Structure model' '_citation.page_first' 11 3 'Structure model' '_citation.page_last' 12 3 'Structure model' '_citation.pdbx_database_id_PubMed' 13 3 'Structure model' '_citation.title' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -4.2974 _pdbx_refine_tls.origin_y -11.7800 _pdbx_refine_tls.origin_z 12.1489 _pdbx_refine_tls.T[1][1] 0.0808 _pdbx_refine_tls.T[2][2] 0.0756 _pdbx_refine_tls.T[3][3] 0.0731 _pdbx_refine_tls.T[1][2] 0.0030 _pdbx_refine_tls.T[1][3] -0.0140 _pdbx_refine_tls.T[2][3] -0.0016 _pdbx_refine_tls.L[1][1] 0.9212 _pdbx_refine_tls.L[2][2] 1.0388 _pdbx_refine_tls.L[3][3] 0.3115 _pdbx_refine_tls.L[1][2] -0.3253 _pdbx_refine_tls.L[1][3] 0.1528 _pdbx_refine_tls.L[2][3] -0.1024 _pdbx_refine_tls.S[1][1] -0.0459 _pdbx_refine_tls.S[1][2] -0.1024 _pdbx_refine_tls.S[1][3] -0.0105 _pdbx_refine_tls.S[2][1] 0.1155 _pdbx_refine_tls.S[2][2] 0.0403 _pdbx_refine_tls.S[2][3] -0.0648 _pdbx_refine_tls.S[3][1] 0.0054 _pdbx_refine_tls.S[3][2] -0.0572 _pdbx_refine_tls.S[3][3] -0.0189 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.11.1_2575: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 1362 ? ? O A HOH 1440 ? ? 1.90 2 1 O A HOH 1314 ? ? O A HOH 1450 ? ? 2.01 3 1 O A HOH 1465 ? ? O A HOH 1469 ? ? 2.05 4 1 NE2 A GLN 1146 ? A O A HOH 1301 ? ? 2.09 5 1 O A HOH 1317 ? ? O A HOH 1440 ? ? 2.13 6 1 O A HOH 1349 ? ? O A HOH 1454 ? ? 2.14 7 1 OD1 A ASP 1190 ? ? O A HOH 1302 ? ? 2.16 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 1371 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 1462 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 3_555 _pdbx_validate_symm_contact.dist 2.19 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 1183 ? CD ? A GLU 105 CD 2 1 Y 1 A GLU 1183 ? OE1 ? A GLU 105 OE1 3 1 Y 1 A GLU 1183 ? OE2 ? A GLU 105 OE2 # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id GLY _pdbx_unobs_or_zero_occ_residues.auth_seq_id 1197 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id GLY _pdbx_unobs_or_zero_occ_residues.label_seq_id 119 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '1-[4-ethoxy-3-[3-(2~{H}-1,2,3,4-tetrazol-5-yl)phenyl]phenyl]ethanone' YE5 3 1,2-ETHANEDIOL EDO 4 water HOH #