data_5N5M # _entry.id 5N5M # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.313 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5N5M WWPDB D_1200003387 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5N5M _pdbx_database_status.recvd_initial_deposition_date 2017-02-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Siefker, C.' 1 ? 'Heine, A.' 2 ? 'Klebe, G.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'to be published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'A crystallographic fragment study with human Pim-1 kinase' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Siefker, C.' 1 ? primary 'Heine, A.' 2 ? primary 'Taylor, C.' 3 ? primary 'Kolb, P.' 4 ? primary 'Hardes, K.' 5 ? primary 'Steinmetzer, A.' 6 ? primary 'Klebe, G.' 7 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5N5M _cell.details ? _cell.formula_units_Z ? _cell.length_a 98.605 _cell.length_a_esd ? _cell.length_b 98.605 _cell.length_b_esd ? _cell.length_c 80.267 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5N5M _symmetry.cell_setting ? _symmetry.Int_Tables_number 170 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Serine/threonine-protein kinase pim-1' 35712.578 1 2.7.11.1 R250G ? 'Isofrom 2 of PIM-1 kinase' 2 polymer syn Pimtide 1592.850 1 ? ? ? 'PIM-1 consensus peptide' 3 non-polymer syn '~{N}-(isoquinolin-5-ylmethyl)-~{N}-methyl-2-[(3~{R})-pyrrolidin-3-yl]benzamide' 345.438 1 ? ? ? ? 4 water nat water 18.015 135 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no yes ;MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGEL PNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHN CGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI PFEHDEEIIGGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK ; ;MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGEL PNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHN CGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI PFEHDEEIIGGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK ; A ? 2 'polypeptide(L)' no no ARKRRRHPSGPPTA ARKRRRHPSGPPTA B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LEU n 1 3 LEU n 1 4 SER n 1 5 LYS n 1 6 ILE n 1 7 ASN n 1 8 SER n 1 9 LEU n 1 10 ALA n 1 11 HIS n 1 12 LEU n 1 13 ARG n 1 14 ALA n 1 15 ALA n 1 16 PRO n 1 17 CYS n 1 18 ASN n 1 19 ASP n 1 20 LEU n 1 21 HIS n 1 22 ALA n 1 23 THR n 1 24 LYS n 1 25 LEU n 1 26 ALA n 1 27 PRO n 1 28 GLY n 1 29 LYS n 1 30 GLU n 1 31 LYS n 1 32 GLU n 1 33 PRO n 1 34 LEU n 1 35 GLU n 1 36 SER n 1 37 GLN n 1 38 TYR n 1 39 GLN n 1 40 VAL n 1 41 GLY n 1 42 PRO n 1 43 LEU n 1 44 LEU n 1 45 GLY n 1 46 SER n 1 47 GLY n 1 48 GLY n 1 49 PHE n 1 50 GLY n 1 51 SER n 1 52 VAL n 1 53 TYR n 1 54 SER n 1 55 GLY n 1 56 ILE n 1 57 ARG n 1 58 VAL n 1 59 SER n 1 60 ASP n 1 61 ASN n 1 62 LEU n 1 63 PRO n 1 64 VAL n 1 65 ALA n 1 66 ILE n 1 67 LYS n 1 68 HIS n 1 69 VAL n 1 70 GLU n 1 71 LYS n 1 72 ASP n 1 73 ARG n 1 74 ILE n 1 75 SER n 1 76 ASP n 1 77 TRP n 1 78 GLY n 1 79 GLU n 1 80 LEU n 1 81 PRO n 1 82 ASN n 1 83 GLY n 1 84 THR n 1 85 ARG n 1 86 VAL n 1 87 PRO n 1 88 MET n 1 89 GLU n 1 90 VAL n 1 91 VAL n 1 92 LEU n 1 93 LEU n 1 94 LYS n 1 95 LYS n 1 96 VAL n 1 97 SER n 1 98 SER n 1 99 GLY n 1 100 PHE n 1 101 SER n 1 102 GLY n 1 103 VAL n 1 104 ILE n 1 105 ARG n 1 106 LEU n 1 107 LEU n 1 108 ASP n 1 109 TRP n 1 110 PHE n 1 111 GLU n 1 112 ARG n 1 113 PRO n 1 114 ASP n 1 115 SER n 1 116 PHE n 1 117 VAL n 1 118 LEU n 1 119 ILE n 1 120 LEU n 1 121 GLU n 1 122 ARG n 1 123 PRO n 1 124 GLU n 1 125 PRO n 1 126 VAL n 1 127 GLN n 1 128 ASP n 1 129 LEU n 1 130 PHE n 1 131 ASP n 1 132 PHE n 1 133 ILE n 1 134 THR n 1 135 GLU n 1 136 ARG n 1 137 GLY n 1 138 ALA n 1 139 LEU n 1 140 GLN n 1 141 GLU n 1 142 GLU n 1 143 LEU n 1 144 ALA n 1 145 ARG n 1 146 SER n 1 147 PHE n 1 148 PHE n 1 149 TRP n 1 150 GLN n 1 151 VAL n 1 152 LEU n 1 153 GLU n 1 154 ALA n 1 155 VAL n 1 156 ARG n 1 157 HIS n 1 158 CYS n 1 159 HIS n 1 160 ASN n 1 161 CYS n 1 162 GLY n 1 163 VAL n 1 164 LEU n 1 165 HIS n 1 166 ARG n 1 167 ASP n 1 168 ILE n 1 169 LYS n 1 170 ASP n 1 171 GLU n 1 172 ASN n 1 173 ILE n 1 174 LEU n 1 175 ILE n 1 176 ASP n 1 177 LEU n 1 178 ASN n 1 179 ARG n 1 180 GLY n 1 181 GLU n 1 182 LEU n 1 183 LYS n 1 184 LEU n 1 185 ILE n 1 186 ASP n 1 187 PHE n 1 188 GLY n 1 189 SER n 1 190 GLY n 1 191 ALA n 1 192 LEU n 1 193 LEU n 1 194 LYS n 1 195 ASP n 1 196 THR n 1 197 VAL n 1 198 TYR n 1 199 THR n 1 200 ASP n 1 201 PHE n 1 202 ASP n 1 203 GLY n 1 204 THR n 1 205 ARG n 1 206 VAL n 1 207 TYR n 1 208 SER n 1 209 PRO n 1 210 PRO n 1 211 GLU n 1 212 TRP n 1 213 ILE n 1 214 ARG n 1 215 TYR n 1 216 HIS n 1 217 ARG n 1 218 TYR n 1 219 HIS n 1 220 GLY n 1 221 ARG n 1 222 SER n 1 223 ALA n 1 224 ALA n 1 225 VAL n 1 226 TRP n 1 227 SER n 1 228 LEU n 1 229 GLY n 1 230 ILE n 1 231 LEU n 1 232 LEU n 1 233 TYR n 1 234 ASP n 1 235 MET n 1 236 VAL n 1 237 CYS n 1 238 GLY n 1 239 ASP n 1 240 ILE n 1 241 PRO n 1 242 PHE n 1 243 GLU n 1 244 HIS n 1 245 ASP n 1 246 GLU n 1 247 GLU n 1 248 ILE n 1 249 ILE n 1 250 GLY n 1 251 GLY n 1 252 GLN n 1 253 VAL n 1 254 PHE n 1 255 PHE n 1 256 ARG n 1 257 GLN n 1 258 ARG n 1 259 VAL n 1 260 SER n 1 261 SEP n 1 262 GLU n 1 263 CYS n 1 264 GLN n 1 265 HIS n 1 266 LEU n 1 267 ILE n 1 268 ARG n 1 269 TRP n 1 270 CYS n 1 271 LEU n 1 272 ALA n 1 273 LEU n 1 274 ARG n 1 275 PRO n 1 276 SER n 1 277 ASP n 1 278 ARG n 1 279 PRO n 1 280 THR n 1 281 PHE n 1 282 GLU n 1 283 GLU n 1 284 ILE n 1 285 GLN n 1 286 ASN n 1 287 HIS n 1 288 PRO n 1 289 TRP n 1 290 MET n 1 291 GLN n 1 292 ASP n 1 293 VAL n 1 294 LEU n 1 295 LEU n 1 296 PRO n 1 297 GLN n 1 298 GLU n 1 299 THR n 1 300 ALA n 1 301 GLU n 1 302 ILE n 1 303 HIS n 1 304 LEU n 1 305 HIS n 1 306 SER n 1 307 LEU n 1 308 SER n 1 309 PRO n 1 310 GLY n 1 311 PRO n 1 312 SER n 1 313 LYS n 2 1 ALA n 2 2 ARG n 2 3 LYS n 2 4 ARG n 2 5 ARG n 2 6 ARG n 2 7 HIS n 2 8 PRO n 2 9 SER n 2 10 GLY n 2 11 PRO n 2 12 PRO n 2 13 THR n 2 14 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 313 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PIM1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant pLysS _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pLIC-SGC _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 14 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name Human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP PIM1_HUMAN P11309 P11309-2 1 ;MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGEL PNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHN CGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK ; 1 2 PDB 5N5M 5N5M ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5N5M A 1 ? 313 ? P11309 1 ? 313 ? 1 313 2 2 5N5M B 1 ? 14 ? 5N5M 1 ? 14 ? 1 14 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 5N5M _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 250 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P11309 _struct_ref_seq_dif.db_mon_id ARG _struct_ref_seq_dif.pdbx_seq_db_seq_num 250 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 250 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 8O8 non-polymer . '~{N}-(isoquinolin-5-ylmethyl)-~{N}-methyl-2-[(3~{R})-pyrrolidin-3-yl]benzamide' ? 'C22 H23 N3 O' 345.438 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P' 185.072 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5N5M _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.16 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 61 _exptl_crystal.description 'hexagonal rod' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;HEPES MgCl2 Glycerol DTT BIS-TRIS-propane PEG3350 Ethylene-glycol DMSO ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details Silicon _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-09-17 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si-111 crystal monochromator' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.873 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'BESSY BEAMLINE 14.2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.873 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 14.2 _diffrn_source.pdbx_synchrotron_site BESSY # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5N5M _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.21 _reflns.d_resolution_low 50.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 22235 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.93 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.83 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.139 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.99 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.21 _reflns_shell.d_res_low 2.35 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.21 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 3579 _reflns_shell.percent_possible_all 99.8 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.98 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.567 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.89 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5N5M _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.21 _refine.ls_d_res_low 49.303 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 22230 _refine.ls_number_reflns_R_free 1112 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.91 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1679 _refine.ls_R_factor_R_free 0.2052 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1659 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.37 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3WE8 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 19.40 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.25 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2231 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 26 _refine_hist.number_atoms_solvent 135 _refine_hist.number_atoms_total 2392 _refine_hist.d_res_high 2.21 _refine_hist.d_res_low 49.303 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 2352 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.763 ? 3196 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 19.820 ? 1395 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.051 ? 338 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 438 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.2127 2.3134 . . 138 2632 100.00 . . . 0.2515 . 0.2140 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3134 2.4353 . . 139 2626 100.00 . . . 0.2701 . 0.1944 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4353 2.5879 . . 138 2629 100.00 . . . 0.2023 . 0.1730 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5879 2.7877 . . 138 2620 100.00 . . . 0.2118 . 0.1726 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7877 3.0682 . . 139 2636 100.00 . . . 0.1994 . 0.1625 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0682 3.5121 . . 138 2637 100.00 . . . 0.1947 . 0.1594 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5121 4.4244 . . 140 2649 100.00 . . . 0.1828 . 0.1482 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.4244 49.3147 . . 142 2689 100.00 . . . 0.2099 . 0.1669 . . . . . . . . . . # _struct.entry_id 5N5M _struct.title ;Crystal structure of human Pim-1 kinase in complex with a consensuspeptide and (R)-3-(2-((isoquinolin-5-ylmethyl)(methyl)carbamoyl)phenyl)pyrrolidin-1-ium ; _struct.pdbx_descriptor 'Serine/threonine-protein kinase pim-1 (E.C.2.7.11.1), Pimtide' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5N5M _struct_keywords.text 'Serine Threonine Kinase, Transferase, proto-oncogene, Fragment, PIM-1, Consensus peptide' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 33 ? GLN A 37 ? PRO A 33 GLN A 37 1 ? 5 HELX_P HELX_P2 AA2 ASP A 72 ? ILE A 74 ? ASP A 72 ILE A 74 5 ? 3 HELX_P HELX_P3 AA3 MET A 88 ? SER A 97 ? MET A 88 SER A 97 1 ? 10 HELX_P HELX_P4 AA4 LEU A 129 ? GLY A 137 ? LEU A 129 GLY A 137 1 ? 9 HELX_P HELX_P5 AA5 GLN A 140 ? CYS A 161 ? GLN A 140 CYS A 161 1 ? 22 HELX_P HELX_P6 AA6 LYS A 169 ? GLU A 171 ? LYS A 169 GLU A 171 5 ? 3 HELX_P HELX_P7 AA7 THR A 204 ? SER A 208 ? THR A 204 SER A 208 5 ? 5 HELX_P HELX_P8 AA8 PRO A 209 ? HIS A 216 ? PRO A 209 HIS A 216 1 ? 8 HELX_P HELX_P9 AA9 HIS A 219 ? GLY A 238 ? HIS A 219 GLY A 238 1 ? 20 HELX_P HELX_P10 AB1 HIS A 244 ? GLY A 251 ? HIS A 244 GLY A 251 1 ? 8 HELX_P HELX_P11 AB2 SER A 260 ? LEU A 271 ? SER A 260 LEU A 271 1 ? 12 HELX_P HELX_P12 AB3 ARG A 274 ? ARG A 278 ? ARG A 274 ARG A 278 5 ? 5 HELX_P HELX_P13 AB4 THR A 280 ? ASN A 286 ? THR A 280 ASN A 286 1 ? 7 HELX_P HELX_P14 AB5 HIS A 287 ? GLN A 291 ? HIS A 287 GLN A 291 5 ? 5 HELX_P HELX_P15 AB6 LEU A 295 ? LEU A 304 ? LEU A 295 LEU A 304 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A SER 260 C ? ? ? 1_555 A SEP 261 N ? ? A SER 260 A SEP 261 1_555 ? ? ? ? ? ? ? 1.332 ? covale2 covale both ? A SEP 261 C ? ? ? 1_555 A GLU 262 N A ? A SEP 261 A GLU 262 1_555 ? ? ? ? ? ? ? 1.328 ? covale3 covale both ? A SEP 261 C ? ? ? 1_555 A GLU 262 N B ? A SEP 261 A GLU 262 1_555 ? ? ? ? ? ? ? 1.327 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 124 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 124 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 125 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 125 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.12 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 3 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 38 ? GLY A 47 ? TYR A 38 GLY A 47 AA1 2 GLY A 50 ? ARG A 57 ? GLY A 50 ARG A 57 AA1 3 PRO A 63 ? GLU A 70 ? PRO A 63 GLU A 70 AA1 4 SER A 115 ? GLU A 121 ? SER A 115 GLU A 121 AA1 5 LEU A 106 ? GLU A 111 ? LEU A 106 GLU A 111 AA2 1 TRP A 77 ? GLU A 79 ? TRP A 77 GLU A 79 AA2 2 ARG A 85 ? PRO A 87 ? ARG A 85 PRO A 87 AA3 1 VAL A 126 ? ASP A 128 ? VAL A 126 ASP A 128 AA3 2 ILE A 173 ? ASP A 176 ? ILE A 173 ASP A 176 AA3 3 GLU A 181 ? LEU A 184 ? GLU A 181 LEU A 184 AA4 1 VAL A 163 ? LEU A 164 ? VAL A 163 LEU A 164 AA4 2 ALA A 191 ? LEU A 192 ? ALA A 191 LEU A 192 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 44 ? N LEU A 44 O VAL A 52 ? O VAL A 52 AA1 2 3 N TYR A 53 ? N TYR A 53 O ILE A 66 ? O ILE A 66 AA1 3 4 N ALA A 65 ? N ALA A 65 O LEU A 120 ? O LEU A 120 AA1 4 5 O ILE A 119 ? O ILE A 119 N LEU A 107 ? N LEU A 107 AA2 1 2 N GLY A 78 ? N GLY A 78 O VAL A 86 ? O VAL A 86 AA3 1 2 N GLN A 127 ? N GLN A 127 O ILE A 175 ? O ILE A 175 AA3 2 3 N ASP A 176 ? N ASP A 176 O GLU A 181 ? O GLU A 181 AA4 1 2 N LEU A 164 ? N LEU A 164 O ALA A 191 ? O ALA A 191 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id 8O8 _struct_site.pdbx_auth_seq_id 401 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 10 _struct_site.details 'binding site for residue 8O8 A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 10 GLY A 45 ? GLY A 45 . ? 1_555 ? 2 AC1 10 PHE A 49 ? PHE A 49 . ? 1_555 ? 3 AC1 10 ALA A 65 ? ALA A 65 . ? 1_555 ? 4 AC1 10 GLU A 121 ? GLU A 121 . ? 1_555 ? 5 AC1 10 ARG A 122 ? ARG A 122 . ? 1_555 ? 6 AC1 10 GLU A 171 ? GLU A 171 . ? 1_555 ? 7 AC1 10 ASN A 172 ? ASN A 172 . ? 1_555 ? 8 AC1 10 LEU A 174 ? LEU A 174 . ? 1_555 ? 9 AC1 10 ASP A 186 ? ASP A 186 . ? 1_555 ? 10 AC1 10 HOH D . ? HOH A 550 . ? 1_555 ? # _atom_sites.entry_id 5N5M _atom_sites.fract_transf_matrix[1][1] 0.010141 _atom_sites.fract_transf_matrix[1][2] 0.005855 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011710 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012458 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 LEU 2 2 ? ? ? A . n A 1 3 LEU 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 LYS 5 5 ? ? ? A . n A 1 6 ILE 6 6 ? ? ? A . n A 1 7 ASN 7 7 ? ? ? A . n A 1 8 SER 8 8 ? ? ? A . n A 1 9 LEU 9 9 ? ? ? A . n A 1 10 ALA 10 10 ? ? ? A . n A 1 11 HIS 11 11 ? ? ? A . n A 1 12 LEU 12 12 ? ? ? A . n A 1 13 ARG 13 13 ? ? ? A . n A 1 14 ALA 14 14 ? ? ? A . n A 1 15 ALA 15 15 ? ? ? A . n A 1 16 PRO 16 16 ? ? ? A . n A 1 17 CYS 17 17 ? ? ? A . n A 1 18 ASN 18 18 ? ? ? A . n A 1 19 ASP 19 19 ? ? ? A . n A 1 20 LEU 20 20 ? ? ? A . n A 1 21 HIS 21 21 ? ? ? A . n A 1 22 ALA 22 22 ? ? ? A . n A 1 23 THR 23 23 ? ? ? A . n A 1 24 LYS 24 24 ? ? ? A . n A 1 25 LEU 25 25 ? ? ? A . n A 1 26 ALA 26 26 ? ? ? A . n A 1 27 PRO 27 27 ? ? ? A . n A 1 28 GLY 28 28 ? ? ? A . n A 1 29 LYS 29 29 ? ? ? A . n A 1 30 GLU 30 30 ? ? ? A . n A 1 31 LYS 31 31 ? ? ? A . n A 1 32 GLU 32 32 ? ? ? A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 TRP 77 77 77 TRP TRP A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 MET 88 88 88 MET MET A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 TRP 109 109 109 TRP TRP A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 PRO 113 113 113 PRO PRO A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 PHE 116 116 116 PHE PHE A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 ILE 119 119 119 ILE ILE A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 PRO 123 123 123 PRO PRO A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 PRO 125 125 125 PRO PRO A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 GLN 127 127 127 GLN GLN A . n A 1 128 ASP 128 128 128 ASP ASP A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 PHE 130 130 130 PHE PHE A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 PHE 132 132 132 PHE PHE A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 THR 134 134 134 THR THR A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 ARG 136 136 136 ARG ARG A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 ALA 138 138 138 ALA ALA A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 GLN 140 140 140 GLN GLN A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 ARG 145 145 145 ARG ARG A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 PHE 147 147 147 PHE PHE A . n A 1 148 PHE 148 148 148 PHE PHE A . n A 1 149 TRP 149 149 149 TRP TRP A . n A 1 150 GLN 150 150 150 GLN GLN A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 GLU 153 153 153 GLU GLU A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 HIS 157 157 157 HIS HIS A . n A 1 158 CYS 158 158 158 CYS CYS A . n A 1 159 HIS 159 159 159 HIS HIS A . n A 1 160 ASN 160 160 160 ASN ASN A . n A 1 161 CYS 161 161 161 CYS CYS A . n A 1 162 GLY 162 162 162 GLY GLY A . n A 1 163 VAL 163 163 163 VAL VAL A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 HIS 165 165 165 HIS HIS A . n A 1 166 ARG 166 166 166 ARG ARG A . n A 1 167 ASP 167 167 167 ASP ASP A . n A 1 168 ILE 168 168 168 ILE ILE A . n A 1 169 LYS 169 169 169 LYS LYS A . n A 1 170 ASP 170 170 170 ASP ASP A . n A 1 171 GLU 171 171 171 GLU GLU A . n A 1 172 ASN 172 172 172 ASN ASN A . n A 1 173 ILE 173 173 173 ILE ILE A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 ILE 175 175 175 ILE ILE A . n A 1 176 ASP 176 176 176 ASP ASP A . n A 1 177 LEU 177 177 177 LEU LEU A . n A 1 178 ASN 178 178 178 ASN ASN A . n A 1 179 ARG 179 179 179 ARG ARG A . n A 1 180 GLY 180 180 180 GLY GLY A . n A 1 181 GLU 181 181 181 GLU GLU A . n A 1 182 LEU 182 182 182 LEU LEU A . n A 1 183 LYS 183 183 183 LYS LYS A . n A 1 184 LEU 184 184 184 LEU LEU A . n A 1 185 ILE 185 185 185 ILE ILE A . n A 1 186 ASP 186 186 186 ASP ASP A . n A 1 187 PHE 187 187 187 PHE PHE A . n A 1 188 GLY 188 188 188 GLY GLY A . n A 1 189 SER 189 189 189 SER SER A . n A 1 190 GLY 190 190 190 GLY GLY A . n A 1 191 ALA 191 191 191 ALA ALA A . n A 1 192 LEU 192 192 192 LEU LEU A . n A 1 193 LEU 193 193 193 LEU LEU A . n A 1 194 LYS 194 194 194 LYS LYS A . n A 1 195 ASP 195 195 195 ASP ASP A . n A 1 196 THR 196 196 196 THR THR A . n A 1 197 VAL 197 197 197 VAL VAL A . n A 1 198 TYR 198 198 198 TYR TYR A . n A 1 199 THR 199 199 199 THR THR A . n A 1 200 ASP 200 200 200 ASP ASP A . n A 1 201 PHE 201 201 201 PHE PHE A . n A 1 202 ASP 202 202 202 ASP ASP A . n A 1 203 GLY 203 203 203 GLY GLY A . n A 1 204 THR 204 204 204 THR THR A . n A 1 205 ARG 205 205 205 ARG ARG A . n A 1 206 VAL 206 206 206 VAL VAL A . n A 1 207 TYR 207 207 207 TYR TYR A . n A 1 208 SER 208 208 208 SER SER A . n A 1 209 PRO 209 209 209 PRO PRO A . n A 1 210 PRO 210 210 210 PRO PRO A . n A 1 211 GLU 211 211 211 GLU GLU A . n A 1 212 TRP 212 212 212 TRP TRP A . n A 1 213 ILE 213 213 213 ILE ILE A . n A 1 214 ARG 214 214 214 ARG ARG A . n A 1 215 TYR 215 215 215 TYR TYR A . n A 1 216 HIS 216 216 216 HIS HIS A . n A 1 217 ARG 217 217 217 ARG ARG A . n A 1 218 TYR 218 218 218 TYR TYR A . n A 1 219 HIS 219 219 219 HIS HIS A . n A 1 220 GLY 220 220 220 GLY GLY A . n A 1 221 ARG 221 221 221 ARG ARG A . n A 1 222 SER 222 222 222 SER SER A . n A 1 223 ALA 223 223 223 ALA ALA A . n A 1 224 ALA 224 224 224 ALA ALA A . n A 1 225 VAL 225 225 225 VAL VAL A . n A 1 226 TRP 226 226 226 TRP TRP A . n A 1 227 SER 227 227 227 SER SER A . n A 1 228 LEU 228 228 228 LEU LEU A . n A 1 229 GLY 229 229 229 GLY GLY A . n A 1 230 ILE 230 230 230 ILE ILE A . n A 1 231 LEU 231 231 231 LEU LEU A . n A 1 232 LEU 232 232 232 LEU LEU A . n A 1 233 TYR 233 233 233 TYR TYR A . n A 1 234 ASP 234 234 234 ASP ASP A . n A 1 235 MET 235 235 235 MET MET A . n A 1 236 VAL 236 236 236 VAL VAL A . n A 1 237 CYS 237 237 237 CYS CYS A . n A 1 238 GLY 238 238 238 GLY GLY A . n A 1 239 ASP 239 239 239 ASP ASP A . n A 1 240 ILE 240 240 240 ILE ILE A . n A 1 241 PRO 241 241 241 PRO PRO A . n A 1 242 PHE 242 242 242 PHE PHE A . n A 1 243 GLU 243 243 243 GLU GLU A . n A 1 244 HIS 244 244 244 HIS HIS A . n A 1 245 ASP 245 245 245 ASP ASP A . n A 1 246 GLU 246 246 246 GLU GLU A . n A 1 247 GLU 247 247 247 GLU GLU A . n A 1 248 ILE 248 248 248 ILE ILE A . n A 1 249 ILE 249 249 249 ILE ILE A . n A 1 250 GLY 250 250 250 GLY GLY A . n A 1 251 GLY 251 251 251 GLY GLY A . n A 1 252 GLN 252 252 252 GLN GLN A . n A 1 253 VAL 253 253 253 VAL VAL A . n A 1 254 PHE 254 254 254 PHE PHE A . n A 1 255 PHE 255 255 255 PHE PHE A . n A 1 256 ARG 256 256 256 ARG ARG A . n A 1 257 GLN 257 257 257 GLN GLN A . n A 1 258 ARG 258 258 258 ARG ARG A . n A 1 259 VAL 259 259 259 VAL VAL A . n A 1 260 SER 260 260 260 SER SER A . n A 1 261 SEP 261 261 261 SEP SEP A . n A 1 262 GLU 262 262 262 GLU GLU A . n A 1 263 CYS 263 263 263 CYS CYS A . n A 1 264 GLN 264 264 264 GLN GLN A . n A 1 265 HIS 265 265 265 HIS HIS A . n A 1 266 LEU 266 266 266 LEU LEU A . n A 1 267 ILE 267 267 267 ILE ILE A . n A 1 268 ARG 268 268 268 ARG ARG A . n A 1 269 TRP 269 269 269 TRP TRP A . n A 1 270 CYS 270 270 270 CYS CYS A . n A 1 271 LEU 271 271 271 LEU LEU A . n A 1 272 ALA 272 272 272 ALA ALA A . n A 1 273 LEU 273 273 273 LEU LEU A . n A 1 274 ARG 274 274 274 ARG ARG A . n A 1 275 PRO 275 275 275 PRO PRO A . n A 1 276 SER 276 276 276 SER SER A . n A 1 277 ASP 277 277 277 ASP ASP A . n A 1 278 ARG 278 278 278 ARG ARG A . n A 1 279 PRO 279 279 279 PRO PRO A . n A 1 280 THR 280 280 280 THR THR A . n A 1 281 PHE 281 281 281 PHE PHE A . n A 1 282 GLU 282 282 282 GLU GLU A . n A 1 283 GLU 283 283 283 GLU GLU A . n A 1 284 ILE 284 284 284 ILE ILE A . n A 1 285 GLN 285 285 285 GLN GLN A . n A 1 286 ASN 286 286 286 ASN ASN A . n A 1 287 HIS 287 287 287 HIS HIS A . n A 1 288 PRO 288 288 288 PRO PRO A . n A 1 289 TRP 289 289 289 TRP TRP A . n A 1 290 MET 290 290 290 MET MET A . n A 1 291 GLN 291 291 291 GLN GLN A . n A 1 292 ASP 292 292 292 ASP ASP A . n A 1 293 VAL 293 293 293 VAL VAL A . n A 1 294 LEU 294 294 294 LEU LEU A . n A 1 295 LEU 295 295 295 LEU LEU A . n A 1 296 PRO 296 296 296 PRO PRO A . n A 1 297 GLN 297 297 297 GLN GLN A . n A 1 298 GLU 298 298 298 GLU GLU A . n A 1 299 THR 299 299 299 THR THR A . n A 1 300 ALA 300 300 300 ALA ALA A . n A 1 301 GLU 301 301 301 GLU GLU A . n A 1 302 ILE 302 302 302 ILE ILE A . n A 1 303 HIS 303 303 303 HIS HIS A . n A 1 304 LEU 304 304 304 LEU LEU A . n A 1 305 HIS 305 305 305 HIS HIS A . n A 1 306 SER 306 306 ? ? ? A . n A 1 307 LEU 307 307 ? ? ? A . n A 1 308 SER 308 308 ? ? ? A . n A 1 309 PRO 309 309 ? ? ? A . n A 1 310 GLY 310 310 ? ? ? A . n A 1 311 PRO 311 311 ? ? ? A . n A 1 312 SER 312 312 ? ? ? A . n A 1 313 LYS 313 313 ? ? ? A . n B 2 1 ALA 1 1 ? ? ? B . n B 2 2 ARG 2 2 2 ARG ARG B . n B 2 3 LYS 3 3 3 LYS LYS B . n B 2 4 ARG 4 4 4 ARG ARG B . n B 2 5 ARG 5 5 5 ARG ARG B . n B 2 6 ARG 6 6 6 ARG ARG B . n B 2 7 HIS 7 7 7 HIS HIS B . n B 2 8 PRO 8 8 8 PRO PRO B . n B 2 9 SER 9 9 9 SER SER B . n B 2 10 GLY 10 10 10 GLY GLY B . n B 2 11 PRO 11 11 ? ? ? B . n B 2 12 PRO 12 12 ? ? ? B . n B 2 13 THR 13 13 ? ? ? B . n B 2 14 ALA 14 14 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 8O8 1 401 1 8O8 Z72 A . D 4 HOH 1 501 121 HOH HOH A . D 4 HOH 2 502 142 HOH HOH A . D 4 HOH 3 503 80 HOH HOH A . D 4 HOH 4 504 67 HOH HOH A . D 4 HOH 5 505 56 HOH HOH A . D 4 HOH 6 506 24 HOH HOH A . D 4 HOH 7 507 117 HOH HOH A . D 4 HOH 8 508 136 HOH HOH A . D 4 HOH 9 509 139 HOH HOH A . D 4 HOH 10 510 79 HOH HOH A . D 4 HOH 11 511 107 HOH HOH A . D 4 HOH 12 512 96 HOH HOH A . D 4 HOH 13 513 7 HOH HOH A . D 4 HOH 14 514 135 HOH HOH A . D 4 HOH 15 515 114 HOH HOH A . D 4 HOH 16 516 82 HOH HOH A . D 4 HOH 17 517 12 HOH HOH A . D 4 HOH 18 518 4 HOH HOH A . D 4 HOH 19 519 35 HOH HOH A . D 4 HOH 20 520 47 HOH HOH A . D 4 HOH 21 521 64 HOH HOH A . D 4 HOH 22 522 138 HOH HOH A . D 4 HOH 23 523 29 HOH HOH A . D 4 HOH 24 524 32 HOH HOH A . D 4 HOH 25 525 31 HOH HOH A . D 4 HOH 26 526 110 HOH HOH A . D 4 HOH 27 527 70 HOH HOH A . D 4 HOH 28 528 77 HOH HOH A . D 4 HOH 29 529 133 HOH HOH A . D 4 HOH 30 530 60 HOH HOH A . D 4 HOH 31 531 38 HOH HOH A . D 4 HOH 32 532 15 HOH HOH A . D 4 HOH 33 533 27 HOH HOH A . D 4 HOH 34 534 122 HOH HOH A . D 4 HOH 35 535 120 HOH HOH A . D 4 HOH 36 536 2 HOH HOH A . D 4 HOH 37 537 113 HOH HOH A . D 4 HOH 38 538 102 HOH HOH A . D 4 HOH 39 539 3 HOH HOH A . D 4 HOH 40 540 95 HOH HOH A . D 4 HOH 41 541 25 HOH HOH A . D 4 HOH 42 542 18 HOH HOH A . D 4 HOH 43 543 111 HOH HOH A . D 4 HOH 44 544 40 HOH HOH A . D 4 HOH 45 545 34 HOH HOH A . D 4 HOH 46 546 30 HOH HOH A . D 4 HOH 47 547 17 HOH HOH A . D 4 HOH 48 548 131 HOH HOH A . D 4 HOH 49 549 9 HOH HOH A . D 4 HOH 50 550 28 HOH HOH A . D 4 HOH 51 551 97 HOH HOH A . D 4 HOH 52 552 104 HOH HOH A . D 4 HOH 53 553 1 HOH HOH A . D 4 HOH 54 554 129 HOH HOH A . D 4 HOH 55 555 55 HOH HOH A . D 4 HOH 56 556 43 HOH HOH A . D 4 HOH 57 557 45 HOH HOH A . D 4 HOH 58 558 8 HOH HOH A . D 4 HOH 59 559 106 HOH HOH A . D 4 HOH 60 560 14 HOH HOH A . D 4 HOH 61 561 86 HOH HOH A . D 4 HOH 62 562 63 HOH HOH A . D 4 HOH 63 563 52 HOH HOH A . D 4 HOH 64 564 44 HOH HOH A . D 4 HOH 65 565 23 HOH HOH A . D 4 HOH 66 566 109 HOH HOH A . D 4 HOH 67 567 74 HOH HOH A . D 4 HOH 68 568 69 HOH HOH A . D 4 HOH 69 569 127 HOH HOH A . D 4 HOH 70 570 76 HOH HOH A . D 4 HOH 71 571 85 HOH HOH A . D 4 HOH 72 572 53 HOH HOH A . D 4 HOH 73 573 116 HOH HOH A . D 4 HOH 74 574 99 HOH HOH A . D 4 HOH 75 575 100 HOH HOH A . D 4 HOH 76 576 119 HOH HOH A . D 4 HOH 77 577 90 HOH HOH A . D 4 HOH 78 578 42 HOH HOH A . D 4 HOH 79 579 10 HOH HOH A . D 4 HOH 80 580 78 HOH HOH A . D 4 HOH 81 581 68 HOH HOH A . D 4 HOH 82 582 22 HOH HOH A . D 4 HOH 83 583 91 HOH HOH A . D 4 HOH 84 584 36 HOH HOH A . D 4 HOH 85 585 51 HOH HOH A . D 4 HOH 86 586 71 HOH HOH A . D 4 HOH 87 587 115 HOH HOH A . D 4 HOH 88 588 57 HOH HOH A . D 4 HOH 89 589 128 HOH HOH A . D 4 HOH 90 590 58 HOH HOH A . D 4 HOH 91 591 130 HOH HOH A . D 4 HOH 92 592 89 HOH HOH A . D 4 HOH 93 593 126 HOH HOH A . D 4 HOH 94 594 134 HOH HOH A . D 4 HOH 95 595 87 HOH HOH A . D 4 HOH 96 596 46 HOH HOH A . D 4 HOH 97 597 98 HOH HOH A . D 4 HOH 98 598 33 HOH HOH A . D 4 HOH 99 599 26 HOH HOH A . D 4 HOH 100 600 41 HOH HOH A . D 4 HOH 101 601 141 HOH HOH A . D 4 HOH 102 602 6 HOH HOH A . D 4 HOH 103 603 72 HOH HOH A . D 4 HOH 104 604 21 HOH HOH A . D 4 HOH 105 605 11 HOH HOH A . D 4 HOH 106 606 124 HOH HOH A . D 4 HOH 107 607 88 HOH HOH A . D 4 HOH 108 608 66 HOH HOH A . D 4 HOH 109 609 132 HOH HOH A . D 4 HOH 110 610 13 HOH HOH A . D 4 HOH 111 611 19 HOH HOH A . D 4 HOH 112 612 48 HOH HOH A . D 4 HOH 113 613 54 HOH HOH A . D 4 HOH 114 614 16 HOH HOH A . D 4 HOH 115 615 140 HOH HOH A . D 4 HOH 116 616 39 HOH HOH A . D 4 HOH 117 617 137 HOH HOH A . D 4 HOH 118 618 37 HOH HOH A . D 4 HOH 119 619 81 HOH HOH A . D 4 HOH 120 620 84 HOH HOH A . D 4 HOH 121 621 83 HOH HOH A . D 4 HOH 122 622 125 HOH HOH A . D 4 HOH 123 623 94 HOH HOH A . D 4 HOH 124 624 112 HOH HOH A . D 4 HOH 125 625 118 HOH HOH A . D 4 HOH 126 626 73 HOH HOH A . D 4 HOH 127 627 93 HOH HOH A . D 4 HOH 128 628 108 HOH HOH A . D 4 HOH 129 629 101 HOH HOH A . D 4 HOH 130 630 123 HOH HOH A . D 4 HOH 131 631 105 HOH HOH A . E 4 HOH 1 101 59 HOH HOH B . E 4 HOH 2 102 65 HOH HOH B . E 4 HOH 3 103 50 HOH HOH B . E 4 HOH 4 104 92 HOH HOH B . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id SEP _pdbx_struct_mod_residue.label_seq_id 261 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id SEP _pdbx_struct_mod_residue.auth_seq_id 261 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id SER _pdbx_struct_mod_residue.details 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1160 ? 1 MORE 2 ? 1 'SSA (A^2)' 13040 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-03-07 2 'Structure model' 1 1 2019-08-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' reflns 2 2 'Structure model' reflns_shell # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_reflns.pdbx_Rrim_I_all' 2 2 'Structure model' '_reflns_shell.pdbx_Rrim_I_all' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined -86.4405 88.3425 -11.2022 0.4123 0.2925 0.3770 0.0397 0.0623 -0.0034 0.2284 0.4028 0.2452 0.2636 -0.0159 -0.0524 -0.0220 -0.0393 0.2565 -0.1645 0.0563 -0.0034 -0.2387 0.0756 0.0001 'X-RAY DIFFRACTION' 2 ? refined -92.6579 81.9271 -6.1215 0.3168 0.1836 0.2449 0.0313 0.0397 -0.0169 0.3007 0.6895 0.9064 0.0231 0.5244 0.0475 0.0188 -0.0227 0.2478 0.0262 0.1693 0.2316 -0.2950 -0.2356 0.2086 'X-RAY DIFFRACTION' 3 ? refined -88.9326 63.9215 -2.2331 0.1850 0.1795 0.1912 0.0217 -0.0131 -0.0093 0.7156 0.8482 1.6524 0.0191 -0.4176 -0.0300 0.0690 -0.0762 -0.0176 0.0109 -0.0496 -0.0255 0.0769 0.0349 -0.0000 'X-RAY DIFFRACTION' 4 ? refined -84.7211 74.1284 9.6829 0.4510 0.4007 0.3483 -0.0677 0.0142 -0.1432 0.1267 0.1781 0.0527 -0.0063 0.0787 0.0238 -0.1228 -0.2786 0.1047 -0.0308 0.2152 -0.3055 -0.0378 0.1229 0.0626 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 33 through 96 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 97 through 140 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 141 through 305 ) ; 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 2 through 10 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10.1_2155: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 60 ? ? -141.48 17.60 2 1 SER A 101 ? ? -170.43 -178.46 3 1 ASP A 167 ? ? -146.02 46.07 4 1 ASP A 186 ? ? 60.49 81.96 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A PRO 33 ? CG ? A PRO 33 CG 2 1 Y 1 A PRO 33 ? CD ? A PRO 33 CD 3 1 Y 1 A LEU 34 ? CD1 ? A LEU 34 CD1 4 1 Y 1 A LEU 34 ? CD2 ? A LEU 34 CD2 5 1 Y 1 A GLU 35 ? CG ? A GLU 35 CG 6 1 Y 1 A GLU 35 ? CD ? A GLU 35 CD 7 1 Y 1 A GLU 35 ? OE1 ? A GLU 35 OE1 8 1 Y 1 A GLU 35 ? OE2 ? A GLU 35 OE2 9 1 Y 1 A SER 36 ? OG ? A SER 36 OG 10 1 Y 1 A GLN 39 ? CD ? A GLN 39 CD 11 1 Y 1 A GLN 39 ? OE1 ? A GLN 39 OE1 12 1 Y 1 A GLN 39 ? NE2 ? A GLN 39 NE2 13 1 Y 1 A VAL 58 ? CG1 ? A VAL 58 CG1 14 1 Y 1 A VAL 58 ? CG2 ? A VAL 58 CG2 15 1 Y 1 A SER 59 ? OG ? A SER 59 OG 16 1 Y 1 A ARG 73 ? CG ? A ARG 73 CG 17 1 Y 1 A ARG 73 ? CD ? A ARG 73 CD 18 1 Y 1 A ARG 73 ? NE ? A ARG 73 NE 19 1 Y 1 A ARG 73 ? CZ ? A ARG 73 CZ 20 1 Y 1 A ARG 73 ? NH1 ? A ARG 73 NH1 21 1 Y 1 A ARG 73 ? NH2 ? A ARG 73 NH2 22 1 Y 1 A ILE 74 ? CD1 ? A ILE 74 CD1 23 1 Y 1 A SER 75 ? OG ? A SER 75 OG 24 1 Y 1 A ASP 76 ? OD1 ? A ASP 76 OD1 25 1 Y 1 A ASP 76 ? OD2 ? A ASP 76 OD2 26 1 Y 1 A GLU 79 ? CG ? A GLU 79 CG 27 1 Y 1 A GLU 79 ? CD ? A GLU 79 CD 28 1 Y 1 A GLU 79 ? OE1 ? A GLU 79 OE1 29 1 Y 1 A GLU 79 ? OE2 ? A GLU 79 OE2 30 1 Y 1 A LEU 80 ? CG ? A LEU 80 CG 31 1 Y 1 A LEU 80 ? CD1 ? A LEU 80 CD1 32 1 Y 1 A LEU 80 ? CD2 ? A LEU 80 CD2 33 1 Y 1 A PRO 81 ? CG ? A PRO 81 CG 34 1 Y 1 A PRO 81 ? CD ? A PRO 81 CD 35 1 Y 1 A ASN 82 ? OD1 ? A ASN 82 OD1 36 1 Y 1 A ASN 82 ? ND2 ? A ASN 82 ND2 37 1 Y 1 A THR 84 ? OG1 ? A THR 84 OG1 38 1 Y 1 A THR 84 ? CG2 ? A THR 84 CG2 39 1 Y 1 A ARG 85 ? CG ? A ARG 85 CG 40 1 Y 1 A ARG 85 ? CD ? A ARG 85 CD 41 1 Y 1 A ARG 85 ? NE ? A ARG 85 NE 42 1 Y 1 A ARG 85 ? CZ ? A ARG 85 CZ 43 1 Y 1 A ARG 85 ? NH1 ? A ARG 85 NH1 44 1 Y 1 A ARG 85 ? NH2 ? A ARG 85 NH2 45 1 Y 1 A LYS 94 ? CD ? A LYS 94 CD 46 1 Y 1 A LYS 94 ? CE ? A LYS 94 CE 47 1 Y 1 A LYS 94 ? NZ ? A LYS 94 NZ 48 1 Y 1 A SER 98 ? OG ? A SER 98 OG 49 1 Y 1 A PHE 100 ? CD1 ? A PHE 100 CD1 50 1 Y 1 A PHE 100 ? CE1 ? A PHE 100 CE1 51 1 Y 1 A PHE 100 ? CZ ? A PHE 100 CZ 52 1 Y 1 A ARG 105 ? CG ? A ARG 105 CG 53 1 Y 1 A ARG 105 ? CD ? A ARG 105 CD 54 1 Y 1 A ARG 105 ? NE ? A ARG 105 NE 55 1 Y 1 A ARG 105 ? CZ ? A ARG 105 CZ 56 1 Y 1 A ARG 105 ? NH1 ? A ARG 105 NH1 57 1 Y 1 A ARG 105 ? NH2 ? A ARG 105 NH2 58 1 Y 1 A LYS 183 ? NZ ? A LYS 183 NZ 59 1 Y 1 A ASP 202 ? OD1 ? A ASP 202 OD1 60 1 Y 1 A ASP 202 ? OD2 ? A ASP 202 OD2 61 1 Y 1 A GLN 252 ? OE1 ? A GLN 252 OE1 62 1 Y 1 A GLN 252 ? NE2 ? A GLN 252 NE2 63 1 Y 1 A ARG 274 ? CZ ? A ARG 274 CZ 64 1 Y 1 A ARG 274 ? NH1 ? A ARG 274 NH1 65 1 Y 1 A ARG 274 ? NH2 ? A ARG 274 NH2 66 1 Y 1 A GLN 297 ? OE1 ? A GLN 297 OE1 67 1 Y 1 A GLN 297 ? NE2 ? A GLN 297 NE2 68 1 Y 1 B LYS 3 ? CD ? B LYS 3 CD 69 1 Y 1 B LYS 3 ? CE ? B LYS 3 CE 70 1 Y 1 B LYS 3 ? NZ ? B LYS 3 NZ 71 1 Y 1 B HIS 7 ? O ? B HIS 7 O # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A LEU 2 ? A LEU 2 3 1 Y 1 A LEU 3 ? A LEU 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A LYS 5 ? A LYS 5 6 1 Y 1 A ILE 6 ? A ILE 6 7 1 Y 1 A ASN 7 ? A ASN 7 8 1 Y 1 A SER 8 ? A SER 8 9 1 Y 1 A LEU 9 ? A LEU 9 10 1 Y 1 A ALA 10 ? A ALA 10 11 1 Y 1 A HIS 11 ? A HIS 11 12 1 Y 1 A LEU 12 ? A LEU 12 13 1 Y 1 A ARG 13 ? A ARG 13 14 1 Y 1 A ALA 14 ? A ALA 14 15 1 Y 1 A ALA 15 ? A ALA 15 16 1 Y 1 A PRO 16 ? A PRO 16 17 1 Y 1 A CYS 17 ? A CYS 17 18 1 Y 1 A ASN 18 ? A ASN 18 19 1 Y 1 A ASP 19 ? A ASP 19 20 1 Y 1 A LEU 20 ? A LEU 20 21 1 Y 1 A HIS 21 ? A HIS 21 22 1 Y 1 A ALA 22 ? A ALA 22 23 1 Y 1 A THR 23 ? A THR 23 24 1 Y 1 A LYS 24 ? A LYS 24 25 1 Y 1 A LEU 25 ? A LEU 25 26 1 Y 1 A ALA 26 ? A ALA 26 27 1 Y 1 A PRO 27 ? A PRO 27 28 1 Y 1 A GLY 28 ? A GLY 28 29 1 Y 1 A LYS 29 ? A LYS 29 30 1 Y 1 A GLU 30 ? A GLU 30 31 1 Y 1 A LYS 31 ? A LYS 31 32 1 Y 1 A GLU 32 ? A GLU 32 33 1 Y 1 A SER 306 ? A SER 306 34 1 Y 1 A LEU 307 ? A LEU 307 35 1 Y 1 A SER 308 ? A SER 308 36 1 Y 1 A PRO 309 ? A PRO 309 37 1 Y 1 A GLY 310 ? A GLY 310 38 1 Y 1 A PRO 311 ? A PRO 311 39 1 Y 1 A SER 312 ? A SER 312 40 1 Y 1 A LYS 313 ? A LYS 313 41 1 Y 1 B ALA 1 ? B ALA 1 42 1 Y 1 B PRO 11 ? B PRO 11 43 1 Y 1 B PRO 12 ? B PRO 12 44 1 Y 1 B THR 13 ? B THR 13 45 1 Y 1 B ALA 14 ? B ALA 14 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 '~{N}-(isoquinolin-5-ylmethyl)-~{N}-methyl-2-[(3~{R})-pyrrolidin-3-yl]benzamide' 8O8 4 water HOH #