data_5N9S # _entry.id 5N9S # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.283 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5N9S WWPDB D_1200003739 # _pdbx_database_related.db_name PDB _pdbx_database_related.details 'structure determined under related experimental conditions' _pdbx_database_related.db_id 5N7V _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5N9S _pdbx_database_status.recvd_initial_deposition_date 2017-02-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Uitdehaag, J.' 1 ? 'Willemsen-Seegers, N.' 2 ? 'de Man, J.' 3 ? 'Buijsman, R.C.' 4 ? 'Zaman, G.J.R.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Mol. Biol.' _citation.journal_id_ASTM JMOBAK _citation.journal_id_CSD 0070 _citation.journal_id_ISSN 1089-8638 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 429 _citation.language ? _citation.page_first 2211 _citation.page_last 2230 _citation.title 'Target Residence Time-Guided Optimization on TTK Kinase Results in Inhibitors with Potent Anti-Proliferative Activity.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jmb.2017.05.014 _citation.pdbx_database_id_PubMed 28539250 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Uitdehaag, J.C.M.' 1 primary 'de Man, J.' 2 primary 'Willemsen-Seegers, N.' 3 primary 'Prinsen, M.B.W.' 4 primary 'Libouban, M.A.A.' 5 primary 'Sterrenburg, J.G.' 6 primary 'de Wit, J.J.P.' 7 primary 'de Vetter, J.R.F.' 8 primary 'de Roos, J.A.D.M.' 9 primary 'Buijsman, R.C.' 10 primary 'Zaman, G.J.R.' 11 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5N9S _cell.details ? _cell.formula_units_Z ? _cell.length_a 71.580 _cell.length_a_esd ? _cell.length_b 112.180 _cell.length_b_esd ? _cell.length_c 113.850 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5N9S _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Dual specificity protein kinase TTK' 36211.277 1 2.7.12.1 ? ? ? 2 non-polymer syn ;(2~{R})-2-(4-fluorophenyl)-~{N}-[4-[2-[(2-methoxy-4-methylsulfonyl-phenyl)amino]-[1,2,4]triazolo[1,5-a]pyridin-6-yl]phenyl]propanamide ; 559.611 1 ? ? ? ? 3 water nat water 18.015 66 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Phosphotyrosine picked threonine-protein kinase,PYT' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHSSGVDLGTENLYFQSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYL NKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLI VDGMLKLIDFGIANQMQPDTTSVVKDSQVG(TPO)VNYMPPEAIKDMSSSRENGKSKSKISPKSDVWSLGCILYYMTYGK TPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQTHLVNQMAKGTTEE ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHSSGVDLGTENLYFQSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYL NKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLI VDGMLKLIDFGIANQMQPDTTSVVKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKISPKSDVWSLGCILYYMTYGKTPFQ QIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQTHLVNQMAKGTTEE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 SER n 1 9 SER n 1 10 GLY n 1 11 VAL n 1 12 ASP n 1 13 LEU n 1 14 GLY n 1 15 THR n 1 16 GLU n 1 17 ASN n 1 18 LEU n 1 19 TYR n 1 20 PHE n 1 21 GLN n 1 22 SER n 1 23 MET n 1 24 SER n 1 25 VAL n 1 26 LYS n 1 27 GLY n 1 28 ARG n 1 29 ILE n 1 30 TYR n 1 31 SER n 1 32 ILE n 1 33 LEU n 1 34 LYS n 1 35 GLN n 1 36 ILE n 1 37 GLY n 1 38 SER n 1 39 GLY n 1 40 GLY n 1 41 SER n 1 42 SER n 1 43 LYS n 1 44 VAL n 1 45 PHE n 1 46 GLN n 1 47 VAL n 1 48 LEU n 1 49 ASN n 1 50 GLU n 1 51 LYS n 1 52 LYS n 1 53 GLN n 1 54 ILE n 1 55 TYR n 1 56 ALA n 1 57 ILE n 1 58 LYS n 1 59 TYR n 1 60 VAL n 1 61 ASN n 1 62 LEU n 1 63 GLU n 1 64 GLU n 1 65 ALA n 1 66 ASP n 1 67 ASN n 1 68 GLN n 1 69 THR n 1 70 LEU n 1 71 ASP n 1 72 SER n 1 73 TYR n 1 74 ARG n 1 75 ASN n 1 76 GLU n 1 77 ILE n 1 78 ALA n 1 79 TYR n 1 80 LEU n 1 81 ASN n 1 82 LYS n 1 83 LEU n 1 84 GLN n 1 85 GLN n 1 86 HIS n 1 87 SER n 1 88 ASP n 1 89 LYS n 1 90 ILE n 1 91 ILE n 1 92 ARG n 1 93 LEU n 1 94 TYR n 1 95 ASP n 1 96 TYR n 1 97 GLU n 1 98 ILE n 1 99 THR n 1 100 ASP n 1 101 GLN n 1 102 TYR n 1 103 ILE n 1 104 TYR n 1 105 MET n 1 106 VAL n 1 107 MET n 1 108 GLU n 1 109 CYS n 1 110 GLY n 1 111 ASN n 1 112 ILE n 1 113 ASP n 1 114 LEU n 1 115 ASN n 1 116 SER n 1 117 TRP n 1 118 LEU n 1 119 LYS n 1 120 LYS n 1 121 LYS n 1 122 LYS n 1 123 SER n 1 124 ILE n 1 125 ASP n 1 126 PRO n 1 127 TRP n 1 128 GLU n 1 129 ARG n 1 130 LYS n 1 131 SER n 1 132 TYR n 1 133 TRP n 1 134 LYS n 1 135 ASN n 1 136 MET n 1 137 LEU n 1 138 GLU n 1 139 ALA n 1 140 VAL n 1 141 HIS n 1 142 THR n 1 143 ILE n 1 144 HIS n 1 145 GLN n 1 146 HIS n 1 147 GLY n 1 148 ILE n 1 149 VAL n 1 150 HIS n 1 151 SER n 1 152 ASP n 1 153 LEU n 1 154 LYS n 1 155 PRO n 1 156 ALA n 1 157 ASN n 1 158 PHE n 1 159 LEU n 1 160 ILE n 1 161 VAL n 1 162 ASP n 1 163 GLY n 1 164 MET n 1 165 LEU n 1 166 LYS n 1 167 LEU n 1 168 ILE n 1 169 ASP n 1 170 PHE n 1 171 GLY n 1 172 ILE n 1 173 ALA n 1 174 ASN n 1 175 GLN n 1 176 MET n 1 177 GLN n 1 178 PRO n 1 179 ASP n 1 180 THR n 1 181 THR n 1 182 SER n 1 183 VAL n 1 184 VAL n 1 185 LYS n 1 186 ASP n 1 187 SER n 1 188 GLN n 1 189 VAL n 1 190 GLY n 1 191 TPO n 1 192 VAL n 1 193 ASN n 1 194 TYR n 1 195 MET n 1 196 PRO n 1 197 PRO n 1 198 GLU n 1 199 ALA n 1 200 ILE n 1 201 LYS n 1 202 ASP n 1 203 MET n 1 204 SER n 1 205 SER n 1 206 SER n 1 207 ARG n 1 208 GLU n 1 209 ASN n 1 210 GLY n 1 211 LYS n 1 212 SER n 1 213 LYS n 1 214 SER n 1 215 LYS n 1 216 ILE n 1 217 SER n 1 218 PRO n 1 219 LYS n 1 220 SER n 1 221 ASP n 1 222 VAL n 1 223 TRP n 1 224 SER n 1 225 LEU n 1 226 GLY n 1 227 CYS n 1 228 ILE n 1 229 LEU n 1 230 TYR n 1 231 TYR n 1 232 MET n 1 233 THR n 1 234 TYR n 1 235 GLY n 1 236 LYS n 1 237 THR n 1 238 PRO n 1 239 PHE n 1 240 GLN n 1 241 GLN n 1 242 ILE n 1 243 ILE n 1 244 ASN n 1 245 GLN n 1 246 ILE n 1 247 SER n 1 248 LYS n 1 249 LEU n 1 250 HIS n 1 251 ALA n 1 252 ILE n 1 253 ILE n 1 254 ASP n 1 255 PRO n 1 256 ASN n 1 257 HIS n 1 258 GLU n 1 259 ILE n 1 260 GLU n 1 261 PHE n 1 262 PRO n 1 263 ASP n 1 264 ILE n 1 265 PRO n 1 266 GLU n 1 267 LYS n 1 268 ASP n 1 269 LEU n 1 270 GLN n 1 271 ASP n 1 272 VAL n 1 273 LEU n 1 274 LYS n 1 275 CYS n 1 276 CYS n 1 277 LEU n 1 278 LYS n 1 279 ARG n 1 280 ASP n 1 281 PRO n 1 282 LYS n 1 283 GLN n 1 284 ARG n 1 285 ILE n 1 286 SER n 1 287 ILE n 1 288 PRO n 1 289 GLU n 1 290 LEU n 1 291 LEU n 1 292 ALA n 1 293 HIS n 1 294 PRO n 1 295 TYR n 1 296 VAL n 1 297 GLN n 1 298 ILE n 1 299 GLN n 1 300 THR n 1 301 HIS n 1 302 LEU n 1 303 VAL n 1 304 ASN n 1 305 GLN n 1 306 MET n 1 307 ALA n 1 308 LYS n 1 309 GLY n 1 310 THR n 1 311 THR n 1 312 GLU n 1 313 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 313 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'TTK, MPS1, MPS1L1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TTK_HUMAN _struct_ref.pdbx_db_accession P33981 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYI YMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDTTSV VKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPD IPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQTHPVNQMAKGTTEE ; _struct_ref.pdbx_align_begin 519 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5N9S _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 24 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 313 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P33981 _struct_ref_seq.db_align_beg 519 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 808 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 519 _struct_ref_seq.pdbx_auth_seq_align_end 808 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5N9S MET A 1 ? UNP P33981 ? ? 'initiating methionine' 496 1 1 5N9S HIS A 2 ? UNP P33981 ? ? 'expression tag' 497 2 1 5N9S HIS A 3 ? UNP P33981 ? ? 'expression tag' 498 3 1 5N9S HIS A 4 ? UNP P33981 ? ? 'expression tag' 499 4 1 5N9S HIS A 5 ? UNP P33981 ? ? 'expression tag' 500 5 1 5N9S HIS A 6 ? UNP P33981 ? ? 'expression tag' 501 6 1 5N9S HIS A 7 ? UNP P33981 ? ? 'expression tag' 502 7 1 5N9S SER A 8 ? UNP P33981 ? ? 'expression tag' 503 8 1 5N9S SER A 9 ? UNP P33981 ? ? 'expression tag' 504 9 1 5N9S GLY A 10 ? UNP P33981 ? ? 'expression tag' 505 10 1 5N9S VAL A 11 ? UNP P33981 ? ? 'expression tag' 506 11 1 5N9S ASP A 12 ? UNP P33981 ? ? 'expression tag' 507 12 1 5N9S LEU A 13 ? UNP P33981 ? ? 'expression tag' 508 13 1 5N9S GLY A 14 ? UNP P33981 ? ? 'expression tag' 509 14 1 5N9S THR A 15 ? UNP P33981 ? ? 'expression tag' 510 15 1 5N9S GLU A 16 ? UNP P33981 ? ? 'expression tag' 511 16 1 5N9S ASN A 17 ? UNP P33981 ? ? 'expression tag' 512 17 1 5N9S LEU A 18 ? UNP P33981 ? ? 'expression tag' 513 18 1 5N9S TYR A 19 ? UNP P33981 ? ? 'expression tag' 514 19 1 5N9S PHE A 20 ? UNP P33981 ? ? 'expression tag' 515 20 1 5N9S GLN A 21 ? UNP P33981 ? ? 'expression tag' 516 21 1 5N9S SER A 22 ? UNP P33981 ? ? 'expression tag' 517 22 1 5N9S MET A 23 ? UNP P33981 ? ? 'expression tag' 518 23 1 5N9S LEU A 302 ? UNP P33981 PRO 797 conflict 797 24 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 8QW non-polymer . ;(2~{R})-2-(4-fluorophenyl)-~{N}-[4-[2-[(2-methoxy-4-methylsulfonyl-phenyl)amino]-[1,2,4]triazolo[1,5-a]pyridin-6-yl]phenyl]propanamide ; ? 'C29 H26 F N5 O4 S' 559.611 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TPO 'L-peptide linking' n PHOSPHOTHREONINE PHOSPHONOTHREONINE 'C4 H10 N O6 P' 199.099 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5N9S _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.16 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 61.02 _exptl_crystal.description 'prism shape, transparent' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.3 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '32 - 37% PEG400 (Acros, Geel, Belgium), 0.1 M Na/K phosphate pH 6.3 and 250 mM NaCl.pH 6.3' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-01-27 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.966 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE MASSIF-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.966 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MASSIF-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5N9S _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.30 _reflns.d_resolution_low 60.60 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 20720 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.8 _reflns.pdbx_Rmerge_I_obs 0.077 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.037 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.30 _reflns_shell.d_res_low 2.39 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.7 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2300 _reflns_shell.percent_possible_all 99.6 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.575 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.9 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.251 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.917 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -0.03 _refine.aniso_B[1][2] -0.00 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][2] -0.00 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 0.03 _refine.B_iso_max ? _refine.B_iso_mean 55.358 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.957 _refine.correlation_coeff_Fo_to_Fc_free 0.931 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5N9S _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.30 _refine.ls_d_res_low 60.34 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 19653 _refine.ls_number_reflns_R_free 1062 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.78 _refine.ls_percent_reflns_R_free 5.1 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.19362 _refine.ls_R_factor_R_free 0.24485 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.19091 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5N7V _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.204 _refine.pdbx_overall_ESU_R_Free 0.193 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 5.613 _refine.overall_SU_ML 0.138 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 2127 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 40 _refine_hist.number_atoms_solvent 66 _refine_hist.number_atoms_total 2233 _refine_hist.d_res_high 2.30 _refine_hist.d_res_low 60.34 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.015 0.019 2217 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 2133 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.796 1.990 3000 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.838 3.000 4926 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.573 5.000 257 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 41.382 25.644 101 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 18.137 15.000 413 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 28.976 15.000 6 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.102 0.200 322 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 0.021 2445 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.005 0.020 490 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.300 _refine_ls_shell.d_res_low 2.360 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 87 _refine_ls_shell.number_reflns_R_work 1414 _refine_ls_shell.percent_reflns_obs 99.27 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.309 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.252 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5N9S _struct.title 'TTK kinase domain in complex with BAY 1161909' _struct.pdbx_descriptor 'Dual specificity protein kinase TTK (E.C.2.7.12.1)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5N9S _struct_keywords.text 'kinase, inhibitor, mitosis, Mps1, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 66 ? GLN A 84 ? ASP A 561 GLN A 579 1 ? 19 HELX_P HELX_P2 AA2 LEU A 114 ? LYS A 120 ? LEU A 609 LYS A 615 1 ? 7 HELX_P HELX_P3 AA3 ASP A 125 ? HIS A 146 ? ASP A 620 HIS A 641 1 ? 22 HELX_P HELX_P4 AA4 LYS A 154 ? ALA A 156 ? LYS A 649 ALA A 651 5 ? 3 HELX_P HELX_P5 AA5 PRO A 196 ? ASP A 202 ? PRO A 691 ASP A 697 1 ? 7 HELX_P HELX_P6 AA6 SER A 217 ? GLY A 235 ? SER A 712 GLY A 730 1 ? 19 HELX_P HELX_P7 AA7 ASN A 244 ? ASP A 254 ? ASN A 739 ASP A 749 1 ? 11 HELX_P HELX_P8 AA8 GLU A 266 ? LEU A 277 ? GLU A 761 LEU A 772 1 ? 12 HELX_P HELX_P9 AA9 SER A 286 ? LEU A 291 ? SER A 781 LEU A 786 1 ? 6 HELX_P HELX_P10 AB1 HIS A 293 ? ILE A 298 ? HIS A 788 ILE A 793 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A GLY 190 C ? ? ? 1_555 A TPO 191 N ? ? A GLY 685 A TPO 686 1_555 ? ? ? ? ? ? ? 1.340 ? covale2 covale both ? A TPO 191 C ? ? ? 1_555 A VAL 192 N ? ? A TPO 686 A VAL 687 1_555 ? ? ? ? ? ? ? 1.319 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 22 ? VAL A 25 ? SER A 517 VAL A 520 AA1 2 ARG A 28 ? GLY A 37 ? ARG A 523 GLY A 532 AA1 3 SER A 42 ? ASN A 49 ? SER A 537 ASN A 544 AA1 4 ILE A 54 ? ASN A 61 ? ILE A 549 ASN A 556 AA1 5 TYR A 102 ? MET A 107 ? TYR A 597 MET A 602 AA1 6 LEU A 93 ? ILE A 98 ? LEU A 588 ILE A 593 AA2 1 ILE A 112 ? ASP A 113 ? ILE A 607 ASP A 608 AA2 2 PHE A 158 ? VAL A 161 ? PHE A 653 VAL A 656 AA2 3 MET A 164 ? LEU A 167 ? MET A 659 LEU A 662 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N MET A 23 ? N MET A 518 O TYR A 30 ? O TYR A 525 AA1 2 3 N ILE A 36 ? N ILE A 531 O VAL A 44 ? O VAL A 539 AA1 3 4 N LYS A 43 ? N LYS A 538 O TYR A 59 ? O TYR A 554 AA1 4 5 N ALA A 56 ? N ALA A 551 O MET A 107 ? O MET A 602 AA1 5 6 O VAL A 106 ? O VAL A 601 N TYR A 94 ? N TYR A 589 AA2 1 2 N ILE A 112 ? N ILE A 607 O ILE A 160 ? O ILE A 655 AA2 2 3 N VAL A 161 ? N VAL A 656 O MET A 164 ? O MET A 659 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id 8QW _struct_site.pdbx_auth_seq_id 901 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 19 _struct_site.details 'binding site for residue 8QW A 901' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 19 ILE A 36 ? ILE A 531 . ? 1_555 ? 2 AC1 19 GLN A 46 ? GLN A 541 . ? 1_555 ? 3 AC1 19 ALA A 56 ? ALA A 551 . ? 1_555 ? 4 AC1 19 LYS A 58 ? LYS A 553 . ? 1_555 ? 5 AC1 19 TYR A 73 ? TYR A 568 . ? 1_555 ? 6 AC1 19 GLU A 76 ? GLU A 571 . ? 1_555 ? 7 AC1 19 ILE A 103 ? ILE A 598 . ? 1_555 ? 8 AC1 19 MET A 105 ? MET A 600 . ? 1_555 ? 9 AC1 19 MET A 107 ? MET A 602 . ? 1_555 ? 10 AC1 19 GLU A 108 ? GLU A 603 . ? 1_555 ? 11 AC1 19 GLY A 110 ? GLY A 605 . ? 1_555 ? 12 AC1 19 ASN A 111 ? ASN A 606 . ? 1_555 ? 13 AC1 19 ASP A 113 ? ASP A 608 . ? 1_555 ? 14 AC1 19 SER A 116 ? SER A 611 . ? 1_555 ? 15 AC1 19 LEU A 159 ? LEU A 654 . ? 1_555 ? 16 AC1 19 ILE A 168 ? ILE A 663 . ? 1_555 ? 17 AC1 19 ALA A 173 ? ALA A 668 . ? 1_555 ? 18 AC1 19 ASP A 186 ? ASP A 681 . ? 1_555 ? 19 AC1 19 HOH C . ? HOH A 1017 . ? 1_555 ? # _atom_sites.entry_id 5N9S _atom_sites.fract_transf_matrix[1][1] 0.013970 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008914 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008783 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C F N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 496 ? ? ? A . n A 1 2 HIS 2 497 ? ? ? A . n A 1 3 HIS 3 498 ? ? ? A . n A 1 4 HIS 4 499 ? ? ? A . n A 1 5 HIS 5 500 ? ? ? A . n A 1 6 HIS 6 501 ? ? ? A . n A 1 7 HIS 7 502 ? ? ? A . n A 1 8 SER 8 503 ? ? ? A . n A 1 9 SER 9 504 ? ? ? A . n A 1 10 GLY 10 505 ? ? ? A . n A 1 11 VAL 11 506 ? ? ? A . n A 1 12 ASP 12 507 ? ? ? A . n A 1 13 LEU 13 508 ? ? ? A . n A 1 14 GLY 14 509 ? ? ? A . n A 1 15 THR 15 510 ? ? ? A . n A 1 16 GLU 16 511 ? ? ? A . n A 1 17 ASN 17 512 ? ? ? A . n A 1 18 LEU 18 513 ? ? ? A . n A 1 19 TYR 19 514 ? ? ? A . n A 1 20 PHE 20 515 ? ? ? A . n A 1 21 GLN 21 516 516 GLN GLN A . n A 1 22 SER 22 517 517 SER SER A . n A 1 23 MET 23 518 518 MET MET A . n A 1 24 SER 24 519 519 SER SER A . n A 1 25 VAL 25 520 520 VAL VAL A . n A 1 26 LYS 26 521 521 LYS LYS A . n A 1 27 GLY 27 522 522 GLY GLY A . n A 1 28 ARG 28 523 523 ARG ARG A . n A 1 29 ILE 29 524 524 ILE ILE A . n A 1 30 TYR 30 525 525 TYR TYR A . n A 1 31 SER 31 526 526 SER SER A . n A 1 32 ILE 32 527 527 ILE ILE A . n A 1 33 LEU 33 528 528 LEU LEU A . n A 1 34 LYS 34 529 529 LYS LYS A . n A 1 35 GLN 35 530 530 GLN GLN A . n A 1 36 ILE 36 531 531 ILE ILE A . n A 1 37 GLY 37 532 532 GLY GLY A . n A 1 38 SER 38 533 533 SER SER A . n A 1 39 GLY 39 534 534 GLY GLY A . n A 1 40 GLY 40 535 535 GLY GLY A . n A 1 41 SER 41 536 536 SER SER A . n A 1 42 SER 42 537 537 SER SER A . n A 1 43 LYS 43 538 538 LYS LYS A . n A 1 44 VAL 44 539 539 VAL VAL A . n A 1 45 PHE 45 540 540 PHE PHE A . n A 1 46 GLN 46 541 541 GLN GLN A . n A 1 47 VAL 47 542 542 VAL VAL A . n A 1 48 LEU 48 543 543 LEU LEU A . n A 1 49 ASN 49 544 544 ASN ASN A . n A 1 50 GLU 50 545 545 GLU GLU A . n A 1 51 LYS 51 546 546 LYS LYS A . n A 1 52 LYS 52 547 547 LYS LYS A . n A 1 53 GLN 53 548 548 GLN GLN A . n A 1 54 ILE 54 549 549 ILE ILE A . n A 1 55 TYR 55 550 550 TYR TYR A . n A 1 56 ALA 56 551 551 ALA ALA A . n A 1 57 ILE 57 552 552 ILE ILE A . n A 1 58 LYS 58 553 553 LYS LYS A . n A 1 59 TYR 59 554 554 TYR TYR A . n A 1 60 VAL 60 555 555 VAL VAL A . n A 1 61 ASN 61 556 556 ASN ASN A . n A 1 62 LEU 62 557 557 LEU LEU A . n A 1 63 GLU 63 558 558 GLU GLU A . n A 1 64 GLU 64 559 559 GLU GLU A . n A 1 65 ALA 65 560 560 ALA ALA A . n A 1 66 ASP 66 561 561 ASP ASP A . n A 1 67 ASN 67 562 562 ASN ASN A . n A 1 68 GLN 68 563 563 GLN GLN A . n A 1 69 THR 69 564 564 THR THR A . n A 1 70 LEU 70 565 565 LEU LEU A . n A 1 71 ASP 71 566 566 ASP ASP A . n A 1 72 SER 72 567 567 SER SER A . n A 1 73 TYR 73 568 568 TYR TYR A . n A 1 74 ARG 74 569 569 ARG ARG A . n A 1 75 ASN 75 570 570 ASN ASN A . n A 1 76 GLU 76 571 571 GLU GLU A . n A 1 77 ILE 77 572 572 ILE ILE A . n A 1 78 ALA 78 573 573 ALA ALA A . n A 1 79 TYR 79 574 574 TYR TYR A . n A 1 80 LEU 80 575 575 LEU LEU A . n A 1 81 ASN 81 576 576 ASN ASN A . n A 1 82 LYS 82 577 577 LYS LYS A . n A 1 83 LEU 83 578 578 LEU LEU A . n A 1 84 GLN 84 579 579 GLN GLN A . n A 1 85 GLN 85 580 580 GLN GLN A . n A 1 86 HIS 86 581 581 HIS HIS A . n A 1 87 SER 87 582 582 SER SER A . n A 1 88 ASP 88 583 583 ASP ASP A . n A 1 89 LYS 89 584 584 LYS LYS A . n A 1 90 ILE 90 585 585 ILE ILE A . n A 1 91 ILE 91 586 586 ILE ILE A . n A 1 92 ARG 92 587 587 ARG ARG A . n A 1 93 LEU 93 588 588 LEU LEU A . n A 1 94 TYR 94 589 589 TYR TYR A . n A 1 95 ASP 95 590 590 ASP ASP A . n A 1 96 TYR 96 591 591 TYR TYR A . n A 1 97 GLU 97 592 592 GLU GLU A . n A 1 98 ILE 98 593 593 ILE ILE A . n A 1 99 THR 99 594 594 THR THR A . n A 1 100 ASP 100 595 595 ASP ASP A . n A 1 101 GLN 101 596 596 GLN GLN A . n A 1 102 TYR 102 597 597 TYR TYR A . n A 1 103 ILE 103 598 598 ILE ILE A . n A 1 104 TYR 104 599 599 TYR TYR A . n A 1 105 MET 105 600 600 MET MET A . n A 1 106 VAL 106 601 601 VAL VAL A . n A 1 107 MET 107 602 602 MET MET A . n A 1 108 GLU 108 603 603 GLU GLU A . n A 1 109 CYS 109 604 604 CYS CYS A . n A 1 110 GLY 110 605 605 GLY GLY A . n A 1 111 ASN 111 606 606 ASN ASN A . n A 1 112 ILE 112 607 607 ILE ILE A . n A 1 113 ASP 113 608 608 ASP ASP A . n A 1 114 LEU 114 609 609 LEU LEU A . n A 1 115 ASN 115 610 610 ASN ASN A . n A 1 116 SER 116 611 611 SER SER A . n A 1 117 TRP 117 612 612 TRP TRP A . n A 1 118 LEU 118 613 613 LEU LEU A . n A 1 119 LYS 119 614 614 LYS LYS A . n A 1 120 LYS 120 615 615 LYS LYS A . n A 1 121 LYS 121 616 616 LYS LYS A . n A 1 122 LYS 122 617 617 LYS LYS A . n A 1 123 SER 123 618 618 SER SER A . n A 1 124 ILE 124 619 619 ILE ILE A . n A 1 125 ASP 125 620 620 ASP ASP A . n A 1 126 PRO 126 621 621 PRO PRO A . n A 1 127 TRP 127 622 622 TRP TRP A . n A 1 128 GLU 128 623 623 GLU GLU A . n A 1 129 ARG 129 624 624 ARG ARG A . n A 1 130 LYS 130 625 625 LYS LYS A . n A 1 131 SER 131 626 626 SER SER A . n A 1 132 TYR 132 627 627 TYR TYR A . n A 1 133 TRP 133 628 628 TRP TRP A . n A 1 134 LYS 134 629 629 LYS LYS A . n A 1 135 ASN 135 630 630 ASN ASN A . n A 1 136 MET 136 631 631 MET MET A . n A 1 137 LEU 137 632 632 LEU LEU A . n A 1 138 GLU 138 633 633 GLU GLU A . n A 1 139 ALA 139 634 634 ALA ALA A . n A 1 140 VAL 140 635 635 VAL VAL A . n A 1 141 HIS 141 636 636 HIS HIS A . n A 1 142 THR 142 637 637 THR THR A . n A 1 143 ILE 143 638 638 ILE ILE A . n A 1 144 HIS 144 639 639 HIS HIS A . n A 1 145 GLN 145 640 640 GLN GLN A . n A 1 146 HIS 146 641 641 HIS HIS A . n A 1 147 GLY 147 642 642 GLY GLY A . n A 1 148 ILE 148 643 643 ILE ILE A . n A 1 149 VAL 149 644 644 VAL VAL A . n A 1 150 HIS 150 645 645 HIS HIS A . n A 1 151 SER 151 646 646 SER SER A . n A 1 152 ASP 152 647 647 ASP ASP A . n A 1 153 LEU 153 648 648 LEU LEU A . n A 1 154 LYS 154 649 649 LYS LYS A . n A 1 155 PRO 155 650 650 PRO PRO A . n A 1 156 ALA 156 651 651 ALA ALA A . n A 1 157 ASN 157 652 652 ASN ASN A . n A 1 158 PHE 158 653 653 PHE PHE A . n A 1 159 LEU 159 654 654 LEU LEU A . n A 1 160 ILE 160 655 655 ILE ILE A . n A 1 161 VAL 161 656 656 VAL VAL A . n A 1 162 ASP 162 657 657 ASP ASP A . n A 1 163 GLY 163 658 658 GLY GLY A . n A 1 164 MET 164 659 659 MET MET A . n A 1 165 LEU 165 660 660 LEU LEU A . n A 1 166 LYS 166 661 661 LYS LYS A . n A 1 167 LEU 167 662 662 LEU LEU A . n A 1 168 ILE 168 663 663 ILE ILE A . n A 1 169 ASP 169 664 664 ASP ASP A . n A 1 170 PHE 170 665 665 PHE PHE A . n A 1 171 GLY 171 666 666 GLY GLY A . n A 1 172 ILE 172 667 667 ILE ILE A . n A 1 173 ALA 173 668 668 ALA ALA A . n A 1 174 ASN 174 669 669 ASN ASN A . n A 1 175 GLN 175 670 670 GLN GLN A . n A 1 176 MET 176 671 671 MET MET A . n A 1 177 GLN 177 672 672 GLN GLN A . n A 1 178 PRO 178 673 673 PRO PRO A . n A 1 179 ASP 179 674 ? ? ? A . n A 1 180 THR 180 675 ? ? ? A . n A 1 181 THR 181 676 ? ? ? A . n A 1 182 SER 182 677 ? ? ? A . n A 1 183 VAL 183 678 ? ? ? A . n A 1 184 VAL 184 679 ? ? ? A . n A 1 185 LYS 185 680 ? ? ? A . n A 1 186 ASP 186 681 681 ASP ASP A . n A 1 187 SER 187 682 682 SER SER A . n A 1 188 GLN 188 683 683 GLN GLN A . n A 1 189 VAL 189 684 684 VAL VAL A . n A 1 190 GLY 190 685 685 GLY GLY A . n A 1 191 TPO 191 686 686 TPO TPO A . n A 1 192 VAL 192 687 687 VAL VAL A . n A 1 193 ASN 193 688 688 ASN ASN A . n A 1 194 TYR 194 689 689 TYR TYR A . n A 1 195 MET 195 690 690 MET MET A . n A 1 196 PRO 196 691 691 PRO PRO A . n A 1 197 PRO 197 692 692 PRO PRO A . n A 1 198 GLU 198 693 693 GLU GLU A . n A 1 199 ALA 199 694 694 ALA ALA A . n A 1 200 ILE 200 695 695 ILE ILE A . n A 1 201 LYS 201 696 696 LYS LYS A . n A 1 202 ASP 202 697 697 ASP ASP A . n A 1 203 MET 203 698 ? ? ? A . n A 1 204 SER 204 699 ? ? ? A . n A 1 205 SER 205 700 ? ? ? A . n A 1 206 SER 206 701 ? ? ? A . n A 1 207 ARG 207 702 ? ? ? A . n A 1 208 GLU 208 703 ? ? ? A . n A 1 209 ASN 209 704 ? ? ? A . n A 1 210 GLY 210 705 ? ? ? A . n A 1 211 LYS 211 706 ? ? ? A . n A 1 212 SER 212 707 ? ? ? A . n A 1 213 LYS 213 708 ? ? ? A . n A 1 214 SER 214 709 ? ? ? A . n A 1 215 LYS 215 710 710 LYS LYS A . n A 1 216 ILE 216 711 711 ILE ILE A . n A 1 217 SER 217 712 712 SER SER A . n A 1 218 PRO 218 713 713 PRO PRO A . n A 1 219 LYS 219 714 714 LYS LYS A . n A 1 220 SER 220 715 715 SER SER A . n A 1 221 ASP 221 716 716 ASP ASP A . n A 1 222 VAL 222 717 717 VAL VAL A . n A 1 223 TRP 223 718 718 TRP TRP A . n A 1 224 SER 224 719 719 SER SER A . n A 1 225 LEU 225 720 720 LEU LEU A . n A 1 226 GLY 226 721 721 GLY GLY A . n A 1 227 CYS 227 722 722 CYS CYS A . n A 1 228 ILE 228 723 723 ILE ILE A . n A 1 229 LEU 229 724 724 LEU LEU A . n A 1 230 TYR 230 725 725 TYR TYR A . n A 1 231 TYR 231 726 726 TYR TYR A . n A 1 232 MET 232 727 727 MET MET A . n A 1 233 THR 233 728 728 THR THR A . n A 1 234 TYR 234 729 729 TYR TYR A . n A 1 235 GLY 235 730 730 GLY GLY A . n A 1 236 LYS 236 731 731 LYS LYS A . n A 1 237 THR 237 732 732 THR THR A . n A 1 238 PRO 238 733 733 PRO PRO A . n A 1 239 PHE 239 734 734 PHE PHE A . n A 1 240 GLN 240 735 735 GLN GLN A . n A 1 241 GLN 241 736 736 GLN GLN A . n A 1 242 ILE 242 737 737 ILE ILE A . n A 1 243 ILE 243 738 738 ILE ILE A . n A 1 244 ASN 244 739 739 ASN ASN A . n A 1 245 GLN 245 740 740 GLN GLN A . n A 1 246 ILE 246 741 741 ILE ILE A . n A 1 247 SER 247 742 742 SER SER A . n A 1 248 LYS 248 743 743 LYS LYS A . n A 1 249 LEU 249 744 744 LEU LEU A . n A 1 250 HIS 250 745 745 HIS HIS A . n A 1 251 ALA 251 746 746 ALA ALA A . n A 1 252 ILE 252 747 747 ILE ILE A . n A 1 253 ILE 253 748 748 ILE ILE A . n A 1 254 ASP 254 749 749 ASP ASP A . n A 1 255 PRO 255 750 750 PRO PRO A . n A 1 256 ASN 256 751 751 ASN ASN A . n A 1 257 HIS 257 752 752 HIS HIS A . n A 1 258 GLU 258 753 753 GLU GLU A . n A 1 259 ILE 259 754 754 ILE ILE A . n A 1 260 GLU 260 755 755 GLU GLU A . n A 1 261 PHE 261 756 756 PHE PHE A . n A 1 262 PRO 262 757 757 PRO PRO A . n A 1 263 ASP 263 758 758 ASP ASP A . n A 1 264 ILE 264 759 759 ILE ILE A . n A 1 265 PRO 265 760 760 PRO PRO A . n A 1 266 GLU 266 761 761 GLU GLU A . n A 1 267 LYS 267 762 762 LYS LYS A . n A 1 268 ASP 268 763 763 ASP ASP A . n A 1 269 LEU 269 764 764 LEU LEU A . n A 1 270 GLN 270 765 765 GLN GLN A . n A 1 271 ASP 271 766 766 ASP ASP A . n A 1 272 VAL 272 767 767 VAL VAL A . n A 1 273 LEU 273 768 768 LEU LEU A . n A 1 274 LYS 274 769 769 LYS LYS A . n A 1 275 CYS 275 770 770 CYS CYS A . n A 1 276 CYS 276 771 771 CYS CYS A . n A 1 277 LEU 277 772 772 LEU LEU A . n A 1 278 LYS 278 773 773 LYS LYS A . n A 1 279 ARG 279 774 774 ARG ARG A . n A 1 280 ASP 280 775 775 ASP ASP A . n A 1 281 PRO 281 776 776 PRO PRO A . n A 1 282 LYS 282 777 777 LYS LYS A . n A 1 283 GLN 283 778 778 GLN GLN A . n A 1 284 ARG 284 779 779 ARG ARG A . n A 1 285 ILE 285 780 780 ILE ILE A . n A 1 286 SER 286 781 781 SER SER A . n A 1 287 ILE 287 782 782 ILE ILE A . n A 1 288 PRO 288 783 783 PRO PRO A . n A 1 289 GLU 289 784 784 GLU GLU A . n A 1 290 LEU 290 785 785 LEU LEU A . n A 1 291 LEU 291 786 786 LEU LEU A . n A 1 292 ALA 292 787 787 ALA ALA A . n A 1 293 HIS 293 788 788 HIS HIS A . n A 1 294 PRO 294 789 789 PRO PRO A . n A 1 295 TYR 295 790 790 TYR TYR A . n A 1 296 VAL 296 791 791 VAL VAL A . n A 1 297 GLN 297 792 792 GLN GLN A . n A 1 298 ILE 298 793 793 ILE ILE A . n A 1 299 GLN 299 794 794 GLN GLN A . n A 1 300 THR 300 795 ? ? ? A . n A 1 301 HIS 301 796 ? ? ? A . n A 1 302 LEU 302 797 ? ? ? A . n A 1 303 VAL 303 798 ? ? ? A . n A 1 304 ASN 304 799 ? ? ? A . n A 1 305 GLN 305 800 ? ? ? A . n A 1 306 MET 306 801 ? ? ? A . n A 1 307 ALA 307 802 ? ? ? A . n A 1 308 LYS 308 803 ? ? ? A . n A 1 309 GLY 309 804 ? ? ? A . n A 1 310 THR 310 805 ? ? ? A . n A 1 311 THR 311 806 ? ? ? A . n A 1 312 GLU 312 807 ? ? ? A . n A 1 313 GLU 313 808 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 8QW 1 901 797 8QW NX1 A . C 3 HOH 1 1001 70 HOH HOH A . C 3 HOH 2 1002 43 HOH HOH A . C 3 HOH 3 1003 89 HOH HOH A . C 3 HOH 4 1004 9 HOH HOH A . C 3 HOH 5 1005 86 HOH HOH A . C 3 HOH 6 1006 72 HOH HOH A . C 3 HOH 7 1007 24 HOH HOH A . C 3 HOH 8 1008 92 HOH HOH A . C 3 HOH 9 1009 32 HOH HOH A . C 3 HOH 10 1010 2 HOH HOH A . C 3 HOH 11 1011 3 HOH HOH A . C 3 HOH 12 1012 87 HOH HOH A . C 3 HOH 13 1013 90 HOH HOH A . C 3 HOH 14 1014 20 HOH HOH A . C 3 HOH 15 1015 83 HOH HOH A . C 3 HOH 16 1016 39 HOH HOH A . C 3 HOH 17 1017 69 HOH HOH A . C 3 HOH 18 1018 11 HOH HOH A . C 3 HOH 19 1019 73 HOH HOH A . C 3 HOH 20 1020 23 HOH HOH A . C 3 HOH 21 1021 81 HOH HOH A . C 3 HOH 22 1022 106 HOH HOH A . C 3 HOH 23 1023 74 HOH HOH A . C 3 HOH 24 1024 18 HOH HOH A . C 3 HOH 25 1025 58 HOH HOH A . C 3 HOH 26 1026 17 HOH HOH A . C 3 HOH 27 1027 36 HOH HOH A . C 3 HOH 28 1028 96 HOH HOH A . C 3 HOH 29 1029 28 HOH HOH A . C 3 HOH 30 1030 4 HOH HOH A . C 3 HOH 31 1031 35 HOH HOH A . C 3 HOH 32 1032 111 HOH HOH A . C 3 HOH 33 1033 10 HOH HOH A . C 3 HOH 34 1034 66 HOH HOH A . C 3 HOH 35 1035 99 HOH HOH A . C 3 HOH 36 1036 68 HOH HOH A . C 3 HOH 37 1037 6 HOH HOH A . C 3 HOH 38 1038 84 HOH HOH A . C 3 HOH 39 1039 116 HOH HOH A . C 3 HOH 40 1040 95 HOH HOH A . C 3 HOH 41 1041 67 HOH HOH A . C 3 HOH 42 1042 115 HOH HOH A . C 3 HOH 43 1043 52 HOH HOH A . C 3 HOH 44 1044 97 HOH HOH A . C 3 HOH 45 1045 93 HOH HOH A . C 3 HOH 46 1046 98 HOH HOH A . C 3 HOH 47 1047 112 HOH HOH A . C 3 HOH 48 1048 78 HOH HOH A . C 3 HOH 49 1049 1 HOH HOH A . C 3 HOH 50 1050 94 HOH HOH A . C 3 HOH 51 1051 114 HOH HOH A . C 3 HOH 52 1052 101 HOH HOH A . C 3 HOH 53 1053 80 HOH HOH A . C 3 HOH 54 1054 56 HOH HOH A . C 3 HOH 55 1055 76 HOH HOH A . C 3 HOH 56 1056 77 HOH HOH A . C 3 HOH 57 1057 41 HOH HOH A . C 3 HOH 58 1058 85 HOH HOH A . C 3 HOH 59 1059 53 HOH HOH A . C 3 HOH 60 1060 51 HOH HOH A . C 3 HOH 61 1061 107 HOH HOH A . C 3 HOH 62 1062 102 HOH HOH A . C 3 HOH 63 1063 27 HOH HOH A . C 3 HOH 64 1064 59 HOH HOH A . C 3 HOH 65 1065 108 HOH HOH A . C 3 HOH 66 1066 113 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id TPO _pdbx_struct_mod_residue.label_seq_id 191 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id TPO _pdbx_struct_mod_residue.auth_seq_id 686 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id THR _pdbx_struct_mod_residue.details 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 13180 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-05-31 2 'Structure model' 1 1 2017-06-07 3 'Structure model' 1 2 2017-07-05 4 'Structure model' 1 3 2017-08-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Database references' 4 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' citation 2 4 'Structure model' diffrn_detector # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.country' 2 3 'Structure model' '_citation.journal_id_ASTM' 3 3 'Structure model' '_citation.journal_id_CSD' 4 3 'Structure model' '_citation.journal_volume' 5 3 'Structure model' '_citation.page_first' 6 3 'Structure model' '_citation.page_last' 7 3 'Structure model' '_citation.title' 8 4 'Structure model' '_diffrn_detector.detector' 9 4 'Structure model' '_diffrn_detector.type' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.7.0029 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? AMoRE ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 647 ? ? -140.82 45.74 2 1 SER A 682 ? ? -171.11 124.26 3 1 VAL A 684 ? ? 176.56 127.56 4 1 PRO A 757 ? ? -36.79 140.84 5 1 LEU A 772 ? ? -101.59 40.77 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 1066 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 7.24 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 496 ? A MET 1 2 1 Y 1 A HIS 497 ? A HIS 2 3 1 Y 1 A HIS 498 ? A HIS 3 4 1 Y 1 A HIS 499 ? A HIS 4 5 1 Y 1 A HIS 500 ? A HIS 5 6 1 Y 1 A HIS 501 ? A HIS 6 7 1 Y 1 A HIS 502 ? A HIS 7 8 1 Y 1 A SER 503 ? A SER 8 9 1 Y 1 A SER 504 ? A SER 9 10 1 Y 1 A GLY 505 ? A GLY 10 11 1 Y 1 A VAL 506 ? A VAL 11 12 1 Y 1 A ASP 507 ? A ASP 12 13 1 Y 1 A LEU 508 ? A LEU 13 14 1 Y 1 A GLY 509 ? A GLY 14 15 1 Y 1 A THR 510 ? A THR 15 16 1 Y 1 A GLU 511 ? A GLU 16 17 1 Y 1 A ASN 512 ? A ASN 17 18 1 Y 1 A LEU 513 ? A LEU 18 19 1 Y 1 A TYR 514 ? A TYR 19 20 1 Y 1 A PHE 515 ? A PHE 20 21 1 Y 1 A ASP 674 ? A ASP 179 22 1 Y 1 A THR 675 ? A THR 180 23 1 Y 1 A THR 676 ? A THR 181 24 1 Y 1 A SER 677 ? A SER 182 25 1 Y 1 A VAL 678 ? A VAL 183 26 1 Y 1 A VAL 679 ? A VAL 184 27 1 Y 1 A LYS 680 ? A LYS 185 28 1 Y 1 A MET 698 ? A MET 203 29 1 Y 1 A SER 699 ? A SER 204 30 1 Y 1 A SER 700 ? A SER 205 31 1 Y 1 A SER 701 ? A SER 206 32 1 Y 1 A ARG 702 ? A ARG 207 33 1 Y 1 A GLU 703 ? A GLU 208 34 1 Y 1 A ASN 704 ? A ASN 209 35 1 Y 1 A GLY 705 ? A GLY 210 36 1 Y 1 A LYS 706 ? A LYS 211 37 1 Y 1 A SER 707 ? A SER 212 38 1 Y 1 A LYS 708 ? A LYS 213 39 1 Y 1 A SER 709 ? A SER 214 40 1 Y 1 A THR 795 ? A THR 300 41 1 Y 1 A HIS 796 ? A HIS 301 42 1 Y 1 A LEU 797 ? A LEU 302 43 1 Y 1 A VAL 798 ? A VAL 303 44 1 Y 1 A ASN 799 ? A ASN 304 45 1 Y 1 A GLN 800 ? A GLN 305 46 1 Y 1 A MET 801 ? A MET 306 47 1 Y 1 A ALA 802 ? A ALA 307 48 1 Y 1 A LYS 803 ? A LYS 308 49 1 Y 1 A GLY 804 ? A GLY 309 50 1 Y 1 A THR 805 ? A THR 310 51 1 Y 1 A THR 806 ? A THR 311 52 1 Y 1 A GLU 807 ? A GLU 312 53 1 Y 1 A GLU 808 ? A GLU 313 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;(2~{R})-2-(4-fluorophenyl)-~{N}-[4-[2-[(2-methoxy-4-methylsulfonyl-phenyl)amino]-[1,2,4]triazolo[1,5-a]pyridin-6-yl]phenyl]propanamide ; 8QW 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'peak elutes as a monomer' #