data_5N07 # _entry.id 5N07 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5N07 WWPDB D_1200003347 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5N07 _pdbx_database_status.recvd_initial_deposition_date 2017-02-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Volbeda, A.' 1 ? 'Fontecilla-Camps, J.C.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 8 _citation.language ? _citation.page_first 15052 _citation.page_last 15052 _citation.title 'Crystal structures of the NO sensor NsrR reveal how its iron-sulfur cluster modulates DNA binding.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/ncomms15052 _citation.pdbx_database_id_PubMed 28425466 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Volbeda, A.' 1 primary 'Dodd, E.L.' 2 primary 'Darnault, C.' 3 primary 'Crack, J.C.' 4 primary 'Renoux, O.' 5 primary 'Hutchings, M.I.' 6 primary 'Le Brun, N.E.' 7 primary 'Fontecilla-Camps, J.C.' 8 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5N07 _cell.details ? _cell.formula_units_Z ? _cell.length_a 78.760 _cell.length_a_esd ? _cell.length_b 78.760 _cell.length_b_esd ? _cell.length_c 93.260 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5N07 _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'HTH-type transcriptional repressor NsrR' 17503.107 1 ? ? ? ? 2 non-polymer syn 'IRON/SULFUR CLUSTER' 351.640 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 4 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 5 water nat water 18.015 31 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MRLTKFTDLALRSLMRLAVVRDGDEPLATREVAEVVGVPYTHAAKAITRLQHLGVVEARRGRGGGLTLTDLGRRVSVGWL VRELEGEAEVVDCEGDNPCPLRGACRLRRALRDAQEAFYAALDPLTVTDLVAAPTGPVLLGLTDRPSGKLAAALEHHHHH H ; _entity_poly.pdbx_seq_one_letter_code_can ;MRLTKFTDLALRSLMRLAVVRDGDEPLATREVAEVVGVPYTHAAKAITRLQHLGVVEARRGRGGGLTLTDLGRRVSVGWL VRELEGEAEVVDCEGDNPCPLRGACRLRRALRDAQEAFYAALDPLTVTDLVAAPTGPVLLGLTDRPSGKLAAALEHHHHH H ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 LEU n 1 4 THR n 1 5 LYS n 1 6 PHE n 1 7 THR n 1 8 ASP n 1 9 LEU n 1 10 ALA n 1 11 LEU n 1 12 ARG n 1 13 SER n 1 14 LEU n 1 15 MET n 1 16 ARG n 1 17 LEU n 1 18 ALA n 1 19 VAL n 1 20 VAL n 1 21 ARG n 1 22 ASP n 1 23 GLY n 1 24 ASP n 1 25 GLU n 1 26 PRO n 1 27 LEU n 1 28 ALA n 1 29 THR n 1 30 ARG n 1 31 GLU n 1 32 VAL n 1 33 ALA n 1 34 GLU n 1 35 VAL n 1 36 VAL n 1 37 GLY n 1 38 VAL n 1 39 PRO n 1 40 TYR n 1 41 THR n 1 42 HIS n 1 43 ALA n 1 44 ALA n 1 45 LYS n 1 46 ALA n 1 47 ILE n 1 48 THR n 1 49 ARG n 1 50 LEU n 1 51 GLN n 1 52 HIS n 1 53 LEU n 1 54 GLY n 1 55 VAL n 1 56 VAL n 1 57 GLU n 1 58 ALA n 1 59 ARG n 1 60 ARG n 1 61 GLY n 1 62 ARG n 1 63 GLY n 1 64 GLY n 1 65 GLY n 1 66 LEU n 1 67 THR n 1 68 LEU n 1 69 THR n 1 70 ASP n 1 71 LEU n 1 72 GLY n 1 73 ARG n 1 74 ARG n 1 75 VAL n 1 76 SER n 1 77 VAL n 1 78 GLY n 1 79 TRP n 1 80 LEU n 1 81 VAL n 1 82 ARG n 1 83 GLU n 1 84 LEU n 1 85 GLU n 1 86 GLY n 1 87 GLU n 1 88 ALA n 1 89 GLU n 1 90 VAL n 1 91 VAL n 1 92 ASP n 1 93 CYS n 1 94 GLU n 1 95 GLY n 1 96 ASP n 1 97 ASN n 1 98 PRO n 1 99 CYS n 1 100 PRO n 1 101 LEU n 1 102 ARG n 1 103 GLY n 1 104 ALA n 1 105 CYS n 1 106 ARG n 1 107 LEU n 1 108 ARG n 1 109 ARG n 1 110 ALA n 1 111 LEU n 1 112 ARG n 1 113 ASP n 1 114 ALA n 1 115 GLN n 1 116 GLU n 1 117 ALA n 1 118 PHE n 1 119 TYR n 1 120 ALA n 1 121 ALA n 1 122 LEU n 1 123 ASP n 1 124 PRO n 1 125 LEU n 1 126 THR n 1 127 VAL n 1 128 THR n 1 129 ASP n 1 130 LEU n 1 131 VAL n 1 132 ALA n 1 133 ALA n 1 134 PRO n 1 135 THR n 1 136 GLY n 1 137 PRO n 1 138 VAL n 1 139 LEU n 1 140 LEU n 1 141 GLY n 1 142 LEU n 1 143 THR n 1 144 ASP n 1 145 ARG n 1 146 PRO n 1 147 SER n 1 148 GLY n 1 149 LYS n 1 150 LEU n 1 151 ALA n 1 152 ALA n 1 153 ALA n 1 154 LEU n 1 155 GLU n 1 156 HIS n 1 157 HIS n 1 158 HIS n 1 159 HIS n 1 160 HIS n 1 161 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 161 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'nsrR, SCO7427, SC6D11.23' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptomyces coelicolor A3(2)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 100226 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NSRR_STRCO _struct_ref.pdbx_db_accession Q9L132 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MRLTKFTDLALRSLMRLAVVRDGDEPLATREVAEVVGVPYTHAAKAITRLQHLGVVEARRGRGGGLTLTDLGRRVSVGWL VRELEGEAEVVDCEGDNPCPLRGACRLRRALRDAQEAFYAALDPLTVTDLVAAPTGPVLLGLTDRPSG ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5N07 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 148 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9L132 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 148 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 148 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5N07 LYS A 149 ? UNP Q9L132 ? ? 'expression tag' 149 1 1 5N07 LEU A 150 ? UNP Q9L132 ? ? 'expression tag' 150 2 1 5N07 ALA A 151 ? UNP Q9L132 ? ? 'expression tag' 151 3 1 5N07 ALA A 152 ? UNP Q9L132 ? ? 'expression tag' 152 4 1 5N07 ALA A 153 ? UNP Q9L132 ? ? 'expression tag' 153 5 1 5N07 LEU A 154 ? UNP Q9L132 ? ? 'expression tag' 154 6 1 5N07 GLU A 155 ? UNP Q9L132 ? ? 'expression tag' 155 7 1 5N07 HIS A 156 ? UNP Q9L132 ? ? 'expression tag' 156 8 1 5N07 HIS A 157 ? UNP Q9L132 ? ? 'expression tag' 157 9 1 5N07 HIS A 158 ? UNP Q9L132 ? ? 'expression tag' 158 10 1 5N07 HIS A 159 ? UNP Q9L132 ? ? 'expression tag' 159 11 1 5N07 HIS A 160 ? UNP Q9L132 ? ? 'expression tag' 160 12 1 5N07 HIS A 161 ? UNP Q9L132 ? ? 'expression tag' 161 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SF4 non-polymer . 'IRON/SULFUR CLUSTER' ? 'Fe4 S4' 351.640 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5N07 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.39 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.43 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.9 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'NaCl, tetraethyleneglycol monomethyl ether, HEPES, anaerobic' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-12-07 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.984 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.984 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5N07 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.95 _reflns.d_resolution_low 39.38 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12994 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.4 _reflns.pdbx_Rmerge_I_obs 0.036 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 21.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.016 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.95 _reflns_shell.d_res_low 2.02 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.0 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1245 _reflns_shell.percent_possible_all 99.5 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 2.171 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 8.9 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.810 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.509 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -0.36 _refine.aniso_B[1][2] -0.18 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] -0.36 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 1.17 _refine.B_iso_max ? _refine.B_iso_mean 95.124 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.976 _refine.correlation_coeff_Fo_to_Fc_free 0.966 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5N07 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.95 _refine.ls_d_res_low 30.00 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12307 _refine.ls_number_reflns_R_free 671 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.77 _refine.ls_percent_reflns_R_free 5.2 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.19646 _refine.ls_R_factor_R_free 0.22710 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.19491 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.140 _refine.pdbx_overall_ESU_R_Free 0.132 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 12.812 _refine.overall_SU_ML 0.158 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 1016 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 14 _refine_hist.number_atoms_solvent 31 _refine_hist.number_atoms_total 1061 _refine_hist.d_res_high 1.95 _refine_hist.d_res_low 30.00 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.012 0.019 1048 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 1021 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.511 2.049 1432 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.798 3.003 2326 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.043 5.000 135 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 39.104 22.250 40 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.272 15.000 163 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 20.612 15.000 12 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.109 0.200 180 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 0.021 1150 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.004 0.020 214 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 2.792 5.169 546 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.794 5.168 545 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 4.267 9.671 679 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 4.264 9.673 680 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 3.016 5.498 502 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 3.007 5.507 487 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 4.833 10.191 723 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 8.514 64.276 1140 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 8.496 63.787 1133 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.950 _refine_ls_shell.d_res_low 2.001 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 43 _refine_ls_shell.number_reflns_R_work 874 _refine_ls_shell.percent_reflns_obs 98.92 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.378 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.394 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5N07 _struct.title 'Structure of the [4Fe-4S] form of the NO response regulator NsrR' _struct.pdbx_descriptor 'HTH-type transcriptional repressor NsrR' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5N07 _struct_keywords.text 'NO SENSOR, IRON SULFUR CLUSTER, transcription' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 4 ? VAL A 19 ? THR A 4 VAL A 19 1 ? 16 HELX_P HELX_P2 AA2 ALA A 28 ? VAL A 36 ? ALA A 28 VAL A 36 1 ? 9 HELX_P HELX_P3 AA3 PRO A 39 ? LEU A 53 ? PRO A 39 LEU A 53 1 ? 15 HELX_P HELX_P4 AA4 THR A 69 ? VAL A 75 ? THR A 69 VAL A 75 1 ? 7 HELX_P HELX_P5 AA5 SER A 76 ? GLY A 86 ? SER A 76 GLY A 86 1 ? 11 HELX_P HELX_P6 AA6 CYS A 105 ? ASP A 123 ? CYS A 105 ASP A 123 1 ? 19 HELX_P HELX_P7 AA7 THR A 126 ? ALA A 132 ? THR A 126 ALA A 132 1 ? 7 HELX_P HELX_P8 AA8 PRO A 134 ? LEU A 142 ? PRO A 134 LEU A 142 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A CYS 93 SG ? ? ? 1_555 B SF4 . FE1 ? ? A CYS 93 A SF4 201 1_555 ? ? ? ? ? ? ? 2.255 ? metalc2 metalc ? ? A CYS 99 SG ? ? ? 1_555 B SF4 . FE3 ? ? A CYS 99 A SF4 201 1_555 ? ? ? ? ? ? ? 2.294 ? metalc3 metalc ? ? A CYS 105 SG ? ? ? 1_555 B SF4 . FE4 ? ? A CYS 105 A SF4 201 1_555 ? ? ? ? ? ? ? 2.247 ? metalc4 metalc ? ? A ASP 8 OD1 ? ? ? 1_555 B SF4 . FE2 ? ? A ASP 8 A SF4 201 7_554 ? ? ? ? ? ? ? 1.936 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 133 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 133 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 134 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 134 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 7.25 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 56 ? GLU A 57 ? VAL A 56 GLU A 57 AA1 2 THR A 67 ? LEU A 68 ? THR A 67 LEU A 68 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id GLU _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 57 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id GLU _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 57 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id THR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 67 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id THR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 67 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SF4 201 ? 6 'binding site for residue SF4 A 201' AC2 Software A SO4 202 ? 3 'binding site for residue SO4 A 202' AC3 Software A CL 203 ? 1 'binding site for residue CL A 203' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ASP A 8 ? ASP A 8 . ? 7_554 ? 2 AC1 6 ARG A 12 ? ARG A 12 . ? 7_554 ? 3 AC1 6 CYS A 93 ? CYS A 93 . ? 1_555 ? 4 AC1 6 CYS A 99 ? CYS A 99 . ? 1_555 ? 5 AC1 6 ARG A 102 ? ARG A 102 . ? 1_555 ? 6 AC1 6 CYS A 105 ? CYS A 105 . ? 1_555 ? 7 AC2 3 THR A 4 ? THR A 4 . ? 1_555 ? 8 AC2 3 LYS A 5 ? LYS A 5 . ? 1_555 ? 9 AC2 3 PHE A 6 ? PHE A 6 . ? 1_555 ? 10 AC3 1 ARG A 112 ? ARG A 112 . ? 1_555 ? # _atom_sites.entry_id 5N07 _atom_sites.fract_transf_matrix[1][1] 0.012697 _atom_sites.fract_transf_matrix[1][2] 0.007331 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014661 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010723 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL FE N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 MET 15 15 15 MET MET A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 HIS 42 42 42 HIS HIS A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 HIS 52 52 52 HIS HIS A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 ARG 59 59 ? ? ? A . n A 1 60 ARG 60 60 ? ? ? A . n A 1 61 GLY 61 61 ? ? ? A . n A 1 62 ARG 62 62 ? ? ? A . n A 1 63 GLY 63 63 ? ? ? A . n A 1 64 GLY 64 64 ? ? ? A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 TRP 79 79 79 TRP TRP A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 CYS 93 93 93 CYS CYS A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 PRO 98 98 98 PRO PRO A . n A 1 99 CYS 99 99 99 CYS CYS A . n A 1 100 PRO 100 100 100 PRO PRO A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 CYS 105 105 105 CYS CYS A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 ARG 108 108 108 ARG ARG A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 GLN 115 115 115 GLN GLN A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 PHE 118 118 118 PHE PHE A . n A 1 119 TYR 119 119 119 TYR TYR A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 PRO 124 124 124 PRO PRO A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 THR 126 126 126 THR THR A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 THR 128 128 128 THR THR A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 PRO 134 134 134 PRO PRO A . n A 1 135 THR 135 135 135 THR THR A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 PRO 137 137 137 PRO PRO A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 THR 143 143 143 THR THR A . n A 1 144 ASP 144 144 144 ASP ASP A . n A 1 145 ARG 145 145 ? ? ? A . n A 1 146 PRO 146 146 ? ? ? A . n A 1 147 SER 147 147 ? ? ? A . n A 1 148 GLY 148 148 ? ? ? A . n A 1 149 LYS 149 149 ? ? ? A . n A 1 150 LEU 150 150 ? ? ? A . n A 1 151 ALA 151 151 ? ? ? A . n A 1 152 ALA 152 152 ? ? ? A . n A 1 153 ALA 153 153 ? ? ? A . n A 1 154 LEU 154 154 ? ? ? A . n A 1 155 GLU 155 155 ? ? ? A . n A 1 156 HIS 156 156 ? ? ? A . n A 1 157 HIS 157 157 ? ? ? A . n A 1 158 HIS 158 158 ? ? ? A . n A 1 159 HIS 159 159 ? ? ? A . n A 1 160 HIS 160 160 ? ? ? A . n A 1 161 HIS 161 161 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SF4 1 201 150 SF4 FS4 A . C 3 SO4 1 202 151 SO4 SO4 A . D 4 CL 1 203 152 CL CL A . E 5 HOH 1 301 182 HOH HOH A . E 5 HOH 2 302 177 HOH HOH A . E 5 HOH 3 303 181 HOH HOH A . E 5 HOH 4 304 172 HOH HOH A . E 5 HOH 5 305 175 HOH HOH A . E 5 HOH 6 306 185 HOH HOH A . E 5 HOH 7 307 176 HOH HOH A . E 5 HOH 8 308 180 HOH HOH A . E 5 HOH 9 309 163 HOH HOH A . E 5 HOH 10 310 189 HOH HOH A . E 5 HOH 11 311 173 HOH HOH A . E 5 HOH 12 312 186 HOH HOH A . E 5 HOH 13 313 179 HOH HOH A . E 5 HOH 14 314 171 HOH HOH A . E 5 HOH 15 315 169 HOH HOH A . E 5 HOH 16 316 184 HOH HOH A . E 5 HOH 17 317 165 HOH HOH A . E 5 HOH 18 318 167 HOH HOH A . E 5 HOH 19 319 191 HOH HOH A . E 5 HOH 20 320 187 HOH HOH A . E 5 HOH 21 321 188 HOH HOH A . E 5 HOH 22 322 170 HOH HOH A . E 5 HOH 23 323 174 HOH HOH A . E 5 HOH 24 324 183 HOH HOH A . E 5 HOH 25 325 168 HOH HOH A . E 5 HOH 26 326 166 HOH HOH A . E 5 HOH 27 327 161 HOH HOH A . E 5 HOH 28 328 164 HOH HOH A . E 5 HOH 29 329 178 HOH HOH A . E 5 HOH 30 330 162 HOH HOH A . E 5 HOH 31 331 190 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5020 ? 1 MORE -104 ? 1 'SSA (A^2)' 12910 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_554 y,x,-z-1/3 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -31.0866666667 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 93 ? A CYS 93 ? 1_555 FE1 ? B SF4 . ? A SF4 201 ? 1_555 S2 ? B SF4 . ? A SF4 201 ? 1_555 108.0 ? 2 SG ? A CYS 93 ? A CYS 93 ? 1_555 FE1 ? B SF4 . ? A SF4 201 ? 1_555 S3 ? B SF4 . ? A SF4 201 ? 1_555 115.2 ? 3 S2 ? B SF4 . ? A SF4 201 ? 1_555 FE1 ? B SF4 . ? A SF4 201 ? 1_555 S3 ? B SF4 . ? A SF4 201 ? 1_555 107.1 ? 4 SG ? A CYS 93 ? A CYS 93 ? 1_555 FE1 ? B SF4 . ? A SF4 201 ? 1_555 S4 ? B SF4 . ? A SF4 201 ? 1_555 113.6 ? 5 S2 ? B SF4 . ? A SF4 201 ? 1_555 FE1 ? B SF4 . ? A SF4 201 ? 1_555 S4 ? B SF4 . ? A SF4 201 ? 1_555 107.9 ? 6 S3 ? B SF4 . ? A SF4 201 ? 1_555 FE1 ? B SF4 . ? A SF4 201 ? 1_555 S4 ? B SF4 . ? A SF4 201 ? 1_555 104.7 ? 7 SG ? A CYS 99 ? A CYS 99 ? 1_555 FE3 ? B SF4 . ? A SF4 201 ? 1_555 S1 ? B SF4 . ? A SF4 201 ? 1_555 111.4 ? 8 SG ? A CYS 99 ? A CYS 99 ? 1_555 FE3 ? B SF4 . ? A SF4 201 ? 1_555 S2 ? B SF4 . ? A SF4 201 ? 1_555 111.5 ? 9 S1 ? B SF4 . ? A SF4 201 ? 1_555 FE3 ? B SF4 . ? A SF4 201 ? 1_555 S2 ? B SF4 . ? A SF4 201 ? 1_555 107.7 ? 10 SG ? A CYS 99 ? A CYS 99 ? 1_555 FE3 ? B SF4 . ? A SF4 201 ? 1_555 S4 ? B SF4 . ? A SF4 201 ? 1_555 113.4 ? 11 S1 ? B SF4 . ? A SF4 201 ? 1_555 FE3 ? B SF4 . ? A SF4 201 ? 1_555 S4 ? B SF4 . ? A SF4 201 ? 1_555 105.9 ? 12 S2 ? B SF4 . ? A SF4 201 ? 1_555 FE3 ? B SF4 . ? A SF4 201 ? 1_555 S4 ? B SF4 . ? A SF4 201 ? 1_555 106.5 ? 13 SG ? A CYS 105 ? A CYS 105 ? 1_555 FE4 ? B SF4 . ? A SF4 201 ? 1_555 S1 ? B SF4 . ? A SF4 201 ? 1_555 112.7 ? 14 SG ? A CYS 105 ? A CYS 105 ? 1_555 FE4 ? B SF4 . ? A SF4 201 ? 1_555 S2 ? B SF4 . ? A SF4 201 ? 1_555 103.4 ? 15 S1 ? B SF4 . ? A SF4 201 ? 1_555 FE4 ? B SF4 . ? A SF4 201 ? 1_555 S2 ? B SF4 . ? A SF4 201 ? 1_555 107.3 ? 16 SG ? A CYS 105 ? A CYS 105 ? 1_555 FE4 ? B SF4 . ? A SF4 201 ? 1_555 S3 ? B SF4 . ? A SF4 201 ? 1_555 121.9 ? 17 S1 ? B SF4 . ? A SF4 201 ? 1_555 FE4 ? B SF4 . ? A SF4 201 ? 1_555 S3 ? B SF4 . ? A SF4 201 ? 1_555 104.3 ? 18 S2 ? B SF4 . ? A SF4 201 ? 1_555 FE4 ? B SF4 . ? A SF4 201 ? 1_555 S3 ? B SF4 . ? A SF4 201 ? 1_555 106.5 ? 19 OD1 ? A ASP 8 ? A ASP 8 ? 1_555 FE2 ? B SF4 . ? A SF4 201 ? 7_554 S1 ? B SF4 . ? A SF4 201 ? 7_554 122.7 ? 20 OD1 ? A ASP 8 ? A ASP 8 ? 1_555 FE2 ? B SF4 . ? A SF4 201 ? 7_554 S3 ? B SF4 . ? A SF4 201 ? 7_554 107.9 ? 21 S1 ? B SF4 . ? A SF4 201 ? 7_554 FE2 ? B SF4 . ? A SF4 201 ? 7_554 S3 ? B SF4 . ? A SF4 201 ? 7_554 105.4 ? 22 OD1 ? A ASP 8 ? A ASP 8 ? 1_555 FE2 ? B SF4 . ? A SF4 201 ? 7_554 S4 ? B SF4 . ? A SF4 201 ? 7_554 109.5 ? 23 S1 ? B SF4 . ? A SF4 201 ? 7_554 FE2 ? B SF4 . ? A SF4 201 ? 7_554 S4 ? B SF4 . ? A SF4 201 ? 7_554 105.8 ? 24 S3 ? B SF4 . ? A SF4 201 ? 7_554 FE2 ? B SF4 . ? A SF4 201 ? 7_554 S4 ? B SF4 . ? A SF4 201 ? 7_554 103.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-04-26 2 'Structure model' 1 1 2017-05-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined -0.3120 -30.3540 -1.5160 0.3824 0.2723 0.4487 0.1626 0.3354 0.2939 6.0822 4.6396 8.1294 0.7481 -0.8981 -3.0708 -0.5485 -0.6632 -1.0516 0.3905 -0.5146 -0.3665 0.4980 0.5642 1.0631 'X-RAY DIFFRACTION' 2 ? refined -6.8650 -20.2670 -15.0020 0.2159 0.3002 0.3105 0.0884 0.1629 -0.0090 4.6494 2.4320 9.6846 -0.8002 4.2386 -1.1989 -0.3423 0.3744 -0.3840 0.2649 -0.3767 -0.0866 0.3235 0.5850 0.7190 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 A 2 ? ? A 85 ? ? ? ? 'X-RAY DIFFRACTION' 3 2 A 86 ? ? A 144 ? ? ? ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0151 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 30 ? ? CZ A ARG 30 ? ? NH2 A ARG 30 ? ? 123.50 120.30 3.20 0.50 N 2 1 NE A ARG 102 ? ? CZ A ARG 102 ? ? NH2 A ARG 102 ? ? 116.61 120.30 -3.69 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 24 ? ? -79.59 -74.47 2 1 GLU A 25 ? ? -178.26 128.70 3 1 GLU A 57 ? ? -157.96 -141.79 4 1 ALA A 88 ? ? -35.25 131.07 5 1 GLU A 94 ? ? -150.29 87.00 6 1 ARG A 102 ? ? -38.25 125.62 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 2 ? CZ ? A ARG 2 CZ 2 1 Y 1 A ARG 2 ? NH1 ? A ARG 2 NH1 3 1 Y 1 A ARG 2 ? NH2 ? A ARG 2 NH2 4 1 Y 1 A LYS 5 ? CG ? A LYS 5 CG 5 1 Y 1 A LYS 5 ? CD ? A LYS 5 CD 6 1 Y 1 A LYS 5 ? CE ? A LYS 5 CE 7 1 Y 1 A LYS 5 ? NZ ? A LYS 5 NZ 8 1 Y 1 A ARG 21 ? CG ? A ARG 21 CG 9 1 Y 1 A ARG 21 ? CD ? A ARG 21 CD 10 1 Y 1 A ARG 21 ? NE ? A ARG 21 NE 11 1 Y 1 A ARG 21 ? CZ ? A ARG 21 CZ 12 1 Y 1 A ARG 21 ? NH1 ? A ARG 21 NH1 13 1 Y 1 A ARG 21 ? NH2 ? A ARG 21 NH2 14 1 Y 1 A ASP 22 ? CG ? A ASP 22 CG 15 1 Y 1 A ASP 22 ? OD1 ? A ASP 22 OD1 16 1 Y 1 A ASP 22 ? OD2 ? A ASP 22 OD2 17 1 Y 1 A LEU 27 ? CD1 ? A LEU 27 CD1 18 1 Y 1 A LEU 27 ? CD2 ? A LEU 27 CD2 19 1 Y 1 A ASP 144 ? CG ? A ASP 144 CG 20 1 Y 1 A ASP 144 ? OD1 ? A ASP 144 OD1 21 1 Y 1 A ASP 144 ? OD2 ? A ASP 144 OD2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ARG 59 ? A ARG 59 3 1 Y 1 A ARG 60 ? A ARG 60 4 1 Y 1 A GLY 61 ? A GLY 61 5 1 Y 1 A ARG 62 ? A ARG 62 6 1 Y 1 A GLY 63 ? A GLY 63 7 1 Y 1 A GLY 64 ? A GLY 64 8 1 Y 1 A ARG 145 ? A ARG 145 9 1 Y 1 A PRO 146 ? A PRO 146 10 1 Y 1 A SER 147 ? A SER 147 11 1 Y 1 A GLY 148 ? A GLY 148 12 1 Y 1 A LYS 149 ? A LYS 149 13 1 Y 1 A LEU 150 ? A LEU 150 14 1 Y 1 A ALA 151 ? A ALA 151 15 1 Y 1 A ALA 152 ? A ALA 152 16 1 Y 1 A ALA 153 ? A ALA 153 17 1 Y 1 A LEU 154 ? A LEU 154 18 1 Y 1 A GLU 155 ? A GLU 155 19 1 Y 1 A HIS 156 ? A HIS 156 20 1 Y 1 A HIS 157 ? A HIS 157 21 1 Y 1 A HIS 158 ? A HIS 158 22 1 Y 1 A HIS 159 ? A HIS 159 23 1 Y 1 A HIS 160 ? A HIS 160 24 1 Y 1 A HIS 161 ? A HIS 161 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'IRON/SULFUR CLUSTER' SF4 3 'SULFATE ION' SO4 4 'CHLORIDE ION' CL 5 water HOH #