data_5N5W # _entry.id 5N5W # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5N5W pdb_00005n5w 10.2210/pdb5n5w/pdb WWPDB D_1200003549 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-07-19 2 'Structure model' 1 1 2017-08-09 3 'Structure model' 1 2 2024-01-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_initial_refinement_model 6 3 'Structure model' pdbx_struct_conn_angle 7 3 'Structure model' pdbx_struct_special_symmetry 8 3 'Structure model' struct_conn 9 3 'Structure model' struct_conn_type # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.title' 5 3 'Structure model' '_database_2.pdbx_DOI' 6 3 'Structure model' '_database_2.pdbx_database_accession' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_symmetry' 14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 15 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 16 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 17 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 18 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 19 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 20 3 'Structure model' '_pdbx_struct_conn_angle.value' 21 3 'Structure model' '_struct_conn.conn_type_id' 22 3 'Structure model' '_struct_conn.id' 23 3 'Structure model' '_struct_conn.pdbx_dist_value' 24 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 25 3 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 26 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 27 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 28 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 29 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 30 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 31 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 32 3 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 33 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 34 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 35 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 36 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 37 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 38 3 'Structure model' '_struct_conn.ptnr2_label_seq_id' 39 3 'Structure model' '_struct_conn.ptnr2_symmetry' 40 3 'Structure model' '_struct_conn_type.id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5N5W _pdbx_database_status.recvd_initial_deposition_date 2017-02-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Sijbesma, E.' 1 ? 'Leysen, S.' 2 ? 'Ottmann, C.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochemistry _citation.journal_id_ASTM BICHAW _citation.journal_id_CSD 0033 _citation.journal_id_ISSN 1520-4995 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 56 _citation.language ? _citation.page_first 3972 _citation.page_last 3982 _citation.title 'Identification of Two Secondary Ligand Binding Sites in 14-3-3 Proteins Using Fragment Screening.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.biochem.7b00153 _citation.pdbx_database_id_PubMed 28681606 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sijbesma, E.' 1 ? primary 'Skora, L.' 2 ? primary 'Leysen, S.' 3 ? primary 'Brunsveld, L.' 4 ? primary 'Koch, U.' 5 ? primary 'Nussbaumer, P.' 6 ? primary 'Jahnke, W.' 7 ? primary 'Ottmann, C.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '14-3-3 protein sigma' 26542.914 1 ? ? ? ? 2 polymer syn 'TAZ pS89 peptide' 1151.125 1 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 3 ? ? ? ? 4 non-polymer syn 'CHLORIDE ION' 35.453 2 ? ? ? ? 5 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 6 non-polymer syn '4-[3,5-bis(chloranyl)pyridin-2-yl]oxyaniline' 255.100 1 ? ? ? ? 7 water nat water 18.015 214 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Epithelial cell marker protein 1,Stratifin' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSE EKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAM DISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT ; ;GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSE EKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAM DISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT ; A ? 2 'polypeptide(L)' no yes 'RSH(SEP)SPASLQ' RSHSSPASLQ P ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'MAGNESIUM ION' MG 4 'CHLORIDE ION' CL 5 'CALCIUM ION' CA 6 '4-[3,5-bis(chloranyl)pyridin-2-yl]oxyaniline' 8OE 7 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 GLY n 1 5 SER n 1 6 MET n 1 7 GLU n 1 8 ARG n 1 9 ALA n 1 10 SER n 1 11 LEU n 1 12 ILE n 1 13 GLN n 1 14 LYS n 1 15 ALA n 1 16 LYS n 1 17 LEU n 1 18 ALA n 1 19 GLU n 1 20 GLN n 1 21 ALA n 1 22 GLU n 1 23 ARG n 1 24 TYR n 1 25 GLU n 1 26 ASP n 1 27 MET n 1 28 ALA n 1 29 ALA n 1 30 PHE n 1 31 MET n 1 32 LYS n 1 33 GLY n 1 34 ALA n 1 35 VAL n 1 36 GLU n 1 37 LYS n 1 38 GLY n 1 39 GLU n 1 40 GLU n 1 41 LEU n 1 42 SER n 1 43 CYS n 1 44 GLU n 1 45 GLU n 1 46 ARG n 1 47 ASN n 1 48 LEU n 1 49 LEU n 1 50 SER n 1 51 VAL n 1 52 ALA n 1 53 TYR n 1 54 LYS n 1 55 ASN n 1 56 VAL n 1 57 VAL n 1 58 GLY n 1 59 GLY n 1 60 GLN n 1 61 ARG n 1 62 ALA n 1 63 ALA n 1 64 TRP n 1 65 ARG n 1 66 VAL n 1 67 LEU n 1 68 SER n 1 69 SER n 1 70 ILE n 1 71 GLU n 1 72 GLN n 1 73 LYS n 1 74 SER n 1 75 ASN n 1 76 GLU n 1 77 GLU n 1 78 GLY n 1 79 SER n 1 80 GLU n 1 81 GLU n 1 82 LYS n 1 83 GLY n 1 84 PRO n 1 85 GLU n 1 86 VAL n 1 87 ARG n 1 88 GLU n 1 89 TYR n 1 90 ARG n 1 91 GLU n 1 92 LYS n 1 93 VAL n 1 94 GLU n 1 95 THR n 1 96 GLU n 1 97 LEU n 1 98 GLN n 1 99 GLY n 1 100 VAL n 1 101 CYS n 1 102 ASP n 1 103 THR n 1 104 VAL n 1 105 LEU n 1 106 GLY n 1 107 LEU n 1 108 LEU n 1 109 ASP n 1 110 SER n 1 111 HIS n 1 112 LEU n 1 113 ILE n 1 114 LYS n 1 115 GLU n 1 116 ALA n 1 117 GLY n 1 118 ASP n 1 119 ALA n 1 120 GLU n 1 121 SER n 1 122 ARG n 1 123 VAL n 1 124 PHE n 1 125 TYR n 1 126 LEU n 1 127 LYS n 1 128 MET n 1 129 LYS n 1 130 GLY n 1 131 ASP n 1 132 TYR n 1 133 TYR n 1 134 ARG n 1 135 TYR n 1 136 LEU n 1 137 ALA n 1 138 GLU n 1 139 VAL n 1 140 ALA n 1 141 THR n 1 142 GLY n 1 143 ASP n 1 144 ASP n 1 145 LYS n 1 146 LYS n 1 147 ARG n 1 148 ILE n 1 149 ILE n 1 150 ASP n 1 151 SER n 1 152 ALA n 1 153 ARG n 1 154 SER n 1 155 ALA n 1 156 TYR n 1 157 GLN n 1 158 GLU n 1 159 ALA n 1 160 MET n 1 161 ASP n 1 162 ILE n 1 163 SER n 1 164 LYS n 1 165 LYS n 1 166 GLU n 1 167 MET n 1 168 PRO n 1 169 PRO n 1 170 THR n 1 171 ASN n 1 172 PRO n 1 173 ILE n 1 174 ARG n 1 175 LEU n 1 176 GLY n 1 177 LEU n 1 178 ALA n 1 179 LEU n 1 180 ASN n 1 181 PHE n 1 182 SER n 1 183 VAL n 1 184 PHE n 1 185 HIS n 1 186 TYR n 1 187 GLU n 1 188 ILE n 1 189 ALA n 1 190 ASN n 1 191 SER n 1 192 PRO n 1 193 GLU n 1 194 GLU n 1 195 ALA n 1 196 ILE n 1 197 SER n 1 198 LEU n 1 199 ALA n 1 200 LYS n 1 201 THR n 1 202 THR n 1 203 PHE n 1 204 ASP n 1 205 GLU n 1 206 ALA n 1 207 MET n 1 208 ALA n 1 209 ASP n 1 210 LEU n 1 211 HIS n 1 212 THR n 1 213 LEU n 1 214 SER n 1 215 GLU n 1 216 ASP n 1 217 SER n 1 218 TYR n 1 219 LYS n 1 220 ASP n 1 221 SER n 1 222 THR n 1 223 LEU n 1 224 ILE n 1 225 MET n 1 226 GLN n 1 227 LEU n 1 228 LEU n 1 229 ARG n 1 230 ASP n 1 231 ASN n 1 232 LEU n 1 233 THR n 1 234 LEU n 1 235 TRP n 1 236 THR n 2 1 ARG n 2 2 SER n 2 3 HIS n 2 4 SEP n 2 5 SER n 2 6 PRO n 2 7 ALA n 2 8 SER n 2 9 LEU n 2 10 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 236 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SFN, HME1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 10 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name Human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 8OE non-polymer . '4-[3,5-bis(chloranyl)pyridin-2-yl]oxyaniline' ? 'C11 H8 Cl2 N2 O' 255.100 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P' 185.072 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -4 -4 GLY GLY A . n A 1 2 ALA 2 -3 -3 ALA ALA A . n A 1 3 MET 3 -2 -2 MET MET A . n A 1 4 GLY 4 -1 -1 GLY GLY A . n A 1 5 SER 5 0 0 SER SER A . n A 1 6 MET 6 1 1 MET MET A . n A 1 7 GLU 7 2 2 GLU GLU A . n A 1 8 ARG 8 3 3 ARG ARG A . n A 1 9 ALA 9 4 4 ALA ALA A . n A 1 10 SER 10 5 5 SER SER A . n A 1 11 LEU 11 6 6 LEU LEU A . n A 1 12 ILE 12 7 7 ILE ILE A . n A 1 13 GLN 13 8 8 GLN GLN A . n A 1 14 LYS 14 9 9 LYS LYS A . n A 1 15 ALA 15 10 10 ALA ALA A . n A 1 16 LYS 16 11 11 LYS LYS A . n A 1 17 LEU 17 12 12 LEU LEU A . n A 1 18 ALA 18 13 13 ALA ALA A . n A 1 19 GLU 19 14 14 GLU GLU A . n A 1 20 GLN 20 15 15 GLN GLN A . n A 1 21 ALA 21 16 16 ALA ALA A . n A 1 22 GLU 22 17 17 GLU GLU A . n A 1 23 ARG 23 18 18 ARG ARG A . n A 1 24 TYR 24 19 19 TYR TYR A . n A 1 25 GLU 25 20 20 GLU GLU A . n A 1 26 ASP 26 21 21 ASP ASP A . n A 1 27 MET 27 22 22 MET MET A . n A 1 28 ALA 28 23 23 ALA ALA A . n A 1 29 ALA 29 24 24 ALA ALA A . n A 1 30 PHE 30 25 25 PHE PHE A . n A 1 31 MET 31 26 26 MET MET A . n A 1 32 LYS 32 27 27 LYS LYS A . n A 1 33 GLY 33 28 28 GLY GLY A . n A 1 34 ALA 34 29 29 ALA ALA A . n A 1 35 VAL 35 30 30 VAL VAL A . n A 1 36 GLU 36 31 31 GLU GLU A . n A 1 37 LYS 37 32 32 LYS LYS A . n A 1 38 GLY 38 33 33 GLY GLY A . n A 1 39 GLU 39 34 34 GLU GLU A . n A 1 40 GLU 40 35 35 GLU GLU A . n A 1 41 LEU 41 36 36 LEU LEU A . n A 1 42 SER 42 37 37 SER SER A . n A 1 43 CYS 43 38 38 CYS CYS A . n A 1 44 GLU 44 39 39 GLU GLU A . n A 1 45 GLU 45 40 40 GLU GLU A . n A 1 46 ARG 46 41 41 ARG ARG A . n A 1 47 ASN 47 42 42 ASN ASN A . n A 1 48 LEU 48 43 43 LEU LEU A . n A 1 49 LEU 49 44 44 LEU LEU A . n A 1 50 SER 50 45 45 SER SER A . n A 1 51 VAL 51 46 46 VAL VAL A . n A 1 52 ALA 52 47 47 ALA ALA A . n A 1 53 TYR 53 48 48 TYR TYR A . n A 1 54 LYS 54 49 49 LYS LYS A . n A 1 55 ASN 55 50 50 ASN ASN A . n A 1 56 VAL 56 51 51 VAL VAL A . n A 1 57 VAL 57 52 52 VAL VAL A . n A 1 58 GLY 58 53 53 GLY GLY A . n A 1 59 GLY 59 54 54 GLY GLY A . n A 1 60 GLN 60 55 55 GLN GLN A . n A 1 61 ARG 61 56 56 ARG ARG A . n A 1 62 ALA 62 57 57 ALA ALA A . n A 1 63 ALA 63 58 58 ALA ALA A . n A 1 64 TRP 64 59 59 TRP TRP A . n A 1 65 ARG 65 60 60 ARG ARG A . n A 1 66 VAL 66 61 61 VAL VAL A . n A 1 67 LEU 67 62 62 LEU LEU A . n A 1 68 SER 68 63 63 SER SER A . n A 1 69 SER 69 64 64 SER SER A . n A 1 70 ILE 70 65 65 ILE ILE A . n A 1 71 GLU 71 66 66 GLU GLU A . n A 1 72 GLN 72 67 67 GLN GLN A . n A 1 73 LYS 73 68 68 LYS LYS A . n A 1 74 SER 74 69 69 SER SER A . n A 1 75 ASN 75 70 70 ASN ASN A . n A 1 76 GLU 76 71 ? ? ? A . n A 1 77 GLU 77 72 ? ? ? A . n A 1 78 GLY 78 73 ? ? ? A . n A 1 79 SER 79 74 ? ? ? A . n A 1 80 GLU 80 75 ? ? ? A . n A 1 81 GLU 81 76 ? ? ? A . n A 1 82 LYS 82 77 ? ? ? A . n A 1 83 GLY 83 78 78 GLY GLY A . n A 1 84 PRO 84 79 79 PRO PRO A . n A 1 85 GLU 85 80 80 GLU GLU A . n A 1 86 VAL 86 81 81 VAL VAL A . n A 1 87 ARG 87 82 82 ARG ARG A . n A 1 88 GLU 88 83 83 GLU GLU A . n A 1 89 TYR 89 84 84 TYR TYR A . n A 1 90 ARG 90 85 85 ARG ARG A . n A 1 91 GLU 91 86 86 GLU GLU A . n A 1 92 LYS 92 87 87 LYS LYS A . n A 1 93 VAL 93 88 88 VAL VAL A . n A 1 94 GLU 94 89 89 GLU GLU A . n A 1 95 THR 95 90 90 THR THR A . n A 1 96 GLU 96 91 91 GLU GLU A . n A 1 97 LEU 97 92 92 LEU LEU A . n A 1 98 GLN 98 93 93 GLN GLN A . n A 1 99 GLY 99 94 94 GLY GLY A . n A 1 100 VAL 100 95 95 VAL VAL A . n A 1 101 CYS 101 96 96 CYS CYS A . n A 1 102 ASP 102 97 97 ASP ASP A . n A 1 103 THR 103 98 98 THR THR A . n A 1 104 VAL 104 99 99 VAL VAL A . n A 1 105 LEU 105 100 100 LEU LEU A . n A 1 106 GLY 106 101 101 GLY GLY A . n A 1 107 LEU 107 102 102 LEU LEU A . n A 1 108 LEU 108 103 103 LEU LEU A . n A 1 109 ASP 109 104 104 ASP ASP A . n A 1 110 SER 110 105 105 SER SER A . n A 1 111 HIS 111 106 106 HIS HIS A . n A 1 112 LEU 112 107 107 LEU LEU A . n A 1 113 ILE 113 108 108 ILE ILE A . n A 1 114 LYS 114 109 109 LYS LYS A . n A 1 115 GLU 115 110 110 GLU GLU A . n A 1 116 ALA 116 111 111 ALA ALA A . n A 1 117 GLY 117 112 112 GLY GLY A . n A 1 118 ASP 118 113 113 ASP ASP A . n A 1 119 ALA 119 114 114 ALA ALA A . n A 1 120 GLU 120 115 115 GLU GLU A . n A 1 121 SER 121 116 116 SER SER A . n A 1 122 ARG 122 117 117 ARG ARG A . n A 1 123 VAL 123 118 118 VAL VAL A . n A 1 124 PHE 124 119 119 PHE PHE A . n A 1 125 TYR 125 120 120 TYR TYR A . n A 1 126 LEU 126 121 121 LEU LEU A . n A 1 127 LYS 127 122 122 LYS LYS A . n A 1 128 MET 128 123 123 MET MET A . n A 1 129 LYS 129 124 124 LYS LYS A . n A 1 130 GLY 130 125 125 GLY GLY A . n A 1 131 ASP 131 126 126 ASP ASP A . n A 1 132 TYR 132 127 127 TYR TYR A . n A 1 133 TYR 133 128 128 TYR TYR A . n A 1 134 ARG 134 129 129 ARG ARG A . n A 1 135 TYR 135 130 130 TYR TYR A . n A 1 136 LEU 136 131 131 LEU LEU A . n A 1 137 ALA 137 132 132 ALA ALA A . n A 1 138 GLU 138 133 133 GLU GLU A . n A 1 139 VAL 139 134 134 VAL VAL A . n A 1 140 ALA 140 135 135 ALA ALA A . n A 1 141 THR 141 136 136 THR THR A . n A 1 142 GLY 142 137 137 GLY GLY A . n A 1 143 ASP 143 138 138 ASP ASP A . n A 1 144 ASP 144 139 139 ASP ASP A . n A 1 145 LYS 145 140 140 LYS LYS A . n A 1 146 LYS 146 141 141 LYS LYS A . n A 1 147 ARG 147 142 142 ARG ARG A . n A 1 148 ILE 148 143 143 ILE ILE A . n A 1 149 ILE 149 144 144 ILE ILE A . n A 1 150 ASP 150 145 145 ASP ASP A . n A 1 151 SER 151 146 146 SER SER A . n A 1 152 ALA 152 147 147 ALA ALA A . n A 1 153 ARG 153 148 148 ARG ARG A . n A 1 154 SER 154 149 149 SER SER A . n A 1 155 ALA 155 150 150 ALA ALA A . n A 1 156 TYR 156 151 151 TYR TYR A . n A 1 157 GLN 157 152 152 GLN GLN A . n A 1 158 GLU 158 153 153 GLU GLU A . n A 1 159 ALA 159 154 154 ALA ALA A . n A 1 160 MET 160 155 155 MET MET A . n A 1 161 ASP 161 156 156 ASP ASP A . n A 1 162 ILE 162 157 157 ILE ILE A . n A 1 163 SER 163 158 158 SER SER A . n A 1 164 LYS 164 159 159 LYS LYS A . n A 1 165 LYS 165 160 160 LYS LYS A . n A 1 166 GLU 166 161 161 GLU GLU A . n A 1 167 MET 167 162 162 MET MET A . n A 1 168 PRO 168 163 163 PRO PRO A . n A 1 169 PRO 169 164 164 PRO PRO A . n A 1 170 THR 170 165 165 THR THR A . n A 1 171 ASN 171 166 166 ASN ASN A . n A 1 172 PRO 172 167 167 PRO PRO A . n A 1 173 ILE 173 168 168 ILE ILE A . n A 1 174 ARG 174 169 169 ARG ARG A . n A 1 175 LEU 175 170 170 LEU LEU A . n A 1 176 GLY 176 171 171 GLY GLY A . n A 1 177 LEU 177 172 172 LEU LEU A . n A 1 178 ALA 178 173 173 ALA ALA A . n A 1 179 LEU 179 174 174 LEU LEU A . n A 1 180 ASN 180 175 175 ASN ASN A . n A 1 181 PHE 181 176 176 PHE PHE A . n A 1 182 SER 182 177 177 SER SER A . n A 1 183 VAL 183 178 178 VAL VAL A . n A 1 184 PHE 184 179 179 PHE PHE A . n A 1 185 HIS 185 180 180 HIS HIS A . n A 1 186 TYR 186 181 181 TYR TYR A . n A 1 187 GLU 187 182 182 GLU GLU A . n A 1 188 ILE 188 183 183 ILE ILE A . n A 1 189 ALA 189 184 184 ALA ALA A . n A 1 190 ASN 190 185 185 ASN ASN A . n A 1 191 SER 191 186 186 SER SER A . n A 1 192 PRO 192 187 187 PRO PRO A . n A 1 193 GLU 193 188 188 GLU GLU A . n A 1 194 GLU 194 189 189 GLU GLU A . n A 1 195 ALA 195 190 190 ALA ALA A . n A 1 196 ILE 196 191 191 ILE ILE A . n A 1 197 SER 197 192 192 SER SER A . n A 1 198 LEU 198 193 193 LEU LEU A . n A 1 199 ALA 199 194 194 ALA ALA A . n A 1 200 LYS 200 195 195 LYS LYS A . n A 1 201 THR 201 196 196 THR THR A . n A 1 202 THR 202 197 197 THR THR A . n A 1 203 PHE 203 198 198 PHE PHE A . n A 1 204 ASP 204 199 199 ASP ASP A . n A 1 205 GLU 205 200 200 GLU GLU A . n A 1 206 ALA 206 201 201 ALA ALA A . n A 1 207 MET 207 202 202 MET MET A . n A 1 208 ALA 208 203 203 ALA ALA A . n A 1 209 ASP 209 204 204 ASP ASP A . n A 1 210 LEU 210 205 205 LEU LEU A . n A 1 211 HIS 211 206 206 HIS HIS A . n A 1 212 THR 212 207 207 THR THR A . n A 1 213 LEU 213 208 208 LEU LEU A . n A 1 214 SER 214 209 209 SER SER A . n A 1 215 GLU 215 210 210 GLU GLU A . n A 1 216 ASP 216 211 211 ASP ASP A . n A 1 217 SER 217 212 212 SER SER A . n A 1 218 TYR 218 213 213 TYR TYR A . n A 1 219 LYS 219 214 214 LYS LYS A . n A 1 220 ASP 220 215 215 ASP ASP A . n A 1 221 SER 221 216 216 SER SER A . n A 1 222 THR 222 217 217 THR THR A . n A 1 223 LEU 223 218 218 LEU LEU A . n A 1 224 ILE 224 219 219 ILE ILE A . n A 1 225 MET 225 220 220 MET MET A . n A 1 226 GLN 226 221 221 GLN GLN A . n A 1 227 LEU 227 222 222 LEU LEU A . n A 1 228 LEU 228 223 223 LEU LEU A . n A 1 229 ARG 229 224 224 ARG ARG A . n A 1 230 ASP 230 225 225 ASP ASP A . n A 1 231 ASN 231 226 226 ASN ASN A . n A 1 232 LEU 232 227 227 LEU LEU A . n A 1 233 THR 233 228 228 THR THR A . n A 1 234 LEU 234 229 229 LEU LEU A . n A 1 235 TRP 235 230 230 TRP TRP A . n A 1 236 THR 236 231 231 THR THR A . n B 2 1 ARG 1 86 86 ARG ARG P . n B 2 2 SER 2 87 87 SER SER P . n B 2 3 HIS 3 88 88 HIS HIS P . n B 2 4 SEP 4 89 89 SEP SEP P . n B 2 5 SER 5 90 90 SER SER P . n B 2 6 PRO 6 91 91 PRO PRO P . n B 2 7 ALA 7 92 92 ALA ALA P . n B 2 8 SER 8 93 93 SER SER P . n B 2 9 LEU 9 94 94 LEU LEU P . n B 2 10 GLN 10 95 95 GLN GLN P . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 MG 1 301 232 MG MG A . D 3 MG 1 302 233 MG MG A . E 4 CL 1 303 235 CL CL A . F 4 CL 1 304 236 CL CL A . G 5 CA 1 305 239 CA CA A . H 3 MG 1 306 240 MG MG A . I 6 8OE 1 307 1 8OE NV3 A . J 7 HOH 1 401 216 HOH HOH A . J 7 HOH 2 402 158 HOH HOH A . J 7 HOH 3 403 166 HOH HOH A . J 7 HOH 4 404 189 HOH HOH A . J 7 HOH 5 405 157 HOH HOH A . J 7 HOH 6 406 229 HOH HOH A . J 7 HOH 7 407 161 HOH HOH A . J 7 HOH 8 408 313 HOH HOH A . J 7 HOH 9 409 191 HOH HOH A . J 7 HOH 10 410 165 HOH HOH A . J 7 HOH 11 411 94 HOH HOH A . J 7 HOH 12 412 159 HOH HOH A . J 7 HOH 13 413 333 HOH HOH A . J 7 HOH 14 414 139 HOH HOH A . J 7 HOH 15 415 132 HOH HOH A . J 7 HOH 16 416 228 HOH HOH A . J 7 HOH 17 417 116 HOH HOH A . J 7 HOH 18 418 214 HOH HOH A . J 7 HOH 19 419 40 HOH HOH A . J 7 HOH 20 420 57 HOH HOH A . J 7 HOH 21 421 27 HOH HOH A . J 7 HOH 22 422 98 HOH HOH A . J 7 HOH 23 423 156 HOH HOH A . J 7 HOH 24 424 21 HOH HOH A . J 7 HOH 25 425 63 HOH HOH A . J 7 HOH 26 426 4 HOH HOH A . J 7 HOH 27 427 122 HOH HOH A . J 7 HOH 28 428 55 HOH HOH A . J 7 HOH 29 429 86 HOH HOH A . J 7 HOH 30 430 11 HOH HOH A . J 7 HOH 31 431 203 HOH HOH A . J 7 HOH 32 432 38 HOH HOH A . J 7 HOH 33 433 6 HOH HOH A . J 7 HOH 34 434 99 HOH HOH A . J 7 HOH 35 435 8 HOH HOH A . J 7 HOH 36 436 36 HOH HOH A . J 7 HOH 37 437 175 HOH HOH A . J 7 HOH 38 438 167 HOH HOH A . J 7 HOH 39 439 100 HOH HOH A . J 7 HOH 40 440 59 HOH HOH A . J 7 HOH 41 441 245 HOH HOH A . J 7 HOH 42 442 1 HOH HOH A . J 7 HOH 43 443 80 HOH HOH A . J 7 HOH 44 444 18 HOH HOH A . J 7 HOH 45 445 24 HOH HOH A . J 7 HOH 46 446 50 HOH HOH A . J 7 HOH 47 447 136 HOH HOH A . J 7 HOH 48 448 150 HOH HOH A . J 7 HOH 49 449 45 HOH HOH A . J 7 HOH 50 450 47 HOH HOH A . J 7 HOH 51 451 2 HOH HOH A . J 7 HOH 52 452 14 HOH HOH A . J 7 HOH 53 453 328 HOH HOH A . J 7 HOH 54 454 140 HOH HOH A . J 7 HOH 55 455 44 HOH HOH A . J 7 HOH 56 456 287 HOH HOH A . J 7 HOH 57 457 17 HOH HOH A . J 7 HOH 58 458 160 HOH HOH A . J 7 HOH 59 459 20 HOH HOH A . J 7 HOH 60 460 299 HOH HOH A . J 7 HOH 61 461 78 HOH HOH A . J 7 HOH 62 462 141 HOH HOH A . J 7 HOH 63 463 12 HOH HOH A . J 7 HOH 64 464 155 HOH HOH A . J 7 HOH 65 465 64 HOH HOH A . J 7 HOH 66 466 288 HOH HOH A . J 7 HOH 67 467 42 HOH HOH A . J 7 HOH 68 468 226 HOH HOH A . J 7 HOH 69 469 127 HOH HOH A . J 7 HOH 70 470 53 HOH HOH A . J 7 HOH 71 471 107 HOH HOH A . J 7 HOH 72 472 184 HOH HOH A . J 7 HOH 73 473 30 HOH HOH A . J 7 HOH 74 474 9 HOH HOH A . J 7 HOH 75 475 69 HOH HOH A . J 7 HOH 76 476 32 HOH HOH A . J 7 HOH 77 477 71 HOH HOH A . J 7 HOH 78 478 39 HOH HOH A . J 7 HOH 79 479 109 HOH HOH A . J 7 HOH 80 480 96 HOH HOH A . J 7 HOH 81 481 29 HOH HOH A . J 7 HOH 82 482 66 HOH HOH A . J 7 HOH 83 483 241 HOH HOH A . J 7 HOH 84 484 35 HOH HOH A . J 7 HOH 85 485 320 HOH HOH A . J 7 HOH 86 486 220 HOH HOH A . J 7 HOH 87 487 16 HOH HOH A . J 7 HOH 88 488 62 HOH HOH A . J 7 HOH 89 489 7 HOH HOH A . J 7 HOH 90 490 26 HOH HOH A . J 7 HOH 91 491 318 HOH HOH A . J 7 HOH 92 492 67 HOH HOH A . J 7 HOH 93 493 211 HOH HOH A . J 7 HOH 94 494 77 HOH HOH A . J 7 HOH 95 495 134 HOH HOH A . J 7 HOH 96 496 23 HOH HOH A . J 7 HOH 97 497 25 HOH HOH A . J 7 HOH 98 498 195 HOH HOH A . J 7 HOH 99 499 51 HOH HOH A . J 7 HOH 100 500 76 HOH HOH A . J 7 HOH 101 501 33 HOH HOH A . J 7 HOH 102 502 15 HOH HOH A . J 7 HOH 103 503 31 HOH HOH A . J 7 HOH 104 504 149 HOH HOH A . J 7 HOH 105 505 49 HOH HOH A . J 7 HOH 106 506 88 HOH HOH A . J 7 HOH 107 507 168 HOH HOH A . J 7 HOH 108 508 148 HOH HOH A . J 7 HOH 109 509 70 HOH HOH A . J 7 HOH 110 510 54 HOH HOH A . J 7 HOH 111 511 75 HOH HOH A . J 7 HOH 112 512 187 HOH HOH A . J 7 HOH 113 513 291 HOH HOH A . J 7 HOH 114 514 188 HOH HOH A . J 7 HOH 115 515 65 HOH HOH A . J 7 HOH 116 516 170 HOH HOH A . J 7 HOH 117 517 10 HOH HOH A . J 7 HOH 118 518 82 HOH HOH A . J 7 HOH 119 519 125 HOH HOH A . J 7 HOH 120 520 68 HOH HOH A . J 7 HOH 121 521 46 HOH HOH A . J 7 HOH 122 522 5 HOH HOH A . J 7 HOH 123 523 194 HOH HOH A . J 7 HOH 124 524 146 HOH HOH A . J 7 HOH 125 525 92 HOH HOH A . J 7 HOH 126 526 37 HOH HOH A . J 7 HOH 127 527 112 HOH HOH A . J 7 HOH 128 528 143 HOH HOH A . J 7 HOH 129 529 153 HOH HOH A . J 7 HOH 130 530 72 HOH HOH A . J 7 HOH 131 531 135 HOH HOH A . J 7 HOH 132 532 85 HOH HOH A . J 7 HOH 133 533 152 HOH HOH A . J 7 HOH 134 534 93 HOH HOH A . J 7 HOH 135 535 223 HOH HOH A . J 7 HOH 136 536 19 HOH HOH A . J 7 HOH 137 537 13 HOH HOH A . J 7 HOH 138 538 205 HOH HOH A . J 7 HOH 139 539 83 HOH HOH A . J 7 HOH 140 540 87 HOH HOH A . J 7 HOH 141 541 130 HOH HOH A . J 7 HOH 142 542 105 HOH HOH A . J 7 HOH 143 543 235 HOH HOH A . J 7 HOH 144 544 74 HOH HOH A . J 7 HOH 145 545 147 HOH HOH A . J 7 HOH 146 546 201 HOH HOH A . J 7 HOH 147 547 177 HOH HOH A . J 7 HOH 148 548 232 HOH HOH A . J 7 HOH 149 549 61 HOH HOH A . J 7 HOH 150 550 60 HOH HOH A . J 7 HOH 151 551 111 HOH HOH A . J 7 HOH 152 552 193 HOH HOH A . J 7 HOH 153 553 142 HOH HOH A . J 7 HOH 154 554 113 HOH HOH A . J 7 HOH 155 555 327 HOH HOH A . J 7 HOH 156 556 325 HOH HOH A . J 7 HOH 157 557 163 HOH HOH A . J 7 HOH 158 558 315 HOH HOH A . J 7 HOH 159 559 114 HOH HOH A . J 7 HOH 160 560 145 HOH HOH A . J 7 HOH 161 561 247 HOH HOH A . J 7 HOH 162 562 34 HOH HOH A . J 7 HOH 163 563 128 HOH HOH A . J 7 HOH 164 564 22 HOH HOH A . J 7 HOH 165 565 162 HOH HOH A . J 7 HOH 166 566 118 HOH HOH A . J 7 HOH 167 567 186 HOH HOH A . J 7 HOH 168 568 48 HOH HOH A . J 7 HOH 169 569 169 HOH HOH A . J 7 HOH 170 570 129 HOH HOH A . J 7 HOH 171 571 180 HOH HOH A . J 7 HOH 172 572 133 HOH HOH A . J 7 HOH 173 573 89 HOH HOH A . J 7 HOH 174 574 97 HOH HOH A . J 7 HOH 175 575 329 HOH HOH A . J 7 HOH 176 576 101 HOH HOH A . J 7 HOH 177 577 137 HOH HOH A . J 7 HOH 178 578 171 HOH HOH A . J 7 HOH 179 579 81 HOH HOH A . J 7 HOH 180 580 176 HOH HOH A . J 7 HOH 181 581 79 HOH HOH A . J 7 HOH 182 582 121 HOH HOH A . J 7 HOH 183 583 164 HOH HOH A . J 7 HOH 184 584 123 HOH HOH A . J 7 HOH 185 585 316 HOH HOH A . J 7 HOH 186 586 108 HOH HOH A . J 7 HOH 187 587 120 HOH HOH A . J 7 HOH 188 588 56 HOH HOH A . J 7 HOH 189 589 237 HOH HOH A . J 7 HOH 190 590 227 HOH HOH A . J 7 HOH 191 591 248 HOH HOH A . J 7 HOH 192 592 138 HOH HOH A . J 7 HOH 193 593 183 HOH HOH A . J 7 HOH 194 594 106 HOH HOH A . J 7 HOH 195 595 251 HOH HOH A . J 7 HOH 196 596 212 HOH HOH A . J 7 HOH 197 597 319 HOH HOH A . K 7 HOH 1 101 104 HOH HOH P . K 7 HOH 2 102 95 HOH HOH P . K 7 HOH 3 103 206 HOH HOH P . K 7 HOH 4 104 221 HOH HOH P . K 7 HOH 5 105 43 HOH HOH P . K 7 HOH 6 106 192 HOH HOH P . K 7 HOH 7 107 3 HOH HOH P . K 7 HOH 8 108 144 HOH HOH P . K 7 HOH 9 109 330 HOH HOH P . K 7 HOH 10 110 90 HOH HOH P . K 7 HOH 11 111 73 HOH HOH P . K 7 HOH 12 112 58 HOH HOH P . K 7 HOH 13 113 154 HOH HOH P . K 7 HOH 14 114 52 HOH HOH P . K 7 HOH 15 115 326 HOH HOH P . K 7 HOH 16 116 210 HOH HOH P . K 7 HOH 17 117 239 HOH HOH P . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.5.23 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.11.1_2575 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5N5W _cell.details ? _cell.formula_units_Z ? _cell.length_a 81.293 _cell.length_a_esd ? _cell.length_b 112.286 _cell.length_b_esd ? _cell.length_c 62.506 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5N5W _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5N5W _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.58 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 52.24 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.1 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.095 M Na-HEPES pH 7.1, 28% PEG400, 0.19 M Calcium chloride, 5% Glycerol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 80 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-04-18 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.033 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PETRA III, DESY BEAMLINE P11' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.033 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline P11 _diffrn_source.pdbx_synchrotron_site 'PETRA III, DESY' # _reflns.B_iso_Wilson_estimate 14.220 _reflns.entry_id 5N5W _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.370 _reflns.d_resolution_low 65.850 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 60317 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 13.100 _reflns.pdbx_Rmerge_I_obs 0.072 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 20.700 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects 2 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.075 _reflns.pdbx_Rpim_I_all 0.021 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 788177 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.370 1.390 ? ? ? ? ? ? ? 100.000 ? ? ? ? 1.348 ? ? ? ? ? ? ? ? 13.000 ? ? ? ? 1.403 0.387 ? 1 1 0.756 ? 7.500 65.850 ? ? ? ? ? ? ? 99.700 ? ? ? ? 0.035 ? ? ? ? ? ? ? ? 12.300 ? ? ? ? 0.036 0.010 ? 2 1 1.000 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 77.820 _refine.B_iso_mean 19.9013 _refine.B_iso_min 9.910 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5N5W _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.3700 _refine.ls_d_res_low 45.3340 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 60289 _refine.ls_number_reflns_R_free 3044 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9900 _refine.ls_percent_reflns_R_free 5.0500 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1447 _refine.ls_R_factor_R_free 0.1651 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1436 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3MHR _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 15.2100 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1100 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.3700 _refine_hist.d_res_low 45.3340 _refine_hist.pdbx_number_atoms_ligand 30 _refine_hist.number_atoms_solvent 214 _refine_hist.number_atoms_total 2124 _refine_hist.pdbx_number_residues_total 239 _refine_hist.pdbx_B_iso_mean_ligand 26.91 _refine_hist.pdbx_B_iso_mean_solvent 27.74 _refine_hist.pdbx_number_atoms_protein 1880 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? 2036 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.859 ? 2754 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.058 ? 298 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 360 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 20.551 ? 808 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.3700 1.3914 2700 . 132 2568 100.0000 . . . 0.2597 0.0000 0.1958 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 1.3914 1.4142 2710 . 125 2585 100.0000 . . . 0.2165 0.0000 0.1780 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 1.4142 1.4386 2703 . 124 2579 100.0000 . . . 0.2305 0.0000 0.1619 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 1.4386 1.4648 2701 . 141 2560 100.0000 . . . 0.1896 0.0000 0.1511 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 1.4648 1.4929 2702 . 140 2562 100.0000 . . . 0.1838 0.0000 0.1369 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 1.4929 1.5234 2727 . 141 2586 100.0000 . . . 0.2026 0.0000 0.1313 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 1.5234 1.5566 2726 . 133 2593 100.0000 . . . 0.1557 0.0000 0.1274 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 1.5566 1.5928 2700 . 133 2567 100.0000 . . . 0.1635 0.0000 0.1161 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 1.5928 1.6326 2734 . 136 2598 100.0000 . . . 0.1743 0.0000 0.1077 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 1.6326 1.6767 2707 . 148 2559 100.0000 . . . 0.1540 0.0000 0.1045 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 1.6767 1.7261 2736 . 138 2598 100.0000 . . . 0.1482 0.0000 0.1058 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 1.7261 1.7818 2728 . 134 2594 100.0000 . . . 0.1656 0.0000 0.1120 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 1.7818 1.8455 2714 . 130 2584 100.0000 . . . 0.1478 0.0000 0.1129 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 1.8455 1.9194 2747 . 147 2600 100.0000 . . . 0.1651 0.0000 0.1233 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 1.9194 2.0067 2730 . 136 2594 100.0000 . . . 0.1534 0.0000 0.1265 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 2.0067 2.1125 2746 . 133 2613 100.0000 . . . 0.1510 0.0000 0.1268 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 2.1125 2.2449 2755 . 160 2595 100.0000 . . . 0.1590 0.0000 0.1229 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 2.2449 2.4182 2740 . 139 2601 100.0000 . . . 0.1329 0.0000 0.1272 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 2.4182 2.6615 2773 . 156 2617 100.0000 . . . 0.1764 0.0000 0.1411 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 2.6615 3.0466 2776 . 120 2656 100.0000 . . . 0.1668 0.0000 0.1624 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 3.0466 3.8381 2815 . 148 2667 100.0000 . . . 0.1702 0.0000 0.1638 . . . . . . 22 . . . 'X-RAY DIFFRACTION' 3.8381 45.3585 2919 . 150 2769 100.0000 . . . 0.1625 0.0000 0.1719 . . . . . . 22 . . . # _struct.entry_id 5N5W _struct.title '14-3-3 sigma in complex with TAZ pS89 peptide and fragment NV3' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5N5W _struct_keywords.text '14-3-3, TAZ, fragment, FBDD, protein binding' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 4 ? G N N 5 ? H N N 3 ? I N N 6 ? J N N 7 ? K N N 7 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP 1433S_HUMAN P31947 ? 1 ;MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPE VREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKK EMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT ; 1 2 PDB 5N5W 5N5W ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5N5W A 6 ? 236 ? P31947 1 ? 231 ? 1 231 2 2 5N5W P 1 ? 10 ? 5N5W 86 ? 95 ? 86 95 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5N5W GLY A 1 ? UNP P31947 ? ? 'expression tag' -4 1 1 5N5W ALA A 2 ? UNP P31947 ? ? 'expression tag' -3 2 1 5N5W MET A 3 ? UNP P31947 ? ? 'expression tag' -2 3 1 5N5W GLY A 4 ? UNP P31947 ? ? 'expression tag' -1 4 1 5N5W SER A 5 ? UNP P31947 ? ? 'expression tag' 0 5 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6420 ? 1 MORE -116 ? 1 'SSA (A^2)' 22180 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 7 ? ALA A 21 ? GLU A 2 ALA A 16 1 ? 15 HELX_P HELX_P2 AA2 ARG A 23 ? LYS A 37 ? ARG A 18 LYS A 32 1 ? 15 HELX_P HELX_P3 AA3 SER A 42 ? ASN A 75 ? SER A 37 ASN A 70 1 ? 34 HELX_P HELX_P4 AA4 PRO A 84 ? SER A 110 ? PRO A 79 SER A 105 1 ? 27 HELX_P HELX_P5 AA5 HIS A 111 ? ALA A 116 ? HIS A 106 ALA A 111 1 ? 6 HELX_P HELX_P6 AA6 ASP A 118 ? ALA A 140 ? ASP A 113 ALA A 135 1 ? 23 HELX_P HELX_P7 AA7 ASP A 144 ? MET A 167 ? ASP A 139 MET A 162 1 ? 24 HELX_P HELX_P8 AA8 ASN A 171 ? ILE A 188 ? ASN A 166 ILE A 183 1 ? 18 HELX_P HELX_P9 AA9 SER A 191 ? ALA A 208 ? SER A 186 ALA A 203 1 ? 18 HELX_P HELX_P10 AB1 ASP A 209 ? LEU A 213 ? ASP A 204 LEU A 208 5 ? 5 HELX_P HELX_P11 AB2 SER A 214 ? THR A 236 ? SER A 209 THR A 231 1 ? 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B HIS 3 C ? ? ? 1_555 B SEP 4 N ? ? P HIS 88 P SEP 89 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale2 covale both ? B SEP 4 C ? ? ? 1_555 B SER 5 N ? ? P SEP 89 P SER 90 1_555 ? ? ? ? ? ? ? 1.324 ? ? metalc1 metalc ? ? A GLU 7 OE1 ? ? ? 1_555 D MG . MG ? ? A GLU 2 A MG 302 1_555 ? ? ? ? ? ? ? 2.353 ? ? metalc2 metalc ? ? A GLU 7 OE1 ? ? ? 1_555 D MG . MG ? ? A GLU 2 A MG 302 3_655 ? ? ? ? ? ? ? 2.467 ? ? metalc3 metalc ? ? A GLN 13 OE1 ? ? ? 1_555 H MG . MG ? ? A GLN 8 A MG 306 1_555 ? ? ? ? ? ? ? 2.687 ? ? metalc4 metalc ? ? A GLU 40 OE1 ? ? ? 1_555 G CA . CA ? ? A GLU 35 A CA 305 6_545 ? ? ? ? ? ? ? 2.267 ? ? metalc5 metalc ? ? A GLU 40 OE2 ? ? ? 1_555 G CA . CA ? ? A GLU 35 A CA 305 6_545 ? ? ? ? ? ? ? 2.847 ? ? metalc6 metalc ? ? A GLU 85 OE1 ? ? ? 1_555 H MG . MG ? ? A GLU 80 A MG 306 4_555 ? ? ? ? ? ? ? 2.441 ? ? metalc7 metalc ? ? A GLU 115 O ? ? ? 1_555 G CA . CA ? ? A GLU 110 A CA 305 6_545 ? ? ? ? ? ? ? 2.270 ? ? metalc8 metalc ? ? A GLU 166 O ? ? ? 1_555 C MG . MG ? ? A GLU 161 A MG 301 7_544 ? ? ? ? ? ? ? 2.245 ? ? metalc9 metalc ? ? A GLU 193 OE2 ? ? ? 1_555 G CA . CA ? ? A GLU 188 A CA 305 1_555 ? ? ? ? ? ? ? 2.316 ? ? metalc10 metalc ? ? D MG . MG ? ? ? 1_555 J HOH . O ? ? A MG 302 A HOH 412 1_555 ? ? ? ? ? ? ? 2.416 ? ? metalc11 metalc ? ? D MG . MG ? ? ? 1_555 J HOH . O ? ? A MG 302 A HOH 412 3_655 ? ? ? ? ? ? ? 2.668 ? ? metalc12 metalc ? ? G CA . CA ? ? ? 1_555 J HOH . O ? ? A CA 305 A HOH 438 1_555 ? ? ? ? ? ? ? 2.265 ? ? metalc13 metalc ? ? G CA . CA ? ? ? 1_555 J HOH . O ? ? A CA 305 A HOH 557 1_555 ? ? ? ? ? ? ? 2.402 ? ? metalc14 metalc ? ? G CA . CA ? ? ? 1_555 J HOH . O ? ? A CA 305 A HOH 583 1_555 ? ? ? ? ? ? ? 2.350 ? ? metalc15 metalc ? ? H MG . MG ? ? ? 1_555 J HOH . O ? ? A MG 306 A HOH 593 1_555 ? ? ? ? ? ? ? 2.482 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 0.0 ? 2 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? J HOH . ? A HOH 412 ? 1_555 80.8 ? 3 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? J HOH . ? A HOH 412 ? 1_555 80.8 ? 4 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? J HOH . ? A HOH 412 ? 3_655 78.5 ? 5 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? J HOH . ? A HOH 412 ? 3_655 78.5 ? 6 O ? J HOH . ? A HOH 412 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? J HOH . ? A HOH 412 ? 3_655 148.7 ? 7 OE1 ? A GLN 13 ? A GLN 8 ? 1_555 MG ? H MG . ? A MG 306 ? 1_555 OE1 ? A GLU 85 ? A GLU 80 ? 1_555 28.9 ? 8 OE1 ? A GLN 13 ? A GLN 8 ? 1_555 MG ? H MG . ? A MG 306 ? 1_555 O ? J HOH . ? A HOH 593 ? 1_555 149.8 ? 9 OE1 ? A GLU 85 ? A GLU 80 ? 1_555 MG ? H MG . ? A MG 306 ? 1_555 O ? J HOH . ? A HOH 593 ? 1_555 174.2 ? 10 OE1 ? A GLU 40 ? A GLU 35 ? 1_555 CA ? G CA . ? A CA 305 ? 6_545 OE2 ? A GLU 40 ? A GLU 35 ? 1_555 49.0 ? 11 OE1 ? A GLU 40 ? A GLU 35 ? 1_555 CA ? G CA . ? A CA 305 ? 6_545 O ? A GLU 115 ? A GLU 110 ? 1_555 86.6 ? 12 OE2 ? A GLU 40 ? A GLU 35 ? 1_555 CA ? G CA . ? A CA 305 ? 6_545 O ? A GLU 115 ? A GLU 110 ? 1_555 89.5 ? 13 OE1 ? A GLU 40 ? A GLU 35 ? 1_555 CA ? G CA . ? A CA 305 ? 6_545 OE2 ? A GLU 193 ? A GLU 188 ? 1_555 119.3 ? 14 OE2 ? A GLU 40 ? A GLU 35 ? 1_555 CA ? G CA . ? A CA 305 ? 6_545 OE2 ? A GLU 193 ? A GLU 188 ? 1_555 90.0 ? 15 O ? A GLU 115 ? A GLU 110 ? 1_555 CA ? G CA . ? A CA 305 ? 6_545 OE2 ? A GLU 193 ? A GLU 188 ? 1_555 44.6 ? 16 OE1 ? A GLU 40 ? A GLU 35 ? 1_555 CA ? G CA . ? A CA 305 ? 6_545 O ? J HOH . ? A HOH 438 ? 1_555 117.1 ? 17 OE2 ? A GLU 40 ? A GLU 35 ? 1_555 CA ? G CA . ? A CA 305 ? 6_545 O ? J HOH . ? A HOH 438 ? 1_555 87.2 ? 18 O ? A GLU 115 ? A GLU 110 ? 1_555 CA ? G CA . ? A CA 305 ? 6_545 O ? J HOH . ? A HOH 438 ? 1_555 44.4 ? 19 OE2 ? A GLU 193 ? A GLU 188 ? 1_555 CA ? G CA . ? A CA 305 ? 6_545 O ? J HOH . ? A HOH 438 ? 1_555 2.8 ? 20 OE1 ? A GLU 40 ? A GLU 35 ? 1_555 CA ? G CA . ? A CA 305 ? 6_545 O ? J HOH . ? A HOH 557 ? 1_555 117.6 ? 21 OE2 ? A GLU 40 ? A GLU 35 ? 1_555 CA ? G CA . ? A CA 305 ? 6_545 O ? J HOH . ? A HOH 557 ? 1_555 85.6 ? 22 O ? A GLU 115 ? A GLU 110 ? 1_555 CA ? G CA . ? A CA 305 ? 6_545 O ? J HOH . ? A HOH 557 ? 1_555 47.3 ? 23 OE2 ? A GLU 193 ? A GLU 188 ? 1_555 CA ? G CA . ? A CA 305 ? 6_545 O ? J HOH . ? A HOH 557 ? 1_555 5.1 ? 24 O ? J HOH . ? A HOH 438 ? 1_555 CA ? G CA . ? A CA 305 ? 6_545 O ? J HOH . ? A HOH 557 ? 1_555 3.2 ? 25 OE1 ? A GLU 40 ? A GLU 35 ? 1_555 CA ? G CA . ? A CA 305 ? 6_545 O ? J HOH . ? A HOH 583 ? 1_555 119.4 ? 26 OE2 ? A GLU 40 ? A GLU 35 ? 1_555 CA ? G CA . ? A CA 305 ? 6_545 O ? J HOH . ? A HOH 583 ? 1_555 87.0 ? 27 O ? A GLU 115 ? A GLU 110 ? 1_555 CA ? G CA . ? A CA 305 ? 6_545 O ? J HOH . ? A HOH 583 ? 1_555 48.2 ? 28 OE2 ? A GLU 193 ? A GLU 188 ? 1_555 CA ? G CA . ? A CA 305 ? 6_545 O ? J HOH . ? A HOH 583 ? 1_555 4.6 ? 29 O ? J HOH . ? A HOH 438 ? 1_555 CA ? G CA . ? A CA 305 ? 6_545 O ? J HOH . ? A HOH 583 ? 1_555 3.8 ? 30 O ? J HOH . ? A HOH 557 ? 1_555 CA ? G CA . ? A CA 305 ? 6_545 O ? J HOH . ? A HOH 583 ? 1_555 1.8 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 110 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 105 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 HIS _struct_mon_prot_cis.pdbx_label_seq_id_2 111 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 HIS _struct_mon_prot_cis.pdbx_auth_seq_id_2 106 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 8.50 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MG 301 ? 1 'binding site for residue MG A 301' AC2 Software A MG 302 ? 4 'binding site for residue MG A 302' AC3 Software A CL 303 ? 3 'binding site for residue CL A 303' AC4 Software A CL 304 ? 3 'binding site for residue CL A 304' AC5 Software A CA 305 ? 6 'binding site for residue CA A 305' AC6 Software A MG 306 ? 3 'binding site for residue MG A 306' AC7 Software A 8OE 307 ? 7 'binding site for residue 8OE A 307' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 1 GLU A 166 ? GLU A 161 . ? 7_554 ? 2 AC2 4 GLU A 7 ? GLU A 2 . ? 1_555 ? 3 AC2 4 GLU A 7 ? GLU A 2 . ? 3_655 ? 4 AC2 4 HOH J . ? HOH A 412 . ? 3_655 ? 5 AC2 4 HOH J . ? HOH A 412 . ? 1_555 ? 6 AC3 3 LYS A 14 ? LYS A 9 . ? 4_555 ? 7 AC3 3 HOH J . ? HOH A 549 . ? 1_555 ? 8 AC3 3 HOH J . ? HOH A 573 . ? 1_555 ? 9 AC4 3 LYS A 129 ? LYS A 124 . ? 1_555 ? 10 AC4 3 ALA A 155 ? ALA A 150 . ? 1_555 ? 11 AC4 3 HOH J . ? HOH A 464 . ? 1_555 ? 12 AC5 6 GLU A 40 ? GLU A 35 . ? 6_544 ? 13 AC5 6 GLU A 115 ? GLU A 110 . ? 6_544 ? 14 AC5 6 GLU A 193 ? GLU A 188 . ? 1_555 ? 15 AC5 6 HOH J . ? HOH A 438 . ? 1_555 ? 16 AC5 6 HOH J . ? HOH A 557 . ? 1_555 ? 17 AC5 6 HOH J . ? HOH A 583 . ? 1_555 ? 18 AC6 3 GLN A 13 ? GLN A 8 . ? 1_555 ? 19 AC6 3 GLU A 85 ? GLU A 80 . ? 4_555 ? 20 AC6 3 HOH J . ? HOH A 593 . ? 1_555 ? 21 AC7 7 GLU A 39 ? GLU A 34 . ? 6_544 ? 22 AC7 7 LYS A 200 ? LYS A 195 . ? 1_555 ? 23 AC7 7 PHE A 203 ? PHE A 198 . ? 1_555 ? 24 AC7 7 ARG A 229 ? ARG A 224 . ? 1_555 ? 25 AC7 7 ARG A 229 ? ARG A 224 . ? 3_554 ? 26 AC7 7 THR A 236 ? THR A 231 . ? 1_555 ? 27 AC7 7 HOH J . ? HOH A 506 . ? 6_544 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 18 ? ? -104.49 76.38 2 1 HIS A 106 ? ? -145.52 36.93 3 1 THR A 136 ? ? -140.13 -6.09 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id MG _pdbx_struct_special_symmetry.auth_seq_id 302 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id MG _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 71 ? A GLU 76 2 1 Y 1 A GLU 72 ? A GLU 77 3 1 Y 1 A GLY 73 ? A GLY 78 4 1 Y 1 A SER 74 ? A SER 79 5 1 Y 1 A GLU 75 ? A GLU 80 6 1 Y 1 A GLU 76 ? A GLU 81 7 1 Y 1 A LYS 77 ? A LYS 82 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 8OE C02 C Y N 1 8OE C03 C Y N 2 8OE C04 C Y N 3 8OE C05 C Y N 4 8OE C06 C Y N 5 8OE C07 C Y N 6 8OE C09 C Y N 7 8OE C11 C Y N 8 8OE C12 C Y N 9 8OE C14 C Y N 10 8OE C15 C Y N 11 8OE N01 N N N 12 8OE N10 N Y N 13 8OE O08 O N N 14 8OE CL1 CL N N 15 8OE CL2 CL N N 16 8OE H031 H N N 17 8OE H041 H N N 18 8OE H061 H N N 19 8OE H071 H N N 20 8OE H111 H N N 21 8OE H141 H N N 22 8OE H012 H N N 23 8OE H011 H N N 24 ALA N N N N 25 ALA CA C N S 26 ALA C C N N 27 ALA O O N N 28 ALA CB C N N 29 ALA OXT O N N 30 ALA H H N N 31 ALA H2 H N N 32 ALA HA H N N 33 ALA HB1 H N N 34 ALA HB2 H N N 35 ALA HB3 H N N 36 ALA HXT H N N 37 ARG N N N N 38 ARG CA C N S 39 ARG C C N N 40 ARG O O N N 41 ARG CB C N N 42 ARG CG C N N 43 ARG CD C N N 44 ARG NE N N N 45 ARG CZ C N N 46 ARG NH1 N N N 47 ARG NH2 N N N 48 ARG OXT O N N 49 ARG H H N N 50 ARG H2 H N N 51 ARG HA H N N 52 ARG HB2 H N N 53 ARG HB3 H N N 54 ARG HG2 H N N 55 ARG HG3 H N N 56 ARG HD2 H N N 57 ARG HD3 H N N 58 ARG HE H N N 59 ARG HH11 H N N 60 ARG HH12 H N N 61 ARG HH21 H N N 62 ARG HH22 H N N 63 ARG HXT H N N 64 ASN N N N N 65 ASN CA C N S 66 ASN C C N N 67 ASN O O N N 68 ASN CB C N N 69 ASN CG C N N 70 ASN OD1 O N N 71 ASN ND2 N N N 72 ASN OXT O N N 73 ASN H H N N 74 ASN H2 H N N 75 ASN HA H N N 76 ASN HB2 H N N 77 ASN HB3 H N N 78 ASN HD21 H N N 79 ASN HD22 H N N 80 ASN HXT H N N 81 ASP N N N N 82 ASP CA C N S 83 ASP C C N N 84 ASP O O N N 85 ASP CB C N N 86 ASP CG C N N 87 ASP OD1 O N N 88 ASP OD2 O N N 89 ASP OXT O N N 90 ASP H H N N 91 ASP H2 H N N 92 ASP HA H N N 93 ASP HB2 H N N 94 ASP HB3 H N N 95 ASP HD2 H N N 96 ASP HXT H N N 97 CA CA CA N N 98 CL CL CL N N 99 CYS N N N N 100 CYS CA C N R 101 CYS C C N N 102 CYS O O N N 103 CYS CB C N N 104 CYS SG S N N 105 CYS OXT O N N 106 CYS H H N N 107 CYS H2 H N N 108 CYS HA H N N 109 CYS HB2 H N N 110 CYS HB3 H N N 111 CYS HG H N N 112 CYS HXT H N N 113 GLN N N N N 114 GLN CA C N S 115 GLN C C N N 116 GLN O O N N 117 GLN CB C N N 118 GLN CG C N N 119 GLN CD C N N 120 GLN OE1 O N N 121 GLN NE2 N N N 122 GLN OXT O N N 123 GLN H H N N 124 GLN H2 H N N 125 GLN HA H N N 126 GLN HB2 H N N 127 GLN HB3 H N N 128 GLN HG2 H N N 129 GLN HG3 H N N 130 GLN HE21 H N N 131 GLN HE22 H N N 132 GLN HXT H N N 133 GLU N N N N 134 GLU CA C N S 135 GLU C C N N 136 GLU O O N N 137 GLU CB C N N 138 GLU CG C N N 139 GLU CD C N N 140 GLU OE1 O N N 141 GLU OE2 O N N 142 GLU OXT O N N 143 GLU H H N N 144 GLU H2 H N N 145 GLU HA H N N 146 GLU HB2 H N N 147 GLU HB3 H N N 148 GLU HG2 H N N 149 GLU HG3 H N N 150 GLU HE2 H N N 151 GLU HXT H N N 152 GLY N N N N 153 GLY CA C N N 154 GLY C C N N 155 GLY O O N N 156 GLY OXT O N N 157 GLY H H N N 158 GLY H2 H N N 159 GLY HA2 H N N 160 GLY HA3 H N N 161 GLY HXT H N N 162 HIS N N N N 163 HIS CA C N S 164 HIS C C N N 165 HIS O O N N 166 HIS CB C N N 167 HIS CG C Y N 168 HIS ND1 N Y N 169 HIS CD2 C Y N 170 HIS CE1 C Y N 171 HIS NE2 N Y N 172 HIS OXT O N N 173 HIS H H N N 174 HIS H2 H N N 175 HIS HA H N N 176 HIS HB2 H N N 177 HIS HB3 H N N 178 HIS HD1 H N N 179 HIS HD2 H N N 180 HIS HE1 H N N 181 HIS HE2 H N N 182 HIS HXT H N N 183 HOH O O N N 184 HOH H1 H N N 185 HOH H2 H N N 186 ILE N N N N 187 ILE CA C N S 188 ILE C C N N 189 ILE O O N N 190 ILE CB C N S 191 ILE CG1 C N N 192 ILE CG2 C N N 193 ILE CD1 C N N 194 ILE OXT O N N 195 ILE H H N N 196 ILE H2 H N N 197 ILE HA H N N 198 ILE HB H N N 199 ILE HG12 H N N 200 ILE HG13 H N N 201 ILE HG21 H N N 202 ILE HG22 H N N 203 ILE HG23 H N N 204 ILE HD11 H N N 205 ILE HD12 H N N 206 ILE HD13 H N N 207 ILE HXT H N N 208 LEU N N N N 209 LEU CA C N S 210 LEU C C N N 211 LEU O O N N 212 LEU CB C N N 213 LEU CG C N N 214 LEU CD1 C N N 215 LEU CD2 C N N 216 LEU OXT O N N 217 LEU H H N N 218 LEU H2 H N N 219 LEU HA H N N 220 LEU HB2 H N N 221 LEU HB3 H N N 222 LEU HG H N N 223 LEU HD11 H N N 224 LEU HD12 H N N 225 LEU HD13 H N N 226 LEU HD21 H N N 227 LEU HD22 H N N 228 LEU HD23 H N N 229 LEU HXT H N N 230 LYS N N N N 231 LYS CA C N S 232 LYS C C N N 233 LYS O O N N 234 LYS CB C N N 235 LYS CG C N N 236 LYS CD C N N 237 LYS CE C N N 238 LYS NZ N N N 239 LYS OXT O N N 240 LYS H H N N 241 LYS H2 H N N 242 LYS HA H N N 243 LYS HB2 H N N 244 LYS HB3 H N N 245 LYS HG2 H N N 246 LYS HG3 H N N 247 LYS HD2 H N N 248 LYS HD3 H N N 249 LYS HE2 H N N 250 LYS HE3 H N N 251 LYS HZ1 H N N 252 LYS HZ2 H N N 253 LYS HZ3 H N N 254 LYS HXT H N N 255 MET N N N N 256 MET CA C N S 257 MET C C N N 258 MET O O N N 259 MET CB C N N 260 MET CG C N N 261 MET SD S N N 262 MET CE C N N 263 MET OXT O N N 264 MET H H N N 265 MET H2 H N N 266 MET HA H N N 267 MET HB2 H N N 268 MET HB3 H N N 269 MET HG2 H N N 270 MET HG3 H N N 271 MET HE1 H N N 272 MET HE2 H N N 273 MET HE3 H N N 274 MET HXT H N N 275 MG MG MG N N 276 PHE N N N N 277 PHE CA C N S 278 PHE C C N N 279 PHE O O N N 280 PHE CB C N N 281 PHE CG C Y N 282 PHE CD1 C Y N 283 PHE CD2 C Y N 284 PHE CE1 C Y N 285 PHE CE2 C Y N 286 PHE CZ C Y N 287 PHE OXT O N N 288 PHE H H N N 289 PHE H2 H N N 290 PHE HA H N N 291 PHE HB2 H N N 292 PHE HB3 H N N 293 PHE HD1 H N N 294 PHE HD2 H N N 295 PHE HE1 H N N 296 PHE HE2 H N N 297 PHE HZ H N N 298 PHE HXT H N N 299 PRO N N N N 300 PRO CA C N S 301 PRO C C N N 302 PRO O O N N 303 PRO CB C N N 304 PRO CG C N N 305 PRO CD C N N 306 PRO OXT O N N 307 PRO H H N N 308 PRO HA H N N 309 PRO HB2 H N N 310 PRO HB3 H N N 311 PRO HG2 H N N 312 PRO HG3 H N N 313 PRO HD2 H N N 314 PRO HD3 H N N 315 PRO HXT H N N 316 SEP N N N N 317 SEP CA C N S 318 SEP CB C N N 319 SEP OG O N N 320 SEP C C N N 321 SEP O O N N 322 SEP OXT O N N 323 SEP P P N N 324 SEP O1P O N N 325 SEP O2P O N N 326 SEP O3P O N N 327 SEP H H N N 328 SEP H2 H N N 329 SEP HA H N N 330 SEP HB2 H N N 331 SEP HB3 H N N 332 SEP HXT H N N 333 SEP HOP2 H N N 334 SEP HOP3 H N N 335 SER N N N N 336 SER CA C N S 337 SER C C N N 338 SER O O N N 339 SER CB C N N 340 SER OG O N N 341 SER OXT O N N 342 SER H H N N 343 SER H2 H N N 344 SER HA H N N 345 SER HB2 H N N 346 SER HB3 H N N 347 SER HG H N N 348 SER HXT H N N 349 THR N N N N 350 THR CA C N S 351 THR C C N N 352 THR O O N N 353 THR CB C N R 354 THR OG1 O N N 355 THR CG2 C N N 356 THR OXT O N N 357 THR H H N N 358 THR H2 H N N 359 THR HA H N N 360 THR HB H N N 361 THR HG1 H N N 362 THR HG21 H N N 363 THR HG22 H N N 364 THR HG23 H N N 365 THR HXT H N N 366 TRP N N N N 367 TRP CA C N S 368 TRP C C N N 369 TRP O O N N 370 TRP CB C N N 371 TRP CG C Y N 372 TRP CD1 C Y N 373 TRP CD2 C Y N 374 TRP NE1 N Y N 375 TRP CE2 C Y N 376 TRP CE3 C Y N 377 TRP CZ2 C Y N 378 TRP CZ3 C Y N 379 TRP CH2 C Y N 380 TRP OXT O N N 381 TRP H H N N 382 TRP H2 H N N 383 TRP HA H N N 384 TRP HB2 H N N 385 TRP HB3 H N N 386 TRP HD1 H N N 387 TRP HE1 H N N 388 TRP HE3 H N N 389 TRP HZ2 H N N 390 TRP HZ3 H N N 391 TRP HH2 H N N 392 TRP HXT H N N 393 TYR N N N N 394 TYR CA C N S 395 TYR C C N N 396 TYR O O N N 397 TYR CB C N N 398 TYR CG C Y N 399 TYR CD1 C Y N 400 TYR CD2 C Y N 401 TYR CE1 C Y N 402 TYR CE2 C Y N 403 TYR CZ C Y N 404 TYR OH O N N 405 TYR OXT O N N 406 TYR H H N N 407 TYR H2 H N N 408 TYR HA H N N 409 TYR HB2 H N N 410 TYR HB3 H N N 411 TYR HD1 H N N 412 TYR HD2 H N N 413 TYR HE1 H N N 414 TYR HE2 H N N 415 TYR HH H N N 416 TYR HXT H N N 417 VAL N N N N 418 VAL CA C N S 419 VAL C C N N 420 VAL O O N N 421 VAL CB C N N 422 VAL CG1 C N N 423 VAL CG2 C N N 424 VAL OXT O N N 425 VAL H H N N 426 VAL H2 H N N 427 VAL HA H N N 428 VAL HB H N N 429 VAL HG11 H N N 430 VAL HG12 H N N 431 VAL HG13 H N N 432 VAL HG21 H N N 433 VAL HG22 H N N 434 VAL HG23 H N N 435 VAL HXT H N N 436 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 8OE N01 C02 sing N N 1 8OE C02 C03 doub Y N 2 8OE C02 C07 sing Y N 3 8OE C03 C04 sing Y N 4 8OE C07 C06 doub Y N 5 8OE C04 C05 doub Y N 6 8OE C06 C05 sing Y N 7 8OE C05 O08 sing N N 8 8OE O08 C09 sing N N 9 8OE C09 N10 doub Y N 10 8OE C09 C15 sing Y N 11 8OE CL2 C15 sing N N 12 8OE N10 C11 sing Y N 13 8OE C15 C14 doub Y N 14 8OE C11 C12 doub Y N 15 8OE C14 C12 sing Y N 16 8OE C12 CL1 sing N N 17 8OE C03 H031 sing N N 18 8OE C04 H041 sing N N 19 8OE C06 H061 sing N N 20 8OE C07 H071 sing N N 21 8OE C11 H111 sing N N 22 8OE C14 H141 sing N N 23 8OE N01 H012 sing N N 24 8OE N01 H011 sing N N 25 ALA N CA sing N N 26 ALA N H sing N N 27 ALA N H2 sing N N 28 ALA CA C sing N N 29 ALA CA CB sing N N 30 ALA CA HA sing N N 31 ALA C O doub N N 32 ALA C OXT sing N N 33 ALA CB HB1 sing N N 34 ALA CB HB2 sing N N 35 ALA CB HB3 sing N N 36 ALA OXT HXT sing N N 37 ARG N CA sing N N 38 ARG N H sing N N 39 ARG N H2 sing N N 40 ARG CA C sing N N 41 ARG CA CB sing N N 42 ARG CA HA sing N N 43 ARG C O doub N N 44 ARG C OXT sing N N 45 ARG CB CG sing N N 46 ARG CB HB2 sing N N 47 ARG CB HB3 sing N N 48 ARG CG CD sing N N 49 ARG CG HG2 sing N N 50 ARG CG HG3 sing N N 51 ARG CD NE sing N N 52 ARG CD HD2 sing N N 53 ARG CD HD3 sing N N 54 ARG NE CZ sing N N 55 ARG NE HE sing N N 56 ARG CZ NH1 sing N N 57 ARG CZ NH2 doub N N 58 ARG NH1 HH11 sing N N 59 ARG NH1 HH12 sing N N 60 ARG NH2 HH21 sing N N 61 ARG NH2 HH22 sing N N 62 ARG OXT HXT sing N N 63 ASN N CA sing N N 64 ASN N H sing N N 65 ASN N H2 sing N N 66 ASN CA C sing N N 67 ASN CA CB sing N N 68 ASN CA HA sing N N 69 ASN C O doub N N 70 ASN C OXT sing N N 71 ASN CB CG sing N N 72 ASN CB HB2 sing N N 73 ASN CB HB3 sing N N 74 ASN CG OD1 doub N N 75 ASN CG ND2 sing N N 76 ASN ND2 HD21 sing N N 77 ASN ND2 HD22 sing N N 78 ASN OXT HXT sing N N 79 ASP N CA sing N N 80 ASP N H sing N N 81 ASP N H2 sing N N 82 ASP CA C sing N N 83 ASP CA CB sing N N 84 ASP CA HA sing N N 85 ASP C O doub N N 86 ASP C OXT sing N N 87 ASP CB CG sing N N 88 ASP CB HB2 sing N N 89 ASP CB HB3 sing N N 90 ASP CG OD1 doub N N 91 ASP CG OD2 sing N N 92 ASP OD2 HD2 sing N N 93 ASP OXT HXT sing N N 94 CYS N CA sing N N 95 CYS N H sing N N 96 CYS N H2 sing N N 97 CYS CA C sing N N 98 CYS CA CB sing N N 99 CYS CA HA sing N N 100 CYS C O doub N N 101 CYS C OXT sing N N 102 CYS CB SG sing N N 103 CYS CB HB2 sing N N 104 CYS CB HB3 sing N N 105 CYS SG HG sing N N 106 CYS OXT HXT sing N N 107 GLN N CA sing N N 108 GLN N H sing N N 109 GLN N H2 sing N N 110 GLN CA C sing N N 111 GLN CA CB sing N N 112 GLN CA HA sing N N 113 GLN C O doub N N 114 GLN C OXT sing N N 115 GLN CB CG sing N N 116 GLN CB HB2 sing N N 117 GLN CB HB3 sing N N 118 GLN CG CD sing N N 119 GLN CG HG2 sing N N 120 GLN CG HG3 sing N N 121 GLN CD OE1 doub N N 122 GLN CD NE2 sing N N 123 GLN NE2 HE21 sing N N 124 GLN NE2 HE22 sing N N 125 GLN OXT HXT sing N N 126 GLU N CA sing N N 127 GLU N H sing N N 128 GLU N H2 sing N N 129 GLU CA C sing N N 130 GLU CA CB sing N N 131 GLU CA HA sing N N 132 GLU C O doub N N 133 GLU C OXT sing N N 134 GLU CB CG sing N N 135 GLU CB HB2 sing N N 136 GLU CB HB3 sing N N 137 GLU CG CD sing N N 138 GLU CG HG2 sing N N 139 GLU CG HG3 sing N N 140 GLU CD OE1 doub N N 141 GLU CD OE2 sing N N 142 GLU OE2 HE2 sing N N 143 GLU OXT HXT sing N N 144 GLY N CA sing N N 145 GLY N H sing N N 146 GLY N H2 sing N N 147 GLY CA C sing N N 148 GLY CA HA2 sing N N 149 GLY CA HA3 sing N N 150 GLY C O doub N N 151 GLY C OXT sing N N 152 GLY OXT HXT sing N N 153 HIS N CA sing N N 154 HIS N H sing N N 155 HIS N H2 sing N N 156 HIS CA C sing N N 157 HIS CA CB sing N N 158 HIS CA HA sing N N 159 HIS C O doub N N 160 HIS C OXT sing N N 161 HIS CB CG sing N N 162 HIS CB HB2 sing N N 163 HIS CB HB3 sing N N 164 HIS CG ND1 sing Y N 165 HIS CG CD2 doub Y N 166 HIS ND1 CE1 doub Y N 167 HIS ND1 HD1 sing N N 168 HIS CD2 NE2 sing Y N 169 HIS CD2 HD2 sing N N 170 HIS CE1 NE2 sing Y N 171 HIS CE1 HE1 sing N N 172 HIS NE2 HE2 sing N N 173 HIS OXT HXT sing N N 174 HOH O H1 sing N N 175 HOH O H2 sing N N 176 ILE N CA sing N N 177 ILE N H sing N N 178 ILE N H2 sing N N 179 ILE CA C sing N N 180 ILE CA CB sing N N 181 ILE CA HA sing N N 182 ILE C O doub N N 183 ILE C OXT sing N N 184 ILE CB CG1 sing N N 185 ILE CB CG2 sing N N 186 ILE CB HB sing N N 187 ILE CG1 CD1 sing N N 188 ILE CG1 HG12 sing N N 189 ILE CG1 HG13 sing N N 190 ILE CG2 HG21 sing N N 191 ILE CG2 HG22 sing N N 192 ILE CG2 HG23 sing N N 193 ILE CD1 HD11 sing N N 194 ILE CD1 HD12 sing N N 195 ILE CD1 HD13 sing N N 196 ILE OXT HXT sing N N 197 LEU N CA sing N N 198 LEU N H sing N N 199 LEU N H2 sing N N 200 LEU CA C sing N N 201 LEU CA CB sing N N 202 LEU CA HA sing N N 203 LEU C O doub N N 204 LEU C OXT sing N N 205 LEU CB CG sing N N 206 LEU CB HB2 sing N N 207 LEU CB HB3 sing N N 208 LEU CG CD1 sing N N 209 LEU CG CD2 sing N N 210 LEU CG HG sing N N 211 LEU CD1 HD11 sing N N 212 LEU CD1 HD12 sing N N 213 LEU CD1 HD13 sing N N 214 LEU CD2 HD21 sing N N 215 LEU CD2 HD22 sing N N 216 LEU CD2 HD23 sing N N 217 LEU OXT HXT sing N N 218 LYS N CA sing N N 219 LYS N H sing N N 220 LYS N H2 sing N N 221 LYS CA C sing N N 222 LYS CA CB sing N N 223 LYS CA HA sing N N 224 LYS C O doub N N 225 LYS C OXT sing N N 226 LYS CB CG sing N N 227 LYS CB HB2 sing N N 228 LYS CB HB3 sing N N 229 LYS CG CD sing N N 230 LYS CG HG2 sing N N 231 LYS CG HG3 sing N N 232 LYS CD CE sing N N 233 LYS CD HD2 sing N N 234 LYS CD HD3 sing N N 235 LYS CE NZ sing N N 236 LYS CE HE2 sing N N 237 LYS CE HE3 sing N N 238 LYS NZ HZ1 sing N N 239 LYS NZ HZ2 sing N N 240 LYS NZ HZ3 sing N N 241 LYS OXT HXT sing N N 242 MET N CA sing N N 243 MET N H sing N N 244 MET N H2 sing N N 245 MET CA C sing N N 246 MET CA CB sing N N 247 MET CA HA sing N N 248 MET C O doub N N 249 MET C OXT sing N N 250 MET CB CG sing N N 251 MET CB HB2 sing N N 252 MET CB HB3 sing N N 253 MET CG SD sing N N 254 MET CG HG2 sing N N 255 MET CG HG3 sing N N 256 MET SD CE sing N N 257 MET CE HE1 sing N N 258 MET CE HE2 sing N N 259 MET CE HE3 sing N N 260 MET OXT HXT sing N N 261 PHE N CA sing N N 262 PHE N H sing N N 263 PHE N H2 sing N N 264 PHE CA C sing N N 265 PHE CA CB sing N N 266 PHE CA HA sing N N 267 PHE C O doub N N 268 PHE C OXT sing N N 269 PHE CB CG sing N N 270 PHE CB HB2 sing N N 271 PHE CB HB3 sing N N 272 PHE CG CD1 doub Y N 273 PHE CG CD2 sing Y N 274 PHE CD1 CE1 sing Y N 275 PHE CD1 HD1 sing N N 276 PHE CD2 CE2 doub Y N 277 PHE CD2 HD2 sing N N 278 PHE CE1 CZ doub Y N 279 PHE CE1 HE1 sing N N 280 PHE CE2 CZ sing Y N 281 PHE CE2 HE2 sing N N 282 PHE CZ HZ sing N N 283 PHE OXT HXT sing N N 284 PRO N CA sing N N 285 PRO N CD sing N N 286 PRO N H sing N N 287 PRO CA C sing N N 288 PRO CA CB sing N N 289 PRO CA HA sing N N 290 PRO C O doub N N 291 PRO C OXT sing N N 292 PRO CB CG sing N N 293 PRO CB HB2 sing N N 294 PRO CB HB3 sing N N 295 PRO CG CD sing N N 296 PRO CG HG2 sing N N 297 PRO CG HG3 sing N N 298 PRO CD HD2 sing N N 299 PRO CD HD3 sing N N 300 PRO OXT HXT sing N N 301 SEP N CA sing N N 302 SEP N H sing N N 303 SEP N H2 sing N N 304 SEP CA CB sing N N 305 SEP CA C sing N N 306 SEP CA HA sing N N 307 SEP CB OG sing N N 308 SEP CB HB2 sing N N 309 SEP CB HB3 sing N N 310 SEP OG P sing N N 311 SEP C O doub N N 312 SEP C OXT sing N N 313 SEP OXT HXT sing N N 314 SEP P O1P doub N N 315 SEP P O2P sing N N 316 SEP P O3P sing N N 317 SEP O2P HOP2 sing N N 318 SEP O3P HOP3 sing N N 319 SER N CA sing N N 320 SER N H sing N N 321 SER N H2 sing N N 322 SER CA C sing N N 323 SER CA CB sing N N 324 SER CA HA sing N N 325 SER C O doub N N 326 SER C OXT sing N N 327 SER CB OG sing N N 328 SER CB HB2 sing N N 329 SER CB HB3 sing N N 330 SER OG HG sing N N 331 SER OXT HXT sing N N 332 THR N CA sing N N 333 THR N H sing N N 334 THR N H2 sing N N 335 THR CA C sing N N 336 THR CA CB sing N N 337 THR CA HA sing N N 338 THR C O doub N N 339 THR C OXT sing N N 340 THR CB OG1 sing N N 341 THR CB CG2 sing N N 342 THR CB HB sing N N 343 THR OG1 HG1 sing N N 344 THR CG2 HG21 sing N N 345 THR CG2 HG22 sing N N 346 THR CG2 HG23 sing N N 347 THR OXT HXT sing N N 348 TRP N CA sing N N 349 TRP N H sing N N 350 TRP N H2 sing N N 351 TRP CA C sing N N 352 TRP CA CB sing N N 353 TRP CA HA sing N N 354 TRP C O doub N N 355 TRP C OXT sing N N 356 TRP CB CG sing N N 357 TRP CB HB2 sing N N 358 TRP CB HB3 sing N N 359 TRP CG CD1 doub Y N 360 TRP CG CD2 sing Y N 361 TRP CD1 NE1 sing Y N 362 TRP CD1 HD1 sing N N 363 TRP CD2 CE2 doub Y N 364 TRP CD2 CE3 sing Y N 365 TRP NE1 CE2 sing Y N 366 TRP NE1 HE1 sing N N 367 TRP CE2 CZ2 sing Y N 368 TRP CE3 CZ3 doub Y N 369 TRP CE3 HE3 sing N N 370 TRP CZ2 CH2 doub Y N 371 TRP CZ2 HZ2 sing N N 372 TRP CZ3 CH2 sing Y N 373 TRP CZ3 HZ3 sing N N 374 TRP CH2 HH2 sing N N 375 TRP OXT HXT sing N N 376 TYR N CA sing N N 377 TYR N H sing N N 378 TYR N H2 sing N N 379 TYR CA C sing N N 380 TYR CA CB sing N N 381 TYR CA HA sing N N 382 TYR C O doub N N 383 TYR C OXT sing N N 384 TYR CB CG sing N N 385 TYR CB HB2 sing N N 386 TYR CB HB3 sing N N 387 TYR CG CD1 doub Y N 388 TYR CG CD2 sing Y N 389 TYR CD1 CE1 sing Y N 390 TYR CD1 HD1 sing N N 391 TYR CD2 CE2 doub Y N 392 TYR CD2 HD2 sing N N 393 TYR CE1 CZ doub Y N 394 TYR CE1 HE1 sing N N 395 TYR CE2 CZ sing Y N 396 TYR CE2 HE2 sing N N 397 TYR CZ OH sing N N 398 TYR OH HH sing N N 399 TYR OXT HXT sing N N 400 VAL N CA sing N N 401 VAL N H sing N N 402 VAL N H2 sing N N 403 VAL CA C sing N N 404 VAL CA CB sing N N 405 VAL CA HA sing N N 406 VAL C O doub N N 407 VAL C OXT sing N N 408 VAL CB CG1 sing N N 409 VAL CB CG2 sing N N 410 VAL CB HB sing N N 411 VAL CG1 HG11 sing N N 412 VAL CG1 HG12 sing N N 413 VAL CG1 HG13 sing N N 414 VAL CG2 HG21 sing N N 415 VAL CG2 HG22 sing N N 416 VAL CG2 HG23 sing N N 417 VAL OXT HXT sing N N 418 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3MHR _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 5N5W _atom_sites.fract_transf_matrix[1][1] 0.012301 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008906 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015998 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CA CL H MG N O P S # loop_