data_5NAO # _entry.id 5NAO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.394 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5NAO pdb_00005nao 10.2210/pdb5nao/pdb WWPDB D_1200003791 ? ? BMRB 34109 ? 10.13018/BMR34109 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-03-21 2 'Structure model' 1 1 2019-04-03 3 'Structure model' 1 2 2019-05-08 4 'Structure model' 1 3 2024-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' pdbx_database_proc 4 3 'Structure model' pdbx_nmr_software 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 8 4 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 3 'Structure model' '_pdbx_nmr_software.name' 13 4 'Structure model' '_database_2.pdbx_DOI' 14 4 'Structure model' '_database_2.pdbx_database_accession' 15 4 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5NAO _pdbx_database_status.recvd_initial_deposition_date 2017-02-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'NMR structure of TLR4 transmembrane domain (624-657) in DPC micelles' _pdbx_database_related.db_id 34109 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Mineev, K.S.' 1 0000-0002-2418-9421 'Goncharuk, S.A.' 2 ? 'Goncharuk, M.V.' 3 ? 'Arseniev, A.S.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2045-2322 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 7 _citation.language ? _citation.page_first 6864 _citation.page_last 6864 _citation.title 'Spatial structure of TLR4 transmembrane domain in bicelles provides the insight into the receptor activation mechanism.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41598-017-07250-4 _citation.pdbx_database_id_PubMed 28761155 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mineev, K.S.' 1 0000-0002-2418-9421 primary 'Goncharuk, S.A.' 2 ? primary 'Goncharuk, M.V.' 3 ? primary 'Volynsky, P.E.' 4 ? primary 'Novikova, E.V.' 5 ? primary 'Aresinev, A.S.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Toll-like receptor 4' _entity.formula_weight 3903.716 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 623-657' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name hToll # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MNITSQMNKTIIGVSVLSVLVVSVVAVLVYKFYFH _entity_poly.pdbx_seq_one_letter_code_can MNITSQMNKTIIGVSVLSVLVVSVVAVLVYKFYFH _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 ILE n 1 4 THR n 1 5 SER n 1 6 GLN n 1 7 MET n 1 8 ASN n 1 9 LYS n 1 10 THR n 1 11 ILE n 1 12 ILE n 1 13 GLY n 1 14 VAL n 1 15 SER n 1 16 VAL n 1 17 LEU n 1 18 SER n 1 19 VAL n 1 20 LEU n 1 21 VAL n 1 22 VAL n 1 23 SER n 1 24 VAL n 1 25 VAL n 1 26 ALA n 1 27 VAL n 1 28 LEU n 1 29 VAL n 1 30 TYR n 1 31 LYS n 1 32 PHE n 1 33 TYR n 1 34 PHE n 1 35 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 35 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene TLR4 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 MET 7 7 7 MET MET A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 HIS 35 35 35 HIS HIS A . n # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5NAO _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.000 _cell.length_a_esd ? _cell.length_b 1.000 _cell.length_b_esd ? _cell.length_c 1.000 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5NAO _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5NAO _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _database_PDB_matrix.entry_id 5NAO _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 5NAO _struct.title 'NMR structure of TLR4 transmembrane domain (624-657) in DPC micelles' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5NAO _struct_keywords.text 'Toll-like receptor, PROTEIN RECEPTOR, transmembrane domain, PROTEIN, signaling protein' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TLR4_HUMAN _struct_ref.pdbx_db_accession O00206 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code LNITCQMNKTIIGVSVLSVLVVSVVAVLVYKFYFH _struct_ref.pdbx_align_begin 623 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5NAO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 35 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O00206 _struct_ref_seq.db_align_beg 623 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 657 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 35 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5NAO MET A 1 ? UNP O00206 LEU 623 'initiating methionine' 1 1 1 5NAO SER A 5 ? UNP O00206 CYS 627 conflict 5 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 3830 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ASN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 8 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id HIS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 35 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 8 _struct_conf.end_auth_comp_id HIS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 35 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 28 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 3 ? ? -98.70 33.12 2 1 THR A 4 ? ? 38.48 41.88 3 1 PHE A 34 ? ? -113.81 50.38 4 2 PHE A 34 ? ? -107.75 47.22 5 3 ASN A 2 ? ? -108.25 55.24 6 3 PHE A 34 ? ? -109.44 48.70 7 4 SER A 5 ? ? -169.57 -169.90 8 4 GLN A 6 ? ? 51.17 -169.75 9 4 PHE A 34 ? ? -113.62 50.70 10 5 ILE A 3 ? ? -95.66 31.98 11 5 THR A 4 ? ? 38.63 41.84 12 5 SER A 5 ? ? -56.17 106.58 13 6 PHE A 34 ? ? -112.99 50.52 14 7 ILE A 3 ? ? -95.38 33.59 15 7 THR A 4 ? ? 38.37 42.13 16 7 GLN A 6 ? ? -98.79 36.35 17 7 PHE A 34 ? ? -112.94 50.53 18 8 ILE A 3 ? ? -98.69 31.78 19 8 THR A 4 ? ? 38.54 41.84 20 8 PHE A 34 ? ? -108.02 47.35 21 9 PHE A 34 ? ? -107.85 47.27 22 10 PHE A 34 ? ? -114.88 51.27 # _pdbx_nmr_ensemble.entry_id 5NAO _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5NAO _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.0 mM [U-100% 13C; U-100% 15N] TLR4-TM, 100 mM [U-99% 2H] DPC, 20 mM sodium phosphate, 0.01 % sodium azide, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 1 _pdbx_nmr_sample_details.type micelle _pdbx_nmr_sample_details.details 'sample in DPC micelles' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 TLR4-TM 1.0 ? mM '[U-100% 13C; U-100% 15N]' 1 DPC 100 ? mM '[U-99% 2H]' 1 'sodium phosphate' 20 ? mM 'natural abundance' 1 'sodium azide' 0.01 ? % 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 313 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label 1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D HNCO' 1 isotropic 2 1 1 '3D HNCA' 1 isotropic 3 1 1 '3D 1H-15N NOESY' 1 isotropic 4 1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic 5 1 1 '3D HCCH-TOCSY' 1 isotropic # _pdbx_nmr_refine.entry_id 5NAO _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'structure calculation' CYANA 3.97 'Guntert, Mumenthaler and Wuthrich' 2 'chemical shift assignment' CARA 1.9.1 'Keller and Wuthrich' 3 processing TopSpin 3.5 'Bruker Biospin' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 CYS N N N N 31 CYS CA C N R 32 CYS C C N N 33 CYS O O N N 34 CYS CB C N N 35 CYS SG S N N 36 CYS OXT O N N 37 CYS H H N N 38 CYS H2 H N N 39 CYS HA H N N 40 CYS HB2 H N N 41 CYS HB3 H N N 42 CYS HG H N N 43 CYS HXT H N N 44 GLN N N N N 45 GLN CA C N S 46 GLN C C N N 47 GLN O O N N 48 GLN CB C N N 49 GLN CG C N N 50 GLN CD C N N 51 GLN OE1 O N N 52 GLN NE2 N N N 53 GLN OXT O N N 54 GLN H H N N 55 GLN H2 H N N 56 GLN HA H N N 57 GLN HB2 H N N 58 GLN HB3 H N N 59 GLN HG2 H N N 60 GLN HG3 H N N 61 GLN HE21 H N N 62 GLN HE22 H N N 63 GLN HXT H N N 64 GLY N N N N 65 GLY CA C N N 66 GLY C C N N 67 GLY O O N N 68 GLY OXT O N N 69 GLY H H N N 70 GLY H2 H N N 71 GLY HA2 H N N 72 GLY HA3 H N N 73 GLY HXT H N N 74 HIS N N N N 75 HIS CA C N S 76 HIS C C N N 77 HIS O O N N 78 HIS CB C N N 79 HIS CG C Y N 80 HIS ND1 N Y N 81 HIS CD2 C Y N 82 HIS CE1 C Y N 83 HIS NE2 N Y N 84 HIS OXT O N N 85 HIS H H N N 86 HIS H2 H N N 87 HIS HA H N N 88 HIS HB2 H N N 89 HIS HB3 H N N 90 HIS HD1 H N N 91 HIS HD2 H N N 92 HIS HE1 H N N 93 HIS HE2 H N N 94 HIS HXT H N N 95 ILE N N N N 96 ILE CA C N S 97 ILE C C N N 98 ILE O O N N 99 ILE CB C N S 100 ILE CG1 C N N 101 ILE CG2 C N N 102 ILE CD1 C N N 103 ILE OXT O N N 104 ILE H H N N 105 ILE H2 H N N 106 ILE HA H N N 107 ILE HB H N N 108 ILE HG12 H N N 109 ILE HG13 H N N 110 ILE HG21 H N N 111 ILE HG22 H N N 112 ILE HG23 H N N 113 ILE HD11 H N N 114 ILE HD12 H N N 115 ILE HD13 H N N 116 ILE HXT H N N 117 LEU N N N N 118 LEU CA C N S 119 LEU C C N N 120 LEU O O N N 121 LEU CB C N N 122 LEU CG C N N 123 LEU CD1 C N N 124 LEU CD2 C N N 125 LEU OXT O N N 126 LEU H H N N 127 LEU H2 H N N 128 LEU HA H N N 129 LEU HB2 H N N 130 LEU HB3 H N N 131 LEU HG H N N 132 LEU HD11 H N N 133 LEU HD12 H N N 134 LEU HD13 H N N 135 LEU HD21 H N N 136 LEU HD22 H N N 137 LEU HD23 H N N 138 LEU HXT H N N 139 LYS N N N N 140 LYS CA C N S 141 LYS C C N N 142 LYS O O N N 143 LYS CB C N N 144 LYS CG C N N 145 LYS CD C N N 146 LYS CE C N N 147 LYS NZ N N N 148 LYS OXT O N N 149 LYS H H N N 150 LYS H2 H N N 151 LYS HA H N N 152 LYS HB2 H N N 153 LYS HB3 H N N 154 LYS HG2 H N N 155 LYS HG3 H N N 156 LYS HD2 H N N 157 LYS HD3 H N N 158 LYS HE2 H N N 159 LYS HE3 H N N 160 LYS HZ1 H N N 161 LYS HZ2 H N N 162 LYS HZ3 H N N 163 LYS HXT H N N 164 MET N N N N 165 MET CA C N S 166 MET C C N N 167 MET O O N N 168 MET CB C N N 169 MET CG C N N 170 MET SD S N N 171 MET CE C N N 172 MET OXT O N N 173 MET H H N N 174 MET H2 H N N 175 MET HA H N N 176 MET HB2 H N N 177 MET HB3 H N N 178 MET HG2 H N N 179 MET HG3 H N N 180 MET HE1 H N N 181 MET HE2 H N N 182 MET HE3 H N N 183 MET HXT H N N 184 PHE N N N N 185 PHE CA C N S 186 PHE C C N N 187 PHE O O N N 188 PHE CB C N N 189 PHE CG C Y N 190 PHE CD1 C Y N 191 PHE CD2 C Y N 192 PHE CE1 C Y N 193 PHE CE2 C Y N 194 PHE CZ C Y N 195 PHE OXT O N N 196 PHE H H N N 197 PHE H2 H N N 198 PHE HA H N N 199 PHE HB2 H N N 200 PHE HB3 H N N 201 PHE HD1 H N N 202 PHE HD2 H N N 203 PHE HE1 H N N 204 PHE HE2 H N N 205 PHE HZ H N N 206 PHE HXT H N N 207 SER N N N N 208 SER CA C N S 209 SER C C N N 210 SER O O N N 211 SER CB C N N 212 SER OG O N N 213 SER OXT O N N 214 SER H H N N 215 SER H2 H N N 216 SER HA H N N 217 SER HB2 H N N 218 SER HB3 H N N 219 SER HG H N N 220 SER HXT H N N 221 THR N N N N 222 THR CA C N S 223 THR C C N N 224 THR O O N N 225 THR CB C N R 226 THR OG1 O N N 227 THR CG2 C N N 228 THR OXT O N N 229 THR H H N N 230 THR H2 H N N 231 THR HA H N N 232 THR HB H N N 233 THR HG1 H N N 234 THR HG21 H N N 235 THR HG22 H N N 236 THR HG23 H N N 237 THR HXT H N N 238 TYR N N N N 239 TYR CA C N S 240 TYR C C N N 241 TYR O O N N 242 TYR CB C N N 243 TYR CG C Y N 244 TYR CD1 C Y N 245 TYR CD2 C Y N 246 TYR CE1 C Y N 247 TYR CE2 C Y N 248 TYR CZ C Y N 249 TYR OH O N N 250 TYR OXT O N N 251 TYR H H N N 252 TYR H2 H N N 253 TYR HA H N N 254 TYR HB2 H N N 255 TYR HB3 H N N 256 TYR HD1 H N N 257 TYR HD2 H N N 258 TYR HE1 H N N 259 TYR HE2 H N N 260 TYR HH H N N 261 TYR HXT H N N 262 VAL N N N N 263 VAL CA C N S 264 VAL C C N N 265 VAL O O N N 266 VAL CB C N N 267 VAL CG1 C N N 268 VAL CG2 C N N 269 VAL OXT O N N 270 VAL H H N N 271 VAL H2 H N N 272 VAL HA H N N 273 VAL HB H N N 274 VAL HG11 H N N 275 VAL HG12 H N N 276 VAL HG13 H N N 277 VAL HG21 H N N 278 VAL HG22 H N N 279 VAL HG23 H N N 280 VAL HXT H N N 281 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 CYS N CA sing N N 29 CYS N H sing N N 30 CYS N H2 sing N N 31 CYS CA C sing N N 32 CYS CA CB sing N N 33 CYS CA HA sing N N 34 CYS C O doub N N 35 CYS C OXT sing N N 36 CYS CB SG sing N N 37 CYS CB HB2 sing N N 38 CYS CB HB3 sing N N 39 CYS SG HG sing N N 40 CYS OXT HXT sing N N 41 GLN N CA sing N N 42 GLN N H sing N N 43 GLN N H2 sing N N 44 GLN CA C sing N N 45 GLN CA CB sing N N 46 GLN CA HA sing N N 47 GLN C O doub N N 48 GLN C OXT sing N N 49 GLN CB CG sing N N 50 GLN CB HB2 sing N N 51 GLN CB HB3 sing N N 52 GLN CG CD sing N N 53 GLN CG HG2 sing N N 54 GLN CG HG3 sing N N 55 GLN CD OE1 doub N N 56 GLN CD NE2 sing N N 57 GLN NE2 HE21 sing N N 58 GLN NE2 HE22 sing N N 59 GLN OXT HXT sing N N 60 GLY N CA sing N N 61 GLY N H sing N N 62 GLY N H2 sing N N 63 GLY CA C sing N N 64 GLY CA HA2 sing N N 65 GLY CA HA3 sing N N 66 GLY C O doub N N 67 GLY C OXT sing N N 68 GLY OXT HXT sing N N 69 HIS N CA sing N N 70 HIS N H sing N N 71 HIS N H2 sing N N 72 HIS CA C sing N N 73 HIS CA CB sing N N 74 HIS CA HA sing N N 75 HIS C O doub N N 76 HIS C OXT sing N N 77 HIS CB CG sing N N 78 HIS CB HB2 sing N N 79 HIS CB HB3 sing N N 80 HIS CG ND1 sing Y N 81 HIS CG CD2 doub Y N 82 HIS ND1 CE1 doub Y N 83 HIS ND1 HD1 sing N N 84 HIS CD2 NE2 sing Y N 85 HIS CD2 HD2 sing N N 86 HIS CE1 NE2 sing Y N 87 HIS CE1 HE1 sing N N 88 HIS NE2 HE2 sing N N 89 HIS OXT HXT sing N N 90 ILE N CA sing N N 91 ILE N H sing N N 92 ILE N H2 sing N N 93 ILE CA C sing N N 94 ILE CA CB sing N N 95 ILE CA HA sing N N 96 ILE C O doub N N 97 ILE C OXT sing N N 98 ILE CB CG1 sing N N 99 ILE CB CG2 sing N N 100 ILE CB HB sing N N 101 ILE CG1 CD1 sing N N 102 ILE CG1 HG12 sing N N 103 ILE CG1 HG13 sing N N 104 ILE CG2 HG21 sing N N 105 ILE CG2 HG22 sing N N 106 ILE CG2 HG23 sing N N 107 ILE CD1 HD11 sing N N 108 ILE CD1 HD12 sing N N 109 ILE CD1 HD13 sing N N 110 ILE OXT HXT sing N N 111 LEU N CA sing N N 112 LEU N H sing N N 113 LEU N H2 sing N N 114 LEU CA C sing N N 115 LEU CA CB sing N N 116 LEU CA HA sing N N 117 LEU C O doub N N 118 LEU C OXT sing N N 119 LEU CB CG sing N N 120 LEU CB HB2 sing N N 121 LEU CB HB3 sing N N 122 LEU CG CD1 sing N N 123 LEU CG CD2 sing N N 124 LEU CG HG sing N N 125 LEU CD1 HD11 sing N N 126 LEU CD1 HD12 sing N N 127 LEU CD1 HD13 sing N N 128 LEU CD2 HD21 sing N N 129 LEU CD2 HD22 sing N N 130 LEU CD2 HD23 sing N N 131 LEU OXT HXT sing N N 132 LYS N CA sing N N 133 LYS N H sing N N 134 LYS N H2 sing N N 135 LYS CA C sing N N 136 LYS CA CB sing N N 137 LYS CA HA sing N N 138 LYS C O doub N N 139 LYS C OXT sing N N 140 LYS CB CG sing N N 141 LYS CB HB2 sing N N 142 LYS CB HB3 sing N N 143 LYS CG CD sing N N 144 LYS CG HG2 sing N N 145 LYS CG HG3 sing N N 146 LYS CD CE sing N N 147 LYS CD HD2 sing N N 148 LYS CD HD3 sing N N 149 LYS CE NZ sing N N 150 LYS CE HE2 sing N N 151 LYS CE HE3 sing N N 152 LYS NZ HZ1 sing N N 153 LYS NZ HZ2 sing N N 154 LYS NZ HZ3 sing N N 155 LYS OXT HXT sing N N 156 MET N CA sing N N 157 MET N H sing N N 158 MET N H2 sing N N 159 MET CA C sing N N 160 MET CA CB sing N N 161 MET CA HA sing N N 162 MET C O doub N N 163 MET C OXT sing N N 164 MET CB CG sing N N 165 MET CB HB2 sing N N 166 MET CB HB3 sing N N 167 MET CG SD sing N N 168 MET CG HG2 sing N N 169 MET CG HG3 sing N N 170 MET SD CE sing N N 171 MET CE HE1 sing N N 172 MET CE HE2 sing N N 173 MET CE HE3 sing N N 174 MET OXT HXT sing N N 175 PHE N CA sing N N 176 PHE N H sing N N 177 PHE N H2 sing N N 178 PHE CA C sing N N 179 PHE CA CB sing N N 180 PHE CA HA sing N N 181 PHE C O doub N N 182 PHE C OXT sing N N 183 PHE CB CG sing N N 184 PHE CB HB2 sing N N 185 PHE CB HB3 sing N N 186 PHE CG CD1 doub Y N 187 PHE CG CD2 sing Y N 188 PHE CD1 CE1 sing Y N 189 PHE CD1 HD1 sing N N 190 PHE CD2 CE2 doub Y N 191 PHE CD2 HD2 sing N N 192 PHE CE1 CZ doub Y N 193 PHE CE1 HE1 sing N N 194 PHE CE2 CZ sing Y N 195 PHE CE2 HE2 sing N N 196 PHE CZ HZ sing N N 197 PHE OXT HXT sing N N 198 SER N CA sing N N 199 SER N H sing N N 200 SER N H2 sing N N 201 SER CA C sing N N 202 SER CA CB sing N N 203 SER CA HA sing N N 204 SER C O doub N N 205 SER C OXT sing N N 206 SER CB OG sing N N 207 SER CB HB2 sing N N 208 SER CB HB3 sing N N 209 SER OG HG sing N N 210 SER OXT HXT sing N N 211 THR N CA sing N N 212 THR N H sing N N 213 THR N H2 sing N N 214 THR CA C sing N N 215 THR CA CB sing N N 216 THR CA HA sing N N 217 THR C O doub N N 218 THR C OXT sing N N 219 THR CB OG1 sing N N 220 THR CB CG2 sing N N 221 THR CB HB sing N N 222 THR OG1 HG1 sing N N 223 THR CG2 HG21 sing N N 224 THR CG2 HG22 sing N N 225 THR CG2 HG23 sing N N 226 THR OXT HXT sing N N 227 TYR N CA sing N N 228 TYR N H sing N N 229 TYR N H2 sing N N 230 TYR CA C sing N N 231 TYR CA CB sing N N 232 TYR CA HA sing N N 233 TYR C O doub N N 234 TYR C OXT sing N N 235 TYR CB CG sing N N 236 TYR CB HB2 sing N N 237 TYR CB HB3 sing N N 238 TYR CG CD1 doub Y N 239 TYR CG CD2 sing Y N 240 TYR CD1 CE1 sing Y N 241 TYR CD1 HD1 sing N N 242 TYR CD2 CE2 doub Y N 243 TYR CD2 HD2 sing N N 244 TYR CE1 CZ doub Y N 245 TYR CE1 HE1 sing N N 246 TYR CE2 CZ sing Y N 247 TYR CE2 HE2 sing N N 248 TYR CZ OH sing N N 249 TYR OH HH sing N N 250 TYR OXT HXT sing N N 251 VAL N CA sing N N 252 VAL N H sing N N 253 VAL N H2 sing N N 254 VAL CA C sing N N 255 VAL CA CB sing N N 256 VAL CA HA sing N N 257 VAL C O doub N N 258 VAL C OXT sing N N 259 VAL CB CG1 sing N N 260 VAL CB CG2 sing N N 261 VAL CB HB sing N N 262 VAL CG1 HG11 sing N N 263 VAL CG1 HG12 sing N N 264 VAL CG1 HG13 sing N N 265 VAL CG2 HG21 sing N N 266 VAL CG2 HG22 sing N N 267 VAL CG2 HG23 sing N N 268 VAL OXT HXT sing N N 269 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 5NAO _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_