data_5NCP # _entry.id 5NCP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5NCP pdb_00005ncp 10.2210/pdb5ncp/pdb WWPDB D_1200003878 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-03-28 2 'Structure model' 1 1 2020-11-25 3 'Structure model' 1 2 2022-10-26 4 'Structure model' 1 3 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 3 'Structure model' database_2 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' 9 3 'Structure model' '_citation.journal_volume' 10 3 'Structure model' '_citation.page_first' 11 3 'Structure model' '_citation.page_last' 12 3 'Structure model' '_citation.pdbx_database_id_PubMed' 13 3 'Structure model' '_citation.title' 14 3 'Structure model' '_database_2.pdbx_DOI' 15 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5NCP _pdbx_database_status.recvd_initial_deposition_date 2017-03-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Barone, M.' 1 ? 'Roske, Y.' 2 ? # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.unpublished_flag ? ? ? ? ? ? ? US ? ? primary Proc.Natl.Acad.Sci.USA PNASA6 0040 1091-6490 ? ? 117 ? 29684 29690 'Designed nanomolar small-molecule inhibitors of Ena/VASP EVH1 interaction impair invasion and extravasation of breast cancer cells.' 2020 ? 10.1073/pnas.2007213117 33184177 ? ? ? ? ? ? ? ? US ? ? 1 'Proc. Natl. Acad. Sci. U.S.A.' PNASA6 0040 1091-6490 ? ? 112 ? 5011 5016 'A modular toolkit to inhibit proline-rich motif-mediated protein-protein interactions.' 2015 ? 10.1073/pnas.1422054112 25848013 ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Barone, M.' 1 0000-0002-6554-6464 primary 'Muller, M.' 2 ? primary 'Chiha, S.' 3 ? primary 'Ren, J.' 4 ? primary 'Albat, D.' 5 ? primary 'Soicke, A.' 6 ? primary 'Dohmen, S.' 7 ? primary 'Klein, M.' 8 ? primary 'Bruns, J.' 9 ? primary 'van Dinther, M.' 10 ? primary 'Opitz, R.' 11 ? primary 'Lindemann, P.' 12 ? primary 'Beerbaum, M.' 13 ? primary 'Motzny, K.' 14 ? primary 'Roske, Y.' 15 ? primary 'Schmieder, P.' 16 0000-0001-9968-9327 primary 'Volkmer, R.' 17 ? primary 'Nazare, M.' 18 0000-0002-1602-2330 primary 'Heinemann, U.' 19 0000-0002-8191-3850 primary 'Oschkinat, H.' 20 ? primary 'Ten Dijke, P.' 21 ? primary 'Schmalz, H.G.' 22 0000-0003-0489-1827 primary 'Kuhne, R.' 23 ? 1 'Opitz, R.' 24 ? 1 'Mueller, M.' 25 ? 1 'Reuter, C.' 26 ? 1 'Barone, M.' 27 ? 1 'Soicke, A.' 28 ? 1 'Roske, Y.' 29 ? 1 'Piotukh, K.' 30 ? 1 'Huy, P.' 31 ? 1 'Beerbaum, M.' 32 ? 1 'Wiesner, B.' 33 ? 1 'Beyermann, M.' 34 ? 1 'Schmieder, P.' 35 ? 1 'Freund, C.' 36 ? 1 'Volkmer, R.' 37 ? 1 'Oschkinat, H.' 38 ? 1 'Schmalz, H.G.' 39 ? 1 'Kuehne, R.' 40 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein enabled homolog' 12628.273 1 ? ? ? ? 2 non-polymer syn ;(3~{S},7~{R},10~{R},13~{R})-4-[(3~{S},6~{R},8~{a}~{S})-1'-[(2~{S})-2-acetamido-3-(2-chlorophenyl)propanoyl]-5-oxidanylidene-spiro[1,2,3,8~{a}-tetrahydroindolizine-6,2'-pyrrolidine]-3-yl]carbonyl-2-oxidanylidene-1,4-diazatricyclo[8.3.0.0^{3,7}]tridec-8-ene-13-carboxylic acid ; 678.174 1 ? ? ? ? 3 non-polymer syn 'NITRATE ION' 62.005 2 ? ? ? ? 4 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 5 water nat water 18.015 78 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSMSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFH QWRDARQVYGLNFGSKEDANVFASAMMHALEVL ; _entity_poly.pdbx_seq_one_letter_code_can ;GSMSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFH QWRDARQVYGLNFGSKEDANVFASAMMHALEVL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;(3~{S},7~{R},10~{R},13~{R})-4-[(3~{S},6~{R},8~{a}~{S})-1'-[(2~{S})-2-acetamido-3-(2-chlorophenyl)propanoyl]-5-oxidanylidene-spiro[1,2,3,8~{a}-tetrahydroindolizine-6,2'-pyrrolidine]-3-yl]carbonyl-2-oxidanylidene-1,4-diazatricyclo[8.3.0.0^{3,7}]tridec-8-ene-13-carboxylic acid ; EG5 3 'NITRATE ION' NO3 4 'SULFATE ION' SO4 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MET n 1 4 SER n 1 5 GLU n 1 6 GLN n 1 7 SER n 1 8 ILE n 1 9 CYS n 1 10 GLN n 1 11 ALA n 1 12 ARG n 1 13 ALA n 1 14 ALA n 1 15 VAL n 1 16 MET n 1 17 VAL n 1 18 TYR n 1 19 ASP n 1 20 ASP n 1 21 ALA n 1 22 ASN n 1 23 LYS n 1 24 LYS n 1 25 TRP n 1 26 VAL n 1 27 PRO n 1 28 ALA n 1 29 GLY n 1 30 GLY n 1 31 SER n 1 32 THR n 1 33 GLY n 1 34 PHE n 1 35 SER n 1 36 ARG n 1 37 VAL n 1 38 HIS n 1 39 ILE n 1 40 TYR n 1 41 HIS n 1 42 HIS n 1 43 THR n 1 44 GLY n 1 45 ASN n 1 46 ASN n 1 47 THR n 1 48 PHE n 1 49 ARG n 1 50 VAL n 1 51 VAL n 1 52 GLY n 1 53 ARG n 1 54 LYS n 1 55 ILE n 1 56 GLN n 1 57 ASP n 1 58 HIS n 1 59 GLN n 1 60 VAL n 1 61 VAL n 1 62 ILE n 1 63 ASN n 1 64 CYS n 1 65 ALA n 1 66 ILE n 1 67 PRO n 1 68 LYS n 1 69 GLY n 1 70 LEU n 1 71 LYS n 1 72 TYR n 1 73 ASN n 1 74 GLN n 1 75 ALA n 1 76 THR n 1 77 GLN n 1 78 THR n 1 79 PHE n 1 80 HIS n 1 81 GLN n 1 82 TRP n 1 83 ARG n 1 84 ASP n 1 85 ALA n 1 86 ARG n 1 87 GLN n 1 88 VAL n 1 89 TYR n 1 90 GLY n 1 91 LEU n 1 92 ASN n 1 93 PHE n 1 94 GLY n 1 95 SER n 1 96 LYS n 1 97 GLU n 1 98 ASP n 1 99 ALA n 1 100 ASN n 1 101 VAL n 1 102 PHE n 1 103 ALA n 1 104 SER n 1 105 ALA n 1 106 MET n 1 107 MET n 1 108 HIS n 1 109 ALA n 1 110 LEU n 1 111 GLU n 1 112 VAL n 1 113 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 113 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ENAH, MENA' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX-4T-1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EG5 non-polymer . ;(3~{S},7~{R},10~{R},13~{R})-4-[(3~{S},6~{R},8~{a}~{S})-1'-[(2~{S})-2-acetamido-3-(2-chlorophenyl)propanoyl]-5-oxidanylidene-spiro[1,2,3,8~{a}-tetrahydroindolizine-6,2'-pyrrolidine]-3-yl]carbonyl-2-oxidanylidene-1,4-diazatricyclo[8.3.0.0^{3,7}]tridec-8-ene-13-carboxylic acid ; ? 'C35 H40 Cl N5 O7' 678.174 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NO3 non-polymer . 'NITRATE ION' ? 'N O3 -1' 62.005 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 ? ? ? A . n A 1 2 SER 2 0 ? ? ? A . n A 1 3 MET 3 1 ? ? ? A . n A 1 4 SER 4 2 ? ? ? A . n A 1 5 GLU 5 3 3 GLU GLU A . n A 1 6 GLN 6 4 4 GLN GLN A . n A 1 7 SER 7 5 5 SER SER A . n A 1 8 ILE 8 6 6 ILE ILE A . n A 1 9 CYS 9 7 7 CYS CYS A . n A 1 10 GLN 10 8 8 GLN GLN A . n A 1 11 ALA 11 9 9 ALA ALA A . n A 1 12 ARG 12 10 10 ARG ARG A . n A 1 13 ALA 13 11 11 ALA ALA A . n A 1 14 ALA 14 12 12 ALA ALA A . n A 1 15 VAL 15 13 13 VAL VAL A . n A 1 16 MET 16 14 14 MET MET A . n A 1 17 VAL 17 15 15 VAL VAL A . n A 1 18 TYR 18 16 16 TYR TYR A . n A 1 19 ASP 19 17 17 ASP ASP A . n A 1 20 ASP 20 18 18 ASP ASP A . n A 1 21 ALA 21 19 19 ALA ALA A . n A 1 22 ASN 22 20 20 ASN ASN A . n A 1 23 LYS 23 21 21 LYS LYS A . n A 1 24 LYS 24 22 22 LYS LYS A . n A 1 25 TRP 25 23 23 TRP TRP A . n A 1 26 VAL 26 24 24 VAL VAL A . n A 1 27 PRO 27 25 25 PRO PRO A . n A 1 28 ALA 28 26 26 ALA ALA A . n A 1 29 GLY 29 27 27 GLY GLY A . n A 1 30 GLY 30 28 28 GLY GLY A . n A 1 31 SER 31 29 29 SER SER A . n A 1 32 THR 32 30 30 THR THR A . n A 1 33 GLY 33 31 31 GLY GLY A . n A 1 34 PHE 34 32 32 PHE PHE A . n A 1 35 SER 35 33 33 SER SER A . n A 1 36 ARG 36 34 34 ARG ARG A . n A 1 37 VAL 37 35 35 VAL VAL A . n A 1 38 HIS 38 36 36 HIS HIS A . n A 1 39 ILE 39 37 37 ILE ILE A . n A 1 40 TYR 40 38 38 TYR TYR A . n A 1 41 HIS 41 39 39 HIS HIS A . n A 1 42 HIS 42 40 40 HIS HIS A . n A 1 43 THR 43 41 41 THR THR A . n A 1 44 GLY 44 42 42 GLY GLY A . n A 1 45 ASN 45 43 43 ASN ASN A . n A 1 46 ASN 46 44 44 ASN ASN A . n A 1 47 THR 47 45 45 THR THR A . n A 1 48 PHE 48 46 46 PHE PHE A . n A 1 49 ARG 49 47 47 ARG ARG A . n A 1 50 VAL 50 48 48 VAL VAL A . n A 1 51 VAL 51 49 49 VAL VAL A . n A 1 52 GLY 52 50 50 GLY GLY A . n A 1 53 ARG 53 51 51 ARG ARG A . n A 1 54 LYS 54 52 52 LYS LYS A . n A 1 55 ILE 55 53 53 ILE ILE A . n A 1 56 GLN 56 54 54 GLN GLN A . n A 1 57 ASP 57 55 55 ASP ASP A . n A 1 58 HIS 58 56 56 HIS HIS A . n A 1 59 GLN 59 57 57 GLN GLN A . n A 1 60 VAL 60 58 58 VAL VAL A . n A 1 61 VAL 61 59 59 VAL VAL A . n A 1 62 ILE 62 60 60 ILE ILE A . n A 1 63 ASN 63 61 61 ASN ASN A . n A 1 64 CYS 64 62 62 CYS CYS A . n A 1 65 ALA 65 63 63 ALA ALA A . n A 1 66 ILE 66 64 64 ILE ILE A . n A 1 67 PRO 67 65 65 PRO PRO A . n A 1 68 LYS 68 66 66 LYS LYS A . n A 1 69 GLY 69 67 67 GLY GLY A . n A 1 70 LEU 70 68 68 LEU LEU A . n A 1 71 LYS 71 69 69 LYS LYS A . n A 1 72 TYR 72 70 70 TYR TYR A . n A 1 73 ASN 73 71 71 ASN ASN A . n A 1 74 GLN 74 72 72 GLN GLN A . n A 1 75 ALA 75 73 73 ALA ALA A . n A 1 76 THR 76 74 74 THR THR A . n A 1 77 GLN 77 75 75 GLN GLN A . n A 1 78 THR 78 76 76 THR THR A . n A 1 79 PHE 79 77 77 PHE PHE A . n A 1 80 HIS 80 78 78 HIS HIS A . n A 1 81 GLN 81 79 79 GLN GLN A . n A 1 82 TRP 82 80 80 TRP TRP A . n A 1 83 ARG 83 81 81 ARG ARG A . n A 1 84 ASP 84 82 82 ASP ASP A . n A 1 85 ALA 85 83 83 ALA ALA A . n A 1 86 ARG 86 84 84 ARG ARG A . n A 1 87 GLN 87 85 85 GLN GLN A . n A 1 88 VAL 88 86 86 VAL VAL A . n A 1 89 TYR 89 87 87 TYR TYR A . n A 1 90 GLY 90 88 88 GLY GLY A . n A 1 91 LEU 91 89 89 LEU LEU A . n A 1 92 ASN 92 90 90 ASN ASN A . n A 1 93 PHE 93 91 91 PHE PHE A . n A 1 94 GLY 94 92 92 GLY GLY A . n A 1 95 SER 95 93 93 SER SER A . n A 1 96 LYS 96 94 94 LYS LYS A . n A 1 97 GLU 97 95 95 GLU GLU A . n A 1 98 ASP 98 96 96 ASP ASP A . n A 1 99 ALA 99 97 97 ALA ALA A . n A 1 100 ASN 100 98 98 ASN ASN A . n A 1 101 VAL 101 99 99 VAL VAL A . n A 1 102 PHE 102 100 100 PHE PHE A . n A 1 103 ALA 103 101 101 ALA ALA A . n A 1 104 SER 104 102 102 SER SER A . n A 1 105 ALA 105 103 103 ALA ALA A . n A 1 106 MET 106 104 104 MET MET A . n A 1 107 MET 107 105 105 MET MET A . n A 1 108 HIS 108 106 106 HIS HIS A . n A 1 109 ALA 109 107 107 ALA ALA A . n A 1 110 LEU 110 108 108 LEU LEU A . n A 1 111 GLU 111 109 109 GLU GLU A . n A 1 112 VAL 112 110 110 VAL VAL A . n A 1 113 LEU 113 111 111 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EG5 1 201 1 EG5 210 A . C 3 NO3 1 202 1 NO3 NO3 A . D 3 NO3 1 203 2 NO3 NO3 A . E 4 SO4 1 204 1 SO4 SO4 A . F 5 HOH 1 301 58 HOH HOH A . F 5 HOH 2 302 73 HOH HOH A . F 5 HOH 3 303 39 HOH HOH A . F 5 HOH 4 304 19 HOH HOH A . F 5 HOH 5 305 78 HOH HOH A . F 5 HOH 6 306 72 HOH HOH A . F 5 HOH 7 307 49 HOH HOH A . F 5 HOH 8 308 26 HOH HOH A . F 5 HOH 9 309 2 HOH HOH A . F 5 HOH 10 310 48 HOH HOH A . F 5 HOH 11 311 41 HOH HOH A . F 5 HOH 12 312 17 HOH HOH A . F 5 HOH 13 313 27 HOH HOH A . F 5 HOH 14 314 11 HOH HOH A . F 5 HOH 15 315 55 HOH HOH A . F 5 HOH 16 316 10 HOH HOH A . F 5 HOH 17 317 75 HOH HOH A . F 5 HOH 18 318 51 HOH HOH A . F 5 HOH 19 319 9 HOH HOH A . F 5 HOH 20 320 74 HOH HOH A . F 5 HOH 21 321 37 HOH HOH A . F 5 HOH 22 322 70 HOH HOH A . F 5 HOH 23 323 64 HOH HOH A . F 5 HOH 24 324 44 HOH HOH A . F 5 HOH 25 325 14 HOH HOH A . F 5 HOH 26 326 62 HOH HOH A . F 5 HOH 27 327 50 HOH HOH A . F 5 HOH 28 328 45 HOH HOH A . F 5 HOH 29 329 6 HOH HOH A . F 5 HOH 30 330 69 HOH HOH A . F 5 HOH 31 331 13 HOH HOH A . F 5 HOH 32 332 52 HOH HOH A . F 5 HOH 33 333 71 HOH HOH A . F 5 HOH 34 334 3 HOH HOH A . F 5 HOH 35 335 23 HOH HOH A . F 5 HOH 36 336 67 HOH HOH A . F 5 HOH 37 337 12 HOH HOH A . F 5 HOH 38 338 21 HOH HOH A . F 5 HOH 39 339 5 HOH HOH A . F 5 HOH 40 340 42 HOH HOH A . F 5 HOH 41 341 22 HOH HOH A . F 5 HOH 42 342 47 HOH HOH A . F 5 HOH 43 343 16 HOH HOH A . F 5 HOH 44 344 38 HOH HOH A . F 5 HOH 45 345 4 HOH HOH A . F 5 HOH 46 346 63 HOH HOH A . F 5 HOH 47 347 1 HOH HOH A . F 5 HOH 48 348 34 HOH HOH A . F 5 HOH 49 349 57 HOH HOH A . F 5 HOH 50 350 18 HOH HOH A . F 5 HOH 51 351 60 HOH HOH A . F 5 HOH 52 352 32 HOH HOH A . F 5 HOH 53 353 43 HOH HOH A . F 5 HOH 54 354 8 HOH HOH A . F 5 HOH 55 355 46 HOH HOH A . F 5 HOH 56 356 59 HOH HOH A . F 5 HOH 57 357 7 HOH HOH A . F 5 HOH 58 358 68 HOH HOH A . F 5 HOH 59 359 77 HOH HOH A . F 5 HOH 60 360 31 HOH HOH A . F 5 HOH 61 361 28 HOH HOH A . F 5 HOH 62 362 66 HOH HOH A . F 5 HOH 63 363 15 HOH HOH A . F 5 HOH 64 364 24 HOH HOH A . F 5 HOH 65 365 33 HOH HOH A . F 5 HOH 66 366 65 HOH HOH A . F 5 HOH 67 367 76 HOH HOH A . F 5 HOH 68 368 80 HOH HOH A . F 5 HOH 69 369 29 HOH HOH A . F 5 HOH 70 370 56 HOH HOH A . F 5 HOH 71 371 25 HOH HOH A . F 5 HOH 72 372 79 HOH HOH A . F 5 HOH 73 373 81 HOH HOH A . F 5 HOH 74 374 36 HOH HOH A . F 5 HOH 75 375 53 HOH HOH A . F 5 HOH 76 376 54 HOH HOH A . F 5 HOH 77 377 20 HOH HOH A . F 5 HOH 78 378 35 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.11.1_2575: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5NCP _cell.details ? _cell.formula_units_Z ? _cell.length_a 44.141 _cell.length_a_esd ? _cell.length_b 141.367 _cell.length_b_esd ? _cell.length_c 34.706 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5NCP _symmetry.cell_setting ? _symmetry.Int_Tables_number 21 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5NCP _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.13 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 42.3 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7. _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293.15 _exptl_crystal_grow.temp_details 'plate hotel' _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.7M ammonium sulfate, 180mM ammonium nitrate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-05-20 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.918409 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'BESSY BEAMLINE 14.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.918409 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 14.1 _diffrn_source.pdbx_synchrotron_site BESSY # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5NCP _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.65 _reflns.d_resolution_low 42.135 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13548 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.5 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.14 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.200 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.65 _reflns_shell.d_res_low 1.75 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.97 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2144 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 8.4 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 2.106 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.433 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5NCP _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.650 _refine.ls_d_res_low 42.135 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13543 _refine.ls_number_reflns_R_free 677 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.90 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1856 _refine.ls_R_factor_R_free 0.2083 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1845 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5NCG _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.36 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.25 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 863 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 61 _refine_hist.number_atoms_solvent 78 _refine_hist.number_atoms_total 1002 _refine_hist.d_res_high 1.650 _refine_hist.d_res_low 42.135 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 ? 987 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.268 ? 1347 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 16.340 ? 654 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.061 ? 140 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 177 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.6497 1.7770 . . 132 2509 100.00 . . . 0.3481 . 0.3152 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7770 1.9559 . . 132 2529 100.00 . . . 0.2885 . 0.2544 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9559 2.2389 . . 135 2555 100.00 . . . 0.2117 . 0.1916 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2389 2.8207 . . 135 2572 100.00 . . . 0.2063 . 0.1766 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8207 42.1485 . . 143 2701 100.00 . . . 0.1756 . 0.1562 . . . . . . . . . . # _struct.entry_id 5NCP _struct.title 'ENAH EVH1 in complex with Ac-[2-Cl-F]-[ProM-2]-[ProM-12]-OH' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5NCP _struct_keywords.text 'proline-rich motif, Ena/VASP inhibitor, actin, protein-protein interaction, cell adhesion' _struct_keywords.pdbx_keywords 'CELL ADHESION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ENAH_HUMAN _struct_ref.pdbx_db_accession Q8N8S7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQW RDARQVYGLNFGSKEDANVFASAMMHALEVL ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5NCP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 113 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8N8S7 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 111 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 111 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5NCP GLY A 1 ? UNP Q8N8S7 ? ? 'expression tag' -1 1 1 5NCP SER A 2 ? UNP Q8N8S7 ? ? 'expression tag' 0 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 430 ? 1 MORE -12 ? 1 'SSA (A^2)' 6530 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details 'Tetramerization of Ena/VASP is mediated by EVH2 domain (Bachmann1999)' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 29 ? SER A 31 ? GLY A 27 SER A 29 5 ? 3 HELX_P HELX_P2 AA2 SER A 95 ? LEU A 113 ? SER A 93 LEU A 111 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 24 ? PRO A 27 ? LYS A 22 PRO A 25 AA1 2 GLN A 6 ? ASP A 19 ? GLN A 4 ASP A 17 AA1 3 SER A 35 ? HIS A 42 ? SER A 33 HIS A 40 AA1 4 THR A 47 ? LYS A 54 ? THR A 45 LYS A 52 AA1 5 VAL A 60 ? ALA A 65 ? VAL A 58 ALA A 63 AA2 1 LYS A 24 ? PRO A 27 ? LYS A 22 PRO A 25 AA2 2 GLN A 6 ? ASP A 19 ? GLN A 4 ASP A 17 AA2 3 VAL A 88 ? PHE A 93 ? VAL A 86 PHE A 91 AA2 4 PHE A 79 ? ARG A 83 ? PHE A 77 ARG A 81 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LYS A 24 ? O LYS A 22 N ASP A 19 ? N ASP A 17 AA1 2 3 N GLN A 6 ? N GLN A 4 O HIS A 41 ? O HIS A 39 AA1 3 4 N HIS A 38 ? N HIS A 36 O VAL A 51 ? O VAL A 49 AA1 4 5 N VAL A 50 ? N VAL A 48 O CYS A 64 ? O CYS A 62 AA2 1 2 O LYS A 24 ? O LYS A 22 N ASP A 19 ? N ASP A 17 AA2 2 3 N MET A 16 ? N MET A 14 O GLY A 90 ? O GLY A 88 AA2 3 4 O LEU A 91 ? O LEU A 89 N HIS A 80 ? N HIS A 78 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A EG5 201 ? 19 'binding site for residue EG5 A 201' AC2 Software A NO3 202 ? 5 'binding site for residue NO3 A 202' AC3 Software A NO3 203 ? 2 'binding site for residue NO3 A 203' AC4 Software A SO4 204 ? 5 'binding site for residue SO4 A 204' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 19 TYR A 18 ? TYR A 16 . ? 3_755 ? 2 AC1 19 TYR A 18 ? TYR A 16 . ? 1_555 ? 3 AC1 19 ASP A 20 ? ASP A 18 . ? 3_755 ? 4 AC1 19 LYS A 23 ? LYS A 21 . ? 3_755 ? 5 AC1 19 TRP A 25 ? TRP A 23 . ? 1_555 ? 6 AC1 19 LYS A 71 ? LYS A 69 . ? 1_555 ? 7 AC1 19 ASN A 73 ? ASN A 71 . ? 1_555 ? 8 AC1 19 THR A 76 ? THR A 74 . ? 6_755 ? 9 AC1 19 PHE A 79 ? PHE A 77 . ? 1_555 ? 10 AC1 19 GLN A 81 ? GLN A 79 . ? 1_555 ? 11 AC1 19 ARG A 83 ? ARG A 81 . ? 1_555 ? 12 AC1 19 VAL A 88 ? VAL A 86 . ? 1_555 ? 13 AC1 19 HOH F . ? HOH A 313 . ? 6_755 ? 14 AC1 19 HOH F . ? HOH A 318 . ? 6_755 ? 15 AC1 19 HOH F . ? HOH A 327 . ? 1_555 ? 16 AC1 19 HOH F . ? HOH A 335 . ? 1_555 ? 17 AC1 19 HOH F . ? HOH A 352 . ? 1_555 ? 18 AC1 19 HOH F . ? HOH A 355 . ? 1_555 ? 19 AC1 19 HOH F . ? HOH A 362 . ? 1_555 ? 20 AC2 5 GLN A 10 ? GLN A 8 . ? 1_555 ? 21 AC2 5 ALA A 11 ? ALA A 9 . ? 1_555 ? 22 AC2 5 ARG A 12 ? ARG A 10 . ? 1_555 ? 23 AC2 5 ARG A 36 ? ARG A 34 . ? 1_555 ? 24 AC2 5 ASP A 98 ? ASP A 96 . ? 1_555 ? 25 AC3 2 ARG A 49 ? ARG A 47 . ? 1_555 ? 26 AC3 2 HOH F . ? HOH A 303 . ? 1_555 ? 27 AC4 5 ARG A 36 ? ARG A 34 . ? 1_555 ? 28 AC4 5 HIS A 38 ? HIS A 36 . ? 1_555 ? 29 AC4 5 ARG A 53 ? ARG A 51 . ? 1_555 ? 30 AC4 5 HOH F . ? HOH A 308 . ? 1_555 ? 31 AC4 5 HOH F . ? HOH A 326 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD1 A ASP 82 ? ? H A GLN 85 ? ? 1.56 2 1 OE1 A GLN 57 ? ? O A HOH 301 ? ? 2.10 3 1 O A HOH 354 ? ? O A HOH 356 ? ? 2.18 4 1 SG A CYS 62 ? B O A HOH 306 ? ? 2.19 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 336 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 336 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 3_755 _pdbx_validate_symm_contact.dist 1.77 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 61 ? ? -156.84 83.85 2 1 ASN A 61 ? ? -156.84 88.46 # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 55.4977 19.2854 11.6686 0.1232 0.1014 0.1354 -0.0264 0.0208 0.0080 8.0908 0.8126 2.8910 -2.6674 1.2478 -0.4545 -0.1418 -0.1773 0.0098 0.0388 0.1253 0.0625 0.0426 0.1177 0.0846 'X-RAY DIFFRACTION' 2 ? refined 44.0770 29.1661 11.9776 0.2144 0.1991 0.2639 0.0577 0.0006 -0.0790 8.1793 4.8665 8.1469 -5.1809 4.4372 -5.8498 -0.0712 -0.1300 0.2213 0.3452 0.0646 0.5123 -0.4444 -0.3718 -0.0554 'X-RAY DIFFRACTION' 3 ? refined 56.4746 12.5033 12.1652 0.1471 0.1193 0.1281 -0.0066 0.0027 0.0090 3.1027 6.6953 8.5272 0.8703 0.2533 6.4970 -0.0144 -0.0356 -0.2176 0.3802 -0.0955 0.0151 0.6294 -0.1379 0.1026 'X-RAY DIFFRACTION' 4 ? refined 52.8118 16.3170 18.1604 0.1681 0.2841 0.1862 0.0059 0.0265 -0.0298 2.9196 8.1047 8.7602 0.7510 4.9314 0.5398 -0.2246 -0.0711 -0.2874 0.3694 0.2334 -0.0131 -0.0159 0.1730 0.0477 'X-RAY DIFFRACTION' 5 ? refined 55.9035 21.3865 0.0434 0.1449 0.1654 0.1546 0.0472 0.0007 -0.0058 8.8132 4.6533 8.2243 6.4061 5.2844 5.1132 0.0999 0.2220 -0.1539 -0.1127 -0.0921 -0.4213 0.1172 0.0785 0.1489 'X-RAY DIFFRACTION' 6 ? refined 48.7556 21.7715 4.3879 0.1728 0.2612 0.2681 -0.0245 -0.0210 -0.0430 4.8294 7.3095 4.6043 5.5043 4.6222 4.4883 0.2270 0.3185 0.3887 0.2853 -0.2484 0.5326 0.3812 -0.1957 -0.0833 'X-RAY DIFFRACTION' 7 ? refined 60.7585 19.1336 4.2479 0.1177 0.1340 0.0852 0.0076 -0.0035 0.0425 5.6547 6.6824 5.6506 0.1224 0.9496 3.6531 0.0030 0.3513 -0.1362 -0.0887 0.0868 -0.2350 0.0881 0.2941 -0.0921 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 3 through 17 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 18 through 28 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 29 through 52 ) ; 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 53 through 63 ) ; 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 64 through 76 ) ; 'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 77 through 85 ) ; 'X-RAY DIFFRACTION' 7 7 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 86 through 111 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -1 ? A GLY 1 2 1 Y 1 A SER 0 ? A SER 2 3 1 Y 1 A MET 1 ? A MET 3 4 1 Y 1 A SER 2 ? A SER 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 EG5 C32 C N N 88 EG5 O5 O N N 89 EG5 C33 C N N 90 EG5 CL CL N N 91 EG5 C15 C Y N 92 EG5 C19 C Y N 93 EG5 C18 C Y N 94 EG5 C17 C Y N 95 EG5 C16 C Y N 96 EG5 C14 C Y N 97 EG5 C13 C N N 98 EG5 C12 C N S 99 EG5 N4 N N N 100 EG5 C11 C N N 101 EG5 O4 O N N 102 EG5 N5 N N N 103 EG5 C30 C N N 104 EG5 C29 C N N 105 EG5 C34 C N N 106 EG5 C35 C N R 107 EG5 C31 C N N 108 EG5 O3 O N N 109 EG5 N3 N N N 110 EG5 C26 C N N 111 EG5 C28 C N N 112 EG5 C27 C N S 113 EG5 C24 C N N 114 EG5 C9 C N N 115 EG5 C10 C N S 116 EG5 C20 C N N 117 EG5 O6 O N N 118 EG5 N2 N N N 119 EG5 C22 C N N 120 EG5 C23 C N N 121 EG5 C8 C N R 122 EG5 C21 C N S 123 EG5 C25 C N N 124 EG5 O7 O N N 125 EG5 C7 C N N 126 EG5 C6 C N N 127 EG5 C5 C N R 128 EG5 C4 C N N 129 EG5 C3 C N N 130 EG5 C2 C N R 131 EG5 N1 N N N 132 EG5 C1 C N N 133 EG5 O2 O N N 134 EG5 O1 O N N 135 EG5 H10 H N N 136 EG5 H11 H N N 137 EG5 H9 H N N 138 EG5 H1 H N N 139 EG5 H2 H N N 140 EG5 H3 H N N 141 EG5 H4 H N N 142 EG5 H5 H N N 143 EG5 H6 H N N 144 EG5 H7 H N N 145 EG5 H8 H N N 146 EG5 H12 H N N 147 EG5 H13 H N N 148 EG5 H15 H N N 149 EG5 H14 H N N 150 EG5 H17 H N N 151 EG5 H16 H N N 152 EG5 H18 H N N 153 EG5 H19 H N N 154 EG5 H20 H N N 155 EG5 H21 H N N 156 EG5 H22 H N N 157 EG5 H23 H N N 158 EG5 H24 H N N 159 EG5 H25 H N N 160 EG5 H27 H N N 161 EG5 H26 H N N 162 EG5 H28 H N N 163 EG5 H29 H N N 164 EG5 H30 H N N 165 EG5 H31 H N N 166 EG5 H32 H N N 167 EG5 H33 H N N 168 EG5 H34 H N N 169 EG5 H35 H N N 170 EG5 H42 H N N 171 EG5 H38 H N N 172 EG5 H36 H N N 173 EG5 H37 H N N 174 EG5 H39 H N N 175 GLN N N N N 176 GLN CA C N S 177 GLN C C N N 178 GLN O O N N 179 GLN CB C N N 180 GLN CG C N N 181 GLN CD C N N 182 GLN OE1 O N N 183 GLN NE2 N N N 184 GLN OXT O N N 185 GLN H H N N 186 GLN H2 H N N 187 GLN HA H N N 188 GLN HB2 H N N 189 GLN HB3 H N N 190 GLN HG2 H N N 191 GLN HG3 H N N 192 GLN HE21 H N N 193 GLN HE22 H N N 194 GLN HXT H N N 195 GLU N N N N 196 GLU CA C N S 197 GLU C C N N 198 GLU O O N N 199 GLU CB C N N 200 GLU CG C N N 201 GLU CD C N N 202 GLU OE1 O N N 203 GLU OE2 O N N 204 GLU OXT O N N 205 GLU H H N N 206 GLU H2 H N N 207 GLU HA H N N 208 GLU HB2 H N N 209 GLU HB3 H N N 210 GLU HG2 H N N 211 GLU HG3 H N N 212 GLU HE2 H N N 213 GLU HXT H N N 214 GLY N N N N 215 GLY CA C N N 216 GLY C C N N 217 GLY O O N N 218 GLY OXT O N N 219 GLY H H N N 220 GLY H2 H N N 221 GLY HA2 H N N 222 GLY HA3 H N N 223 GLY HXT H N N 224 HIS N N N N 225 HIS CA C N S 226 HIS C C N N 227 HIS O O N N 228 HIS CB C N N 229 HIS CG C Y N 230 HIS ND1 N Y N 231 HIS CD2 C Y N 232 HIS CE1 C Y N 233 HIS NE2 N Y N 234 HIS OXT O N N 235 HIS H H N N 236 HIS H2 H N N 237 HIS HA H N N 238 HIS HB2 H N N 239 HIS HB3 H N N 240 HIS HD1 H N N 241 HIS HD2 H N N 242 HIS HE1 H N N 243 HIS HE2 H N N 244 HIS HXT H N N 245 HOH O O N N 246 HOH H1 H N N 247 HOH H2 H N N 248 ILE N N N N 249 ILE CA C N S 250 ILE C C N N 251 ILE O O N N 252 ILE CB C N S 253 ILE CG1 C N N 254 ILE CG2 C N N 255 ILE CD1 C N N 256 ILE OXT O N N 257 ILE H H N N 258 ILE H2 H N N 259 ILE HA H N N 260 ILE HB H N N 261 ILE HG12 H N N 262 ILE HG13 H N N 263 ILE HG21 H N N 264 ILE HG22 H N N 265 ILE HG23 H N N 266 ILE HD11 H N N 267 ILE HD12 H N N 268 ILE HD13 H N N 269 ILE HXT H N N 270 LEU N N N N 271 LEU CA C N S 272 LEU C C N N 273 LEU O O N N 274 LEU CB C N N 275 LEU CG C N N 276 LEU CD1 C N N 277 LEU CD2 C N N 278 LEU OXT O N N 279 LEU H H N N 280 LEU H2 H N N 281 LEU HA H N N 282 LEU HB2 H N N 283 LEU HB3 H N N 284 LEU HG H N N 285 LEU HD11 H N N 286 LEU HD12 H N N 287 LEU HD13 H N N 288 LEU HD21 H N N 289 LEU HD22 H N N 290 LEU HD23 H N N 291 LEU HXT H N N 292 LYS N N N N 293 LYS CA C N S 294 LYS C C N N 295 LYS O O N N 296 LYS CB C N N 297 LYS CG C N N 298 LYS CD C N N 299 LYS CE C N N 300 LYS NZ N N N 301 LYS OXT O N N 302 LYS H H N N 303 LYS H2 H N N 304 LYS HA H N N 305 LYS HB2 H N N 306 LYS HB3 H N N 307 LYS HG2 H N N 308 LYS HG3 H N N 309 LYS HD2 H N N 310 LYS HD3 H N N 311 LYS HE2 H N N 312 LYS HE3 H N N 313 LYS HZ1 H N N 314 LYS HZ2 H N N 315 LYS HZ3 H N N 316 LYS HXT H N N 317 MET N N N N 318 MET CA C N S 319 MET C C N N 320 MET O O N N 321 MET CB C N N 322 MET CG C N N 323 MET SD S N N 324 MET CE C N N 325 MET OXT O N N 326 MET H H N N 327 MET H2 H N N 328 MET HA H N N 329 MET HB2 H N N 330 MET HB3 H N N 331 MET HG2 H N N 332 MET HG3 H N N 333 MET HE1 H N N 334 MET HE2 H N N 335 MET HE3 H N N 336 MET HXT H N N 337 NO3 N N N N 338 NO3 O1 O N N 339 NO3 O2 O N N 340 NO3 O3 O N N 341 PHE N N N N 342 PHE CA C N S 343 PHE C C N N 344 PHE O O N N 345 PHE CB C N N 346 PHE CG C Y N 347 PHE CD1 C Y N 348 PHE CD2 C Y N 349 PHE CE1 C Y N 350 PHE CE2 C Y N 351 PHE CZ C Y N 352 PHE OXT O N N 353 PHE H H N N 354 PHE H2 H N N 355 PHE HA H N N 356 PHE HB2 H N N 357 PHE HB3 H N N 358 PHE HD1 H N N 359 PHE HD2 H N N 360 PHE HE1 H N N 361 PHE HE2 H N N 362 PHE HZ H N N 363 PHE HXT H N N 364 PRO N N N N 365 PRO CA C N S 366 PRO C C N N 367 PRO O O N N 368 PRO CB C N N 369 PRO CG C N N 370 PRO CD C N N 371 PRO OXT O N N 372 PRO H H N N 373 PRO HA H N N 374 PRO HB2 H N N 375 PRO HB3 H N N 376 PRO HG2 H N N 377 PRO HG3 H N N 378 PRO HD2 H N N 379 PRO HD3 H N N 380 PRO HXT H N N 381 SER N N N N 382 SER CA C N S 383 SER C C N N 384 SER O O N N 385 SER CB C N N 386 SER OG O N N 387 SER OXT O N N 388 SER H H N N 389 SER H2 H N N 390 SER HA H N N 391 SER HB2 H N N 392 SER HB3 H N N 393 SER HG H N N 394 SER HXT H N N 395 SO4 S S N N 396 SO4 O1 O N N 397 SO4 O2 O N N 398 SO4 O3 O N N 399 SO4 O4 O N N 400 THR N N N N 401 THR CA C N S 402 THR C C N N 403 THR O O N N 404 THR CB C N R 405 THR OG1 O N N 406 THR CG2 C N N 407 THR OXT O N N 408 THR H H N N 409 THR H2 H N N 410 THR HA H N N 411 THR HB H N N 412 THR HG1 H N N 413 THR HG21 H N N 414 THR HG22 H N N 415 THR HG23 H N N 416 THR HXT H N N 417 TRP N N N N 418 TRP CA C N S 419 TRP C C N N 420 TRP O O N N 421 TRP CB C N N 422 TRP CG C Y N 423 TRP CD1 C Y N 424 TRP CD2 C Y N 425 TRP NE1 N Y N 426 TRP CE2 C Y N 427 TRP CE3 C Y N 428 TRP CZ2 C Y N 429 TRP CZ3 C Y N 430 TRP CH2 C Y N 431 TRP OXT O N N 432 TRP H H N N 433 TRP H2 H N N 434 TRP HA H N N 435 TRP HB2 H N N 436 TRP HB3 H N N 437 TRP HD1 H N N 438 TRP HE1 H N N 439 TRP HE3 H N N 440 TRP HZ2 H N N 441 TRP HZ3 H N N 442 TRP HH2 H N N 443 TRP HXT H N N 444 TYR N N N N 445 TYR CA C N S 446 TYR C C N N 447 TYR O O N N 448 TYR CB C N N 449 TYR CG C Y N 450 TYR CD1 C Y N 451 TYR CD2 C Y N 452 TYR CE1 C Y N 453 TYR CE2 C Y N 454 TYR CZ C Y N 455 TYR OH O N N 456 TYR OXT O N N 457 TYR H H N N 458 TYR H2 H N N 459 TYR HA H N N 460 TYR HB2 H N N 461 TYR HB3 H N N 462 TYR HD1 H N N 463 TYR HD2 H N N 464 TYR HE1 H N N 465 TYR HE2 H N N 466 TYR HH H N N 467 TYR HXT H N N 468 VAL N N N N 469 VAL CA C N S 470 VAL C C N N 471 VAL O O N N 472 VAL CB C N N 473 VAL CG1 C N N 474 VAL CG2 C N N 475 VAL OXT O N N 476 VAL H H N N 477 VAL H2 H N N 478 VAL HA H N N 479 VAL HB H N N 480 VAL HG11 H N N 481 VAL HG12 H N N 482 VAL HG13 H N N 483 VAL HG21 H N N 484 VAL HG22 H N N 485 VAL HG23 H N N 486 VAL HXT H N N 487 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EG5 C17 C18 doub Y N 83 EG5 C17 C16 sing Y N 84 EG5 C33 C32 sing N N 85 EG5 C18 C19 sing Y N 86 EG5 C16 C14 doub Y N 87 EG5 C32 N4 sing N N 88 EG5 C32 O5 doub N N 89 EG5 N4 C12 sing N N 90 EG5 C19 C15 doub Y N 91 EG5 C14 C15 sing Y N 92 EG5 C14 C13 sing N N 93 EG5 C15 CL sing N N 94 EG5 C13 C12 sing N N 95 EG5 C12 C11 sing N N 96 EG5 O4 C11 doub N N 97 EG5 C11 N5 sing N N 98 EG5 C26 C28 doub N N 99 EG5 C26 C35 sing N N 100 EG5 C28 C27 sing N N 101 EG5 N5 C35 sing N N 102 EG5 N5 C30 sing N N 103 EG5 C24 C27 sing N N 104 EG5 C24 C9 sing N N 105 EG5 C35 C31 sing N N 106 EG5 C35 C34 sing N N 107 EG5 C30 C29 sing N N 108 EG5 C27 N3 sing N N 109 EG5 C31 N3 sing N N 110 EG5 C31 O3 doub N N 111 EG5 N3 C10 sing N N 112 EG5 C9 C10 sing N N 113 EG5 C10 C20 sing N N 114 EG5 C34 C29 sing N N 115 EG5 C22 C23 sing N N 116 EG5 C22 N2 sing N N 117 EG5 C20 N2 sing N N 118 EG5 C20 O6 doub N N 119 EG5 C23 C8 sing N N 120 EG5 N2 C21 sing N N 121 EG5 C8 C21 sing N N 122 EG5 C8 C7 sing N N 123 EG5 C21 C25 sing N N 124 EG5 O7 C25 doub N N 125 EG5 C25 N1 sing N N 126 EG5 C7 C6 doub N N 127 EG5 N1 C5 sing N N 128 EG5 N1 C2 sing N N 129 EG5 C6 C5 sing N N 130 EG5 C5 C4 sing N N 131 EG5 C2 C1 sing N N 132 EG5 C2 C3 sing N N 133 EG5 O1 C1 doub N N 134 EG5 C1 O2 sing N N 135 EG5 C4 C3 sing N N 136 EG5 C33 H10 sing N N 137 EG5 C33 H11 sing N N 138 EG5 C33 H9 sing N N 139 EG5 C19 H1 sing N N 140 EG5 C18 H2 sing N N 141 EG5 C17 H3 sing N N 142 EG5 C16 H4 sing N N 143 EG5 C13 H5 sing N N 144 EG5 C13 H6 sing N N 145 EG5 C12 H7 sing N N 146 EG5 N4 H8 sing N N 147 EG5 C30 H12 sing N N 148 EG5 C30 H13 sing N N 149 EG5 C29 H15 sing N N 150 EG5 C29 H14 sing N N 151 EG5 C34 H17 sing N N 152 EG5 C34 H16 sing N N 153 EG5 C26 H18 sing N N 154 EG5 C28 H19 sing N N 155 EG5 C27 H20 sing N N 156 EG5 C24 H21 sing N N 157 EG5 C24 H22 sing N N 158 EG5 C9 H23 sing N N 159 EG5 C9 H24 sing N N 160 EG5 C10 H25 sing N N 161 EG5 C22 H27 sing N N 162 EG5 C22 H26 sing N N 163 EG5 C23 H28 sing N N 164 EG5 C23 H29 sing N N 165 EG5 C8 H30 sing N N 166 EG5 C21 H31 sing N N 167 EG5 C7 H32 sing N N 168 EG5 C6 H33 sing N N 169 EG5 C5 H34 sing N N 170 EG5 C4 H35 sing N N 171 EG5 C4 H42 sing N N 172 EG5 C3 H38 sing N N 173 EG5 C3 H36 sing N N 174 EG5 C2 H37 sing N N 175 EG5 O2 H39 sing N N 176 GLN N CA sing N N 177 GLN N H sing N N 178 GLN N H2 sing N N 179 GLN CA C sing N N 180 GLN CA CB sing N N 181 GLN CA HA sing N N 182 GLN C O doub N N 183 GLN C OXT sing N N 184 GLN CB CG sing N N 185 GLN CB HB2 sing N N 186 GLN CB HB3 sing N N 187 GLN CG CD sing N N 188 GLN CG HG2 sing N N 189 GLN CG HG3 sing N N 190 GLN CD OE1 doub N N 191 GLN CD NE2 sing N N 192 GLN NE2 HE21 sing N N 193 GLN NE2 HE22 sing N N 194 GLN OXT HXT sing N N 195 GLU N CA sing N N 196 GLU N H sing N N 197 GLU N H2 sing N N 198 GLU CA C sing N N 199 GLU CA CB sing N N 200 GLU CA HA sing N N 201 GLU C O doub N N 202 GLU C OXT sing N N 203 GLU CB CG sing N N 204 GLU CB HB2 sing N N 205 GLU CB HB3 sing N N 206 GLU CG CD sing N N 207 GLU CG HG2 sing N N 208 GLU CG HG3 sing N N 209 GLU CD OE1 doub N N 210 GLU CD OE2 sing N N 211 GLU OE2 HE2 sing N N 212 GLU OXT HXT sing N N 213 GLY N CA sing N N 214 GLY N H sing N N 215 GLY N H2 sing N N 216 GLY CA C sing N N 217 GLY CA HA2 sing N N 218 GLY CA HA3 sing N N 219 GLY C O doub N N 220 GLY C OXT sing N N 221 GLY OXT HXT sing N N 222 HIS N CA sing N N 223 HIS N H sing N N 224 HIS N H2 sing N N 225 HIS CA C sing N N 226 HIS CA CB sing N N 227 HIS CA HA sing N N 228 HIS C O doub N N 229 HIS C OXT sing N N 230 HIS CB CG sing N N 231 HIS CB HB2 sing N N 232 HIS CB HB3 sing N N 233 HIS CG ND1 sing Y N 234 HIS CG CD2 doub Y N 235 HIS ND1 CE1 doub Y N 236 HIS ND1 HD1 sing N N 237 HIS CD2 NE2 sing Y N 238 HIS CD2 HD2 sing N N 239 HIS CE1 NE2 sing Y N 240 HIS CE1 HE1 sing N N 241 HIS NE2 HE2 sing N N 242 HIS OXT HXT sing N N 243 HOH O H1 sing N N 244 HOH O H2 sing N N 245 ILE N CA sing N N 246 ILE N H sing N N 247 ILE N H2 sing N N 248 ILE CA C sing N N 249 ILE CA CB sing N N 250 ILE CA HA sing N N 251 ILE C O doub N N 252 ILE C OXT sing N N 253 ILE CB CG1 sing N N 254 ILE CB CG2 sing N N 255 ILE CB HB sing N N 256 ILE CG1 CD1 sing N N 257 ILE CG1 HG12 sing N N 258 ILE CG1 HG13 sing N N 259 ILE CG2 HG21 sing N N 260 ILE CG2 HG22 sing N N 261 ILE CG2 HG23 sing N N 262 ILE CD1 HD11 sing N N 263 ILE CD1 HD12 sing N N 264 ILE CD1 HD13 sing N N 265 ILE OXT HXT sing N N 266 LEU N CA sing N N 267 LEU N H sing N N 268 LEU N H2 sing N N 269 LEU CA C sing N N 270 LEU CA CB sing N N 271 LEU CA HA sing N N 272 LEU C O doub N N 273 LEU C OXT sing N N 274 LEU CB CG sing N N 275 LEU CB HB2 sing N N 276 LEU CB HB3 sing N N 277 LEU CG CD1 sing N N 278 LEU CG CD2 sing N N 279 LEU CG HG sing N N 280 LEU CD1 HD11 sing N N 281 LEU CD1 HD12 sing N N 282 LEU CD1 HD13 sing N N 283 LEU CD2 HD21 sing N N 284 LEU CD2 HD22 sing N N 285 LEU CD2 HD23 sing N N 286 LEU OXT HXT sing N N 287 LYS N CA sing N N 288 LYS N H sing N N 289 LYS N H2 sing N N 290 LYS CA C sing N N 291 LYS CA CB sing N N 292 LYS CA HA sing N N 293 LYS C O doub N N 294 LYS C OXT sing N N 295 LYS CB CG sing N N 296 LYS CB HB2 sing N N 297 LYS CB HB3 sing N N 298 LYS CG CD sing N N 299 LYS CG HG2 sing N N 300 LYS CG HG3 sing N N 301 LYS CD CE sing N N 302 LYS CD HD2 sing N N 303 LYS CD HD3 sing N N 304 LYS CE NZ sing N N 305 LYS CE HE2 sing N N 306 LYS CE HE3 sing N N 307 LYS NZ HZ1 sing N N 308 LYS NZ HZ2 sing N N 309 LYS NZ HZ3 sing N N 310 LYS OXT HXT sing N N 311 MET N CA sing N N 312 MET N H sing N N 313 MET N H2 sing N N 314 MET CA C sing N N 315 MET CA CB sing N N 316 MET CA HA sing N N 317 MET C O doub N N 318 MET C OXT sing N N 319 MET CB CG sing N N 320 MET CB HB2 sing N N 321 MET CB HB3 sing N N 322 MET CG SD sing N N 323 MET CG HG2 sing N N 324 MET CG HG3 sing N N 325 MET SD CE sing N N 326 MET CE HE1 sing N N 327 MET CE HE2 sing N N 328 MET CE HE3 sing N N 329 MET OXT HXT sing N N 330 NO3 N O1 doub N N 331 NO3 N O2 sing N N 332 NO3 N O3 sing N N 333 PHE N CA sing N N 334 PHE N H sing N N 335 PHE N H2 sing N N 336 PHE CA C sing N N 337 PHE CA CB sing N N 338 PHE CA HA sing N N 339 PHE C O doub N N 340 PHE C OXT sing N N 341 PHE CB CG sing N N 342 PHE CB HB2 sing N N 343 PHE CB HB3 sing N N 344 PHE CG CD1 doub Y N 345 PHE CG CD2 sing Y N 346 PHE CD1 CE1 sing Y N 347 PHE CD1 HD1 sing N N 348 PHE CD2 CE2 doub Y N 349 PHE CD2 HD2 sing N N 350 PHE CE1 CZ doub Y N 351 PHE CE1 HE1 sing N N 352 PHE CE2 CZ sing Y N 353 PHE CE2 HE2 sing N N 354 PHE CZ HZ sing N N 355 PHE OXT HXT sing N N 356 PRO N CA sing N N 357 PRO N CD sing N N 358 PRO N H sing N N 359 PRO CA C sing N N 360 PRO CA CB sing N N 361 PRO CA HA sing N N 362 PRO C O doub N N 363 PRO C OXT sing N N 364 PRO CB CG sing N N 365 PRO CB HB2 sing N N 366 PRO CB HB3 sing N N 367 PRO CG CD sing N N 368 PRO CG HG2 sing N N 369 PRO CG HG3 sing N N 370 PRO CD HD2 sing N N 371 PRO CD HD3 sing N N 372 PRO OXT HXT sing N N 373 SER N CA sing N N 374 SER N H sing N N 375 SER N H2 sing N N 376 SER CA C sing N N 377 SER CA CB sing N N 378 SER CA HA sing N N 379 SER C O doub N N 380 SER C OXT sing N N 381 SER CB OG sing N N 382 SER CB HB2 sing N N 383 SER CB HB3 sing N N 384 SER OG HG sing N N 385 SER OXT HXT sing N N 386 SO4 S O1 doub N N 387 SO4 S O2 doub N N 388 SO4 S O3 sing N N 389 SO4 S O4 sing N N 390 THR N CA sing N N 391 THR N H sing N N 392 THR N H2 sing N N 393 THR CA C sing N N 394 THR CA CB sing N N 395 THR CA HA sing N N 396 THR C O doub N N 397 THR C OXT sing N N 398 THR CB OG1 sing N N 399 THR CB CG2 sing N N 400 THR CB HB sing N N 401 THR OG1 HG1 sing N N 402 THR CG2 HG21 sing N N 403 THR CG2 HG22 sing N N 404 THR CG2 HG23 sing N N 405 THR OXT HXT sing N N 406 TRP N CA sing N N 407 TRP N H sing N N 408 TRP N H2 sing N N 409 TRP CA C sing N N 410 TRP CA CB sing N N 411 TRP CA HA sing N N 412 TRP C O doub N N 413 TRP C OXT sing N N 414 TRP CB CG sing N N 415 TRP CB HB2 sing N N 416 TRP CB HB3 sing N N 417 TRP CG CD1 doub Y N 418 TRP CG CD2 sing Y N 419 TRP CD1 NE1 sing Y N 420 TRP CD1 HD1 sing N N 421 TRP CD2 CE2 doub Y N 422 TRP CD2 CE3 sing Y N 423 TRP NE1 CE2 sing Y N 424 TRP NE1 HE1 sing N N 425 TRP CE2 CZ2 sing Y N 426 TRP CE3 CZ3 doub Y N 427 TRP CE3 HE3 sing N N 428 TRP CZ2 CH2 doub Y N 429 TRP CZ2 HZ2 sing N N 430 TRP CZ3 CH2 sing Y N 431 TRP CZ3 HZ3 sing N N 432 TRP CH2 HH2 sing N N 433 TRP OXT HXT sing N N 434 TYR N CA sing N N 435 TYR N H sing N N 436 TYR N H2 sing N N 437 TYR CA C sing N N 438 TYR CA CB sing N N 439 TYR CA HA sing N N 440 TYR C O doub N N 441 TYR C OXT sing N N 442 TYR CB CG sing N N 443 TYR CB HB2 sing N N 444 TYR CB HB3 sing N N 445 TYR CG CD1 doub Y N 446 TYR CG CD2 sing Y N 447 TYR CD1 CE1 sing Y N 448 TYR CD1 HD1 sing N N 449 TYR CD2 CE2 doub Y N 450 TYR CD2 HD2 sing N N 451 TYR CE1 CZ doub Y N 452 TYR CE1 HE1 sing N N 453 TYR CE2 CZ sing Y N 454 TYR CE2 HE2 sing N N 455 TYR CZ OH sing N N 456 TYR OH HH sing N N 457 TYR OXT HXT sing N N 458 VAL N CA sing N N 459 VAL N H sing N N 460 VAL N H2 sing N N 461 VAL CA C sing N N 462 VAL CA CB sing N N 463 VAL CA HA sing N N 464 VAL C O doub N N 465 VAL C OXT sing N N 466 VAL CB CG1 sing N N 467 VAL CB CG2 sing N N 468 VAL CB HB sing N N 469 VAL CG1 HG11 sing N N 470 VAL CG1 HG12 sing N N 471 VAL CG1 HG13 sing N N 472 VAL CG2 HG21 sing N N 473 VAL CG2 HG22 sing N N 474 VAL CG2 HG23 sing N N 475 VAL OXT HXT sing N N 476 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5NCG _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 5NCP _atom_sites.fract_transf_matrix[1][1] 0.022655 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007074 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.028813 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL H N O S # loop_