data_5NAO
# 
_entry.id   5NAO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.394 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   5NAO         pdb_00005nao 10.2210/pdb5nao/pdb 
WWPDB D_1200003791 ?            ?                   
BMRB  34109        ?            10.13018/BMR34109   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-03-21 
2 'Structure model' 1 1 2019-04-03 
3 'Structure model' 1 2 2019-05-08 
4 'Structure model' 1 3 2024-06-19 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'     
2 2 'Structure model' 'Database references' 
3 3 'Structure model' 'Data collection'     
4 4 'Structure model' 'Data collection'     
5 4 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation              
2 2 'Structure model' citation_author       
3 2 'Structure model' pdbx_database_proc    
4 3 'Structure model' pdbx_nmr_software     
5 4 'Structure model' chem_comp_atom        
6 4 'Structure model' chem_comp_bond        
7 4 'Structure model' database_2            
8 4 'Structure model' pdbx_nmr_spectrometer 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                   
2  2 'Structure model' '_citation.journal_abbrev'            
3  2 'Structure model' '_citation.journal_id_CSD'            
4  2 'Structure model' '_citation.journal_id_ISSN'           
5  2 'Structure model' '_citation.journal_volume'            
6  2 'Structure model' '_citation.page_first'                
7  2 'Structure model' '_citation.page_last'                 
8  2 'Structure model' '_citation.pdbx_database_id_DOI'      
9  2 'Structure model' '_citation.pdbx_database_id_PubMed'   
10 2 'Structure model' '_citation.title'                     
11 2 'Structure model' '_citation.year'                      
12 3 'Structure model' '_pdbx_nmr_software.name'             
13 4 'Structure model' '_database_2.pdbx_DOI'                
14 4 'Structure model' '_database_2.pdbx_database_accession' 
15 4 'Structure model' '_pdbx_nmr_spectrometer.model'        
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.entry_id                        5NAO 
_pdbx_database_status.recvd_initial_deposition_date   2017-02-28 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.details        'NMR structure of TLR4 transmembrane domain (624-657) in DPC micelles' 
_pdbx_database_related.db_id          34109 
_pdbx_database_related.content_type   unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Mineev, K.S.'    1 0000-0002-2418-9421 
'Goncharuk, S.A.' 2 ?                   
'Goncharuk, M.V.' 3 ?                   
'Arseniev, A.S.'  4 ?                   
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Sci Rep' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2045-2322 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            7 
_citation.language                  ? 
_citation.page_first                6864 
_citation.page_last                 6864 
_citation.title                     
'Spatial structure of TLR4 transmembrane domain in bicelles provides the insight into the receptor activation mechanism.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41598-017-07250-4 
_citation.pdbx_database_id_PubMed   28761155 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Mineev, K.S.'    1 0000-0002-2418-9421 
primary 'Goncharuk, S.A.' 2 ?                   
primary 'Goncharuk, M.V.' 3 ?                   
primary 'Volynsky, P.E.'  4 ?                   
primary 'Novikova, E.V.'  5 ?                   
primary 'Aresinev, A.S.'  6 ?                   
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Toll-like receptor 4' 
_entity.formula_weight             3903.716 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'UNP residues 623-657' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        hToll 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MNITSQMNKTIIGVSVLSVLVVSVVAVLVYKFYFH 
_entity_poly.pdbx_seq_one_letter_code_can   MNITSQMNKTIIGVSVLSVLVVSVVAVLVYKFYFH 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  ASN n 
1 3  ILE n 
1 4  THR n 
1 5  SER n 
1 6  GLN n 
1 7  MET n 
1 8  ASN n 
1 9  LYS n 
1 10 THR n 
1 11 ILE n 
1 12 ILE n 
1 13 GLY n 
1 14 VAL n 
1 15 SER n 
1 16 VAL n 
1 17 LEU n 
1 18 SER n 
1 19 VAL n 
1 20 LEU n 
1 21 VAL n 
1 22 VAL n 
1 23 SER n 
1 24 VAL n 
1 25 VAL n 
1 26 ALA n 
1 27 VAL n 
1 28 LEU n 
1 29 VAL n 
1 30 TYR n 
1 31 LYS n 
1 32 PHE n 
1 33 TYR n 
1 34 PHE n 
1 35 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   35 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 TLR4 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE       ? 'C3 H7 N O2'     89.093  
ASN 'L-peptide linking' y ASPARAGINE    ? 'C4 H8 N2 O3'    132.118 
CYS 'L-peptide linking' y CYSTEINE      ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE     ? 'C5 H10 N2 O3'   146.144 
GLY 'peptide linking'   y GLYCINE       ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE     ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE    ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE       ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE        ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE    ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'    165.189 
SER 'L-peptide linking' y SERINE        ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE     ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE      ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE        ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  1  1  MET MET A . n 
A 1 2  ASN 2  2  2  ASN ASN A . n 
A 1 3  ILE 3  3  3  ILE ILE A . n 
A 1 4  THR 4  4  4  THR THR A . n 
A 1 5  SER 5  5  5  SER SER A . n 
A 1 6  GLN 6  6  6  GLN GLN A . n 
A 1 7  MET 7  7  7  MET MET A . n 
A 1 8  ASN 8  8  8  ASN ASN A . n 
A 1 9  LYS 9  9  9  LYS LYS A . n 
A 1 10 THR 10 10 10 THR THR A . n 
A 1 11 ILE 11 11 11 ILE ILE A . n 
A 1 12 ILE 12 12 12 ILE ILE A . n 
A 1 13 GLY 13 13 13 GLY GLY A . n 
A 1 14 VAL 14 14 14 VAL VAL A . n 
A 1 15 SER 15 15 15 SER SER A . n 
A 1 16 VAL 16 16 16 VAL VAL A . n 
A 1 17 LEU 17 17 17 LEU LEU A . n 
A 1 18 SER 18 18 18 SER SER A . n 
A 1 19 VAL 19 19 19 VAL VAL A . n 
A 1 20 LEU 20 20 20 LEU LEU A . n 
A 1 21 VAL 21 21 21 VAL VAL A . n 
A 1 22 VAL 22 22 22 VAL VAL A . n 
A 1 23 SER 23 23 23 SER SER A . n 
A 1 24 VAL 24 24 24 VAL VAL A . n 
A 1 25 VAL 25 25 25 VAL VAL A . n 
A 1 26 ALA 26 26 26 ALA ALA A . n 
A 1 27 VAL 27 27 27 VAL VAL A . n 
A 1 28 LEU 28 28 28 LEU LEU A . n 
A 1 29 VAL 29 29 29 VAL VAL A . n 
A 1 30 TYR 30 30 30 TYR TYR A . n 
A 1 31 LYS 31 31 31 LYS LYS A . n 
A 1 32 PHE 32 32 32 PHE PHE A . n 
A 1 33 TYR 33 33 33 TYR TYR A . n 
A 1 34 PHE 34 34 34 PHE PHE A . n 
A 1 35 HIS 35 35 35 HIS HIS A . n 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5NAO 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.000 
_cell.length_a_esd                 ? 
_cell.length_b                     1.000 
_cell.length_b_esd                 ? 
_cell.length_c                     1.000 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        ? 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5NAO 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5NAO 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_database_PDB_matrix.entry_id          5NAO 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                     5NAO 
_struct.title                        'NMR structure of TLR4 transmembrane domain (624-657) in DPC micelles' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5NAO 
_struct_keywords.text            'Toll-like receptor, PROTEIN RECEPTOR, transmembrane domain, PROTEIN, signaling protein' 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TLR4_HUMAN 
_struct_ref.pdbx_db_accession          O00206 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   LNITCQMNKTIIGVSVLSVLVVSVVAVLVYKFYFH 
_struct_ref.pdbx_align_begin           623 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5NAO 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 35 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O00206 
_struct_ref_seq.db_align_beg                  623 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  657 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       35 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5NAO MET A 1 ? UNP O00206 LEU 623 'initiating methionine' 1 1 
1 5NAO SER A 5 ? UNP O00206 CYS 627 conflict                5 2 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 0    ? 
1 MORE         0    ? 
1 'SSA (A^2)'  3830 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   ? 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       AA1 
_struct_conf.beg_label_comp_id       ASN 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        8 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       HIS 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        35 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        ASN 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         8 
_struct_conf.end_auth_comp_id        HIS 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         35 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   28 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1  ILE A 3  ? ? -98.70  33.12   
2  1  THR A 4  ? ? 38.48   41.88   
3  1  PHE A 34 ? ? -113.81 50.38   
4  2  PHE A 34 ? ? -107.75 47.22   
5  3  ASN A 2  ? ? -108.25 55.24   
6  3  PHE A 34 ? ? -109.44 48.70   
7  4  SER A 5  ? ? -169.57 -169.90 
8  4  GLN A 6  ? ? 51.17   -169.75 
9  4  PHE A 34 ? ? -113.62 50.70   
10 5  ILE A 3  ? ? -95.66  31.98   
11 5  THR A 4  ? ? 38.63   41.84   
12 5  SER A 5  ? ? -56.17  106.58  
13 6  PHE A 34 ? ? -112.99 50.52   
14 7  ILE A 3  ? ? -95.38  33.59   
15 7  THR A 4  ? ? 38.37   42.13   
16 7  GLN A 6  ? ? -98.79  36.35   
17 7  PHE A 34 ? ? -112.94 50.53   
18 8  ILE A 3  ? ? -98.69  31.78   
19 8  THR A 4  ? ? 38.54   41.84   
20 8  PHE A 34 ? ? -108.02 47.35   
21 9  PHE A 34 ? ? -107.85 47.27   
22 10 PHE A 34 ? ? -114.88 51.27   
# 
_pdbx_nmr_ensemble.entry_id                                      5NAO 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             10 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the least restraint violations' 
_pdbx_nmr_ensemble.representative_conformer                      ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             5NAO 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'fewest violations' 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1.0 mM [U-100% 13C; U-100% 15N] TLR4-TM, 100 mM [U-99% 2H] DPC, 20 mM sodium phosphate, 0.01 % sodium azide, 90% H2O/10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
_pdbx_nmr_sample_details.label            1 
_pdbx_nmr_sample_details.type             micelle 
_pdbx_nmr_sample_details.details          'sample in DPC micelles' 
# 
loop_
_pdbx_nmr_exptl_sample.solution_id 
_pdbx_nmr_exptl_sample.component 
_pdbx_nmr_exptl_sample.concentration 
_pdbx_nmr_exptl_sample.concentration_range 
_pdbx_nmr_exptl_sample.concentration_units 
_pdbx_nmr_exptl_sample.isotopic_labeling 
1 TLR4-TM            1.0  ? mM '[U-100% 13C; U-100% 15N]' 
1 DPC                100  ? mM '[U-99% 2H]'               
1 'sodium phosphate' 20   ? mM 'natural abundance'        
1 'sodium azide'     0.01 ? %  'natural abundance'        
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            313 
_pdbx_nmr_exptl_sample_conditions.pressure_units         atm 
_pdbx_nmr_exptl_sample_conditions.pressure               AMBIENT 
_pdbx_nmr_exptl_sample_conditions.pH                     6.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         20 
_pdbx_nmr_exptl_sample_conditions.details                ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_err     ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   mM 
_pdbx_nmr_exptl_sample_conditions.label                  1 
_pdbx_nmr_exptl_sample_conditions.pH_err                 ? 
_pdbx_nmr_exptl_sample_conditions.pH_units               pH 
_pdbx_nmr_exptl_sample_conditions.pressure_err           ? 
_pdbx_nmr_exptl_sample_conditions.temperature_err        ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.spectrometer_id 
_pdbx_nmr_exptl.sample_state 
1 1 1 '3D HNCO'                   1 isotropic 
2 1 1 '3D HNCA'                   1 isotropic 
3 1 1 '3D 1H-15N NOESY'           1 isotropic 
4 1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic 
5 1 1 '3D HCCH-TOCSY'             1 isotropic 
# 
_pdbx_nmr_refine.entry_id           5NAO 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
1 'structure calculation'     CYANA   3.97  'Guntert, Mumenthaler and Wuthrich' 
2 'chemical shift assignment' CARA    1.9.1 'Keller and Wuthrich'               
3 processing                  TopSpin 3.5   'Bruker Biospin'                    
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ASN N    N N N 14  
ASN CA   C N S 15  
ASN C    C N N 16  
ASN O    O N N 17  
ASN CB   C N N 18  
ASN CG   C N N 19  
ASN OD1  O N N 20  
ASN ND2  N N N 21  
ASN OXT  O N N 22  
ASN H    H N N 23  
ASN H2   H N N 24  
ASN HA   H N N 25  
ASN HB2  H N N 26  
ASN HB3  H N N 27  
ASN HD21 H N N 28  
ASN HD22 H N N 29  
ASN HXT  H N N 30  
CYS N    N N N 31  
CYS CA   C N R 32  
CYS C    C N N 33  
CYS O    O N N 34  
CYS CB   C N N 35  
CYS SG   S N N 36  
CYS OXT  O N N 37  
CYS H    H N N 38  
CYS H2   H N N 39  
CYS HA   H N N 40  
CYS HB2  H N N 41  
CYS HB3  H N N 42  
CYS HG   H N N 43  
CYS HXT  H N N 44  
GLN N    N N N 45  
GLN CA   C N S 46  
GLN C    C N N 47  
GLN O    O N N 48  
GLN CB   C N N 49  
GLN CG   C N N 50  
GLN CD   C N N 51  
GLN OE1  O N N 52  
GLN NE2  N N N 53  
GLN OXT  O N N 54  
GLN H    H N N 55  
GLN H2   H N N 56  
GLN HA   H N N 57  
GLN HB2  H N N 58  
GLN HB3  H N N 59  
GLN HG2  H N N 60  
GLN HG3  H N N 61  
GLN HE21 H N N 62  
GLN HE22 H N N 63  
GLN HXT  H N N 64  
GLY N    N N N 65  
GLY CA   C N N 66  
GLY C    C N N 67  
GLY O    O N N 68  
GLY OXT  O N N 69  
GLY H    H N N 70  
GLY H2   H N N 71  
GLY HA2  H N N 72  
GLY HA3  H N N 73  
GLY HXT  H N N 74  
HIS N    N N N 75  
HIS CA   C N S 76  
HIS C    C N N 77  
HIS O    O N N 78  
HIS CB   C N N 79  
HIS CG   C Y N 80  
HIS ND1  N Y N 81  
HIS CD2  C Y N 82  
HIS CE1  C Y N 83  
HIS NE2  N Y N 84  
HIS OXT  O N N 85  
HIS H    H N N 86  
HIS H2   H N N 87  
HIS HA   H N N 88  
HIS HB2  H N N 89  
HIS HB3  H N N 90  
HIS HD1  H N N 91  
HIS HD2  H N N 92  
HIS HE1  H N N 93  
HIS HE2  H N N 94  
HIS HXT  H N N 95  
ILE N    N N N 96  
ILE CA   C N S 97  
ILE C    C N N 98  
ILE O    O N N 99  
ILE CB   C N S 100 
ILE CG1  C N N 101 
ILE CG2  C N N 102 
ILE CD1  C N N 103 
ILE OXT  O N N 104 
ILE H    H N N 105 
ILE H2   H N N 106 
ILE HA   H N N 107 
ILE HB   H N N 108 
ILE HG12 H N N 109 
ILE HG13 H N N 110 
ILE HG21 H N N 111 
ILE HG22 H N N 112 
ILE HG23 H N N 113 
ILE HD11 H N N 114 
ILE HD12 H N N 115 
ILE HD13 H N N 116 
ILE HXT  H N N 117 
LEU N    N N N 118 
LEU CA   C N S 119 
LEU C    C N N 120 
LEU O    O N N 121 
LEU CB   C N N 122 
LEU CG   C N N 123 
LEU CD1  C N N 124 
LEU CD2  C N N 125 
LEU OXT  O N N 126 
LEU H    H N N 127 
LEU H2   H N N 128 
LEU HA   H N N 129 
LEU HB2  H N N 130 
LEU HB3  H N N 131 
LEU HG   H N N 132 
LEU HD11 H N N 133 
LEU HD12 H N N 134 
LEU HD13 H N N 135 
LEU HD21 H N N 136 
LEU HD22 H N N 137 
LEU HD23 H N N 138 
LEU HXT  H N N 139 
LYS N    N N N 140 
LYS CA   C N S 141 
LYS C    C N N 142 
LYS O    O N N 143 
LYS CB   C N N 144 
LYS CG   C N N 145 
LYS CD   C N N 146 
LYS CE   C N N 147 
LYS NZ   N N N 148 
LYS OXT  O N N 149 
LYS H    H N N 150 
LYS H2   H N N 151 
LYS HA   H N N 152 
LYS HB2  H N N 153 
LYS HB3  H N N 154 
LYS HG2  H N N 155 
LYS HG3  H N N 156 
LYS HD2  H N N 157 
LYS HD3  H N N 158 
LYS HE2  H N N 159 
LYS HE3  H N N 160 
LYS HZ1  H N N 161 
LYS HZ2  H N N 162 
LYS HZ3  H N N 163 
LYS HXT  H N N 164 
MET N    N N N 165 
MET CA   C N S 166 
MET C    C N N 167 
MET O    O N N 168 
MET CB   C N N 169 
MET CG   C N N 170 
MET SD   S N N 171 
MET CE   C N N 172 
MET OXT  O N N 173 
MET H    H N N 174 
MET H2   H N N 175 
MET HA   H N N 176 
MET HB2  H N N 177 
MET HB3  H N N 178 
MET HG2  H N N 179 
MET HG3  H N N 180 
MET HE1  H N N 181 
MET HE2  H N N 182 
MET HE3  H N N 183 
MET HXT  H N N 184 
PHE N    N N N 185 
PHE CA   C N S 186 
PHE C    C N N 187 
PHE O    O N N 188 
PHE CB   C N N 189 
PHE CG   C Y N 190 
PHE CD1  C Y N 191 
PHE CD2  C Y N 192 
PHE CE1  C Y N 193 
PHE CE2  C Y N 194 
PHE CZ   C Y N 195 
PHE OXT  O N N 196 
PHE H    H N N 197 
PHE H2   H N N 198 
PHE HA   H N N 199 
PHE HB2  H N N 200 
PHE HB3  H N N 201 
PHE HD1  H N N 202 
PHE HD2  H N N 203 
PHE HE1  H N N 204 
PHE HE2  H N N 205 
PHE HZ   H N N 206 
PHE HXT  H N N 207 
SER N    N N N 208 
SER CA   C N S 209 
SER C    C N N 210 
SER O    O N N 211 
SER CB   C N N 212 
SER OG   O N N 213 
SER OXT  O N N 214 
SER H    H N N 215 
SER H2   H N N 216 
SER HA   H N N 217 
SER HB2  H N N 218 
SER HB3  H N N 219 
SER HG   H N N 220 
SER HXT  H N N 221 
THR N    N N N 222 
THR CA   C N S 223 
THR C    C N N 224 
THR O    O N N 225 
THR CB   C N R 226 
THR OG1  O N N 227 
THR CG2  C N N 228 
THR OXT  O N N 229 
THR H    H N N 230 
THR H2   H N N 231 
THR HA   H N N 232 
THR HB   H N N 233 
THR HG1  H N N 234 
THR HG21 H N N 235 
THR HG22 H N N 236 
THR HG23 H N N 237 
THR HXT  H N N 238 
TYR N    N N N 239 
TYR CA   C N S 240 
TYR C    C N N 241 
TYR O    O N N 242 
TYR CB   C N N 243 
TYR CG   C Y N 244 
TYR CD1  C Y N 245 
TYR CD2  C Y N 246 
TYR CE1  C Y N 247 
TYR CE2  C Y N 248 
TYR CZ   C Y N 249 
TYR OH   O N N 250 
TYR OXT  O N N 251 
TYR H    H N N 252 
TYR H2   H N N 253 
TYR HA   H N N 254 
TYR HB2  H N N 255 
TYR HB3  H N N 256 
TYR HD1  H N N 257 
TYR HD2  H N N 258 
TYR HE1  H N N 259 
TYR HE2  H N N 260 
TYR HH   H N N 261 
TYR HXT  H N N 262 
VAL N    N N N 263 
VAL CA   C N S 264 
VAL C    C N N 265 
VAL O    O N N 266 
VAL CB   C N N 267 
VAL CG1  C N N 268 
VAL CG2  C N N 269 
VAL OXT  O N N 270 
VAL H    H N N 271 
VAL H2   H N N 272 
VAL HA   H N N 273 
VAL HB   H N N 274 
VAL HG11 H N N 275 
VAL HG12 H N N 276 
VAL HG13 H N N 277 
VAL HG21 H N N 278 
VAL HG22 H N N 279 
VAL HG23 H N N 280 
VAL HXT  H N N 281 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ASN N   CA   sing N N 13  
ASN N   H    sing N N 14  
ASN N   H2   sing N N 15  
ASN CA  C    sing N N 16  
ASN CA  CB   sing N N 17  
ASN CA  HA   sing N N 18  
ASN C   O    doub N N 19  
ASN C   OXT  sing N N 20  
ASN CB  CG   sing N N 21  
ASN CB  HB2  sing N N 22  
ASN CB  HB3  sing N N 23  
ASN CG  OD1  doub N N 24  
ASN CG  ND2  sing N N 25  
ASN ND2 HD21 sing N N 26  
ASN ND2 HD22 sing N N 27  
ASN OXT HXT  sing N N 28  
CYS N   CA   sing N N 29  
CYS N   H    sing N N 30  
CYS N   H2   sing N N 31  
CYS CA  C    sing N N 32  
CYS CA  CB   sing N N 33  
CYS CA  HA   sing N N 34  
CYS C   O    doub N N 35  
CYS C   OXT  sing N N 36  
CYS CB  SG   sing N N 37  
CYS CB  HB2  sing N N 38  
CYS CB  HB3  sing N N 39  
CYS SG  HG   sing N N 40  
CYS OXT HXT  sing N N 41  
GLN N   CA   sing N N 42  
GLN N   H    sing N N 43  
GLN N   H2   sing N N 44  
GLN CA  C    sing N N 45  
GLN CA  CB   sing N N 46  
GLN CA  HA   sing N N 47  
GLN C   O    doub N N 48  
GLN C   OXT  sing N N 49  
GLN CB  CG   sing N N 50  
GLN CB  HB2  sing N N 51  
GLN CB  HB3  sing N N 52  
GLN CG  CD   sing N N 53  
GLN CG  HG2  sing N N 54  
GLN CG  HG3  sing N N 55  
GLN CD  OE1  doub N N 56  
GLN CD  NE2  sing N N 57  
GLN NE2 HE21 sing N N 58  
GLN NE2 HE22 sing N N 59  
GLN OXT HXT  sing N N 60  
GLY N   CA   sing N N 61  
GLY N   H    sing N N 62  
GLY N   H2   sing N N 63  
GLY CA  C    sing N N 64  
GLY CA  HA2  sing N N 65  
GLY CA  HA3  sing N N 66  
GLY C   O    doub N N 67  
GLY C   OXT  sing N N 68  
GLY OXT HXT  sing N N 69  
HIS N   CA   sing N N 70  
HIS N   H    sing N N 71  
HIS N   H2   sing N N 72  
HIS CA  C    sing N N 73  
HIS CA  CB   sing N N 74  
HIS CA  HA   sing N N 75  
HIS C   O    doub N N 76  
HIS C   OXT  sing N N 77  
HIS CB  CG   sing N N 78  
HIS CB  HB2  sing N N 79  
HIS CB  HB3  sing N N 80  
HIS CG  ND1  sing Y N 81  
HIS CG  CD2  doub Y N 82  
HIS ND1 CE1  doub Y N 83  
HIS ND1 HD1  sing N N 84  
HIS CD2 NE2  sing Y N 85  
HIS CD2 HD2  sing N N 86  
HIS CE1 NE2  sing Y N 87  
HIS CE1 HE1  sing N N 88  
HIS NE2 HE2  sing N N 89  
HIS OXT HXT  sing N N 90  
ILE N   CA   sing N N 91  
ILE N   H    sing N N 92  
ILE N   H2   sing N N 93  
ILE CA  C    sing N N 94  
ILE CA  CB   sing N N 95  
ILE CA  HA   sing N N 96  
ILE C   O    doub N N 97  
ILE C   OXT  sing N N 98  
ILE CB  CG1  sing N N 99  
ILE CB  CG2  sing N N 100 
ILE CB  HB   sing N N 101 
ILE CG1 CD1  sing N N 102 
ILE CG1 HG12 sing N N 103 
ILE CG1 HG13 sing N N 104 
ILE CG2 HG21 sing N N 105 
ILE CG2 HG22 sing N N 106 
ILE CG2 HG23 sing N N 107 
ILE CD1 HD11 sing N N 108 
ILE CD1 HD12 sing N N 109 
ILE CD1 HD13 sing N N 110 
ILE OXT HXT  sing N N 111 
LEU N   CA   sing N N 112 
LEU N   H    sing N N 113 
LEU N   H2   sing N N 114 
LEU CA  C    sing N N 115 
LEU CA  CB   sing N N 116 
LEU CA  HA   sing N N 117 
LEU C   O    doub N N 118 
LEU C   OXT  sing N N 119 
LEU CB  CG   sing N N 120 
LEU CB  HB2  sing N N 121 
LEU CB  HB3  sing N N 122 
LEU CG  CD1  sing N N 123 
LEU CG  CD2  sing N N 124 
LEU CG  HG   sing N N 125 
LEU CD1 HD11 sing N N 126 
LEU CD1 HD12 sing N N 127 
LEU CD1 HD13 sing N N 128 
LEU CD2 HD21 sing N N 129 
LEU CD2 HD22 sing N N 130 
LEU CD2 HD23 sing N N 131 
LEU OXT HXT  sing N N 132 
LYS N   CA   sing N N 133 
LYS N   H    sing N N 134 
LYS N   H2   sing N N 135 
LYS CA  C    sing N N 136 
LYS CA  CB   sing N N 137 
LYS CA  HA   sing N N 138 
LYS C   O    doub N N 139 
LYS C   OXT  sing N N 140 
LYS CB  CG   sing N N 141 
LYS CB  HB2  sing N N 142 
LYS CB  HB3  sing N N 143 
LYS CG  CD   sing N N 144 
LYS CG  HG2  sing N N 145 
LYS CG  HG3  sing N N 146 
LYS CD  CE   sing N N 147 
LYS CD  HD2  sing N N 148 
LYS CD  HD3  sing N N 149 
LYS CE  NZ   sing N N 150 
LYS CE  HE2  sing N N 151 
LYS CE  HE3  sing N N 152 
LYS NZ  HZ1  sing N N 153 
LYS NZ  HZ2  sing N N 154 
LYS NZ  HZ3  sing N N 155 
LYS OXT HXT  sing N N 156 
MET N   CA   sing N N 157 
MET N   H    sing N N 158 
MET N   H2   sing N N 159 
MET CA  C    sing N N 160 
MET CA  CB   sing N N 161 
MET CA  HA   sing N N 162 
MET C   O    doub N N 163 
MET C   OXT  sing N N 164 
MET CB  CG   sing N N 165 
MET CB  HB2  sing N N 166 
MET CB  HB3  sing N N 167 
MET CG  SD   sing N N 168 
MET CG  HG2  sing N N 169 
MET CG  HG3  sing N N 170 
MET SD  CE   sing N N 171 
MET CE  HE1  sing N N 172 
MET CE  HE2  sing N N 173 
MET CE  HE3  sing N N 174 
MET OXT HXT  sing N N 175 
PHE N   CA   sing N N 176 
PHE N   H    sing N N 177 
PHE N   H2   sing N N 178 
PHE CA  C    sing N N 179 
PHE CA  CB   sing N N 180 
PHE CA  HA   sing N N 181 
PHE C   O    doub N N 182 
PHE C   OXT  sing N N 183 
PHE CB  CG   sing N N 184 
PHE CB  HB2  sing N N 185 
PHE CB  HB3  sing N N 186 
PHE CG  CD1  doub Y N 187 
PHE CG  CD2  sing Y N 188 
PHE CD1 CE1  sing Y N 189 
PHE CD1 HD1  sing N N 190 
PHE CD2 CE2  doub Y N 191 
PHE CD2 HD2  sing N N 192 
PHE CE1 CZ   doub Y N 193 
PHE CE1 HE1  sing N N 194 
PHE CE2 CZ   sing Y N 195 
PHE CE2 HE2  sing N N 196 
PHE CZ  HZ   sing N N 197 
PHE OXT HXT  sing N N 198 
SER N   CA   sing N N 199 
SER N   H    sing N N 200 
SER N   H2   sing N N 201 
SER CA  C    sing N N 202 
SER CA  CB   sing N N 203 
SER CA  HA   sing N N 204 
SER C   O    doub N N 205 
SER C   OXT  sing N N 206 
SER CB  OG   sing N N 207 
SER CB  HB2  sing N N 208 
SER CB  HB3  sing N N 209 
SER OG  HG   sing N N 210 
SER OXT HXT  sing N N 211 
THR N   CA   sing N N 212 
THR N   H    sing N N 213 
THR N   H2   sing N N 214 
THR CA  C    sing N N 215 
THR CA  CB   sing N N 216 
THR CA  HA   sing N N 217 
THR C   O    doub N N 218 
THR C   OXT  sing N N 219 
THR CB  OG1  sing N N 220 
THR CB  CG2  sing N N 221 
THR CB  HB   sing N N 222 
THR OG1 HG1  sing N N 223 
THR CG2 HG21 sing N N 224 
THR CG2 HG22 sing N N 225 
THR CG2 HG23 sing N N 226 
THR OXT HXT  sing N N 227 
TYR N   CA   sing N N 228 
TYR N   H    sing N N 229 
TYR N   H2   sing N N 230 
TYR CA  C    sing N N 231 
TYR CA  CB   sing N N 232 
TYR CA  HA   sing N N 233 
TYR C   O    doub N N 234 
TYR C   OXT  sing N N 235 
TYR CB  CG   sing N N 236 
TYR CB  HB2  sing N N 237 
TYR CB  HB3  sing N N 238 
TYR CG  CD1  doub Y N 239 
TYR CG  CD2  sing Y N 240 
TYR CD1 CE1  sing Y N 241 
TYR CD1 HD1  sing N N 242 
TYR CD2 CE2  doub Y N 243 
TYR CD2 HD2  sing N N 244 
TYR CE1 CZ   doub Y N 245 
TYR CE1 HE1  sing N N 246 
TYR CE2 CZ   sing Y N 247 
TYR CE2 HE2  sing N N 248 
TYR CZ  OH   sing N N 249 
TYR OH  HH   sing N N 250 
TYR OXT HXT  sing N N 251 
VAL N   CA   sing N N 252 
VAL N   H    sing N N 253 
VAL N   H2   sing N N 254 
VAL CA  C    sing N N 255 
VAL CA  CB   sing N N 256 
VAL CA  HA   sing N N 257 
VAL C   O    doub N N 258 
VAL C   OXT  sing N N 259 
VAL CB  CG1  sing N N 260 
VAL CB  CG2  sing N N 261 
VAL CB  HB   sing N N 262 
VAL CG1 HG11 sing N N 263 
VAL CG1 HG12 sing N N 264 
VAL CG1 HG13 sing N N 265 
VAL CG2 HG21 sing N N 266 
VAL CG2 HG22 sing N N 267 
VAL CG2 HG23 sing N N 268 
VAL OXT HXT  sing N N 269 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             'AVANCE III' 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.details           ? 
# 
_atom_sites.entry_id                    5NAO 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_