data_5NGH # _entry.id 5NGH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5NGH pdb_00005ngh 10.2210/pdb5ngh/pdb WWPDB D_1200004103 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-11-01 2 'Structure model' 1 1 2017-11-08 3 'Structure model' 1 2 2017-11-22 4 'Structure model' 1 3 2018-02-28 5 'Structure model' 1 4 2024-01-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Structure summary' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation 3 4 'Structure model' audit_author 4 4 'Structure model' entity 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' database_2 8 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.pdbx_database_id_PubMed' 3 2 'Structure model' '_citation.title' 4 3 'Structure model' '_citation.journal_volume' 5 3 'Structure model' '_citation.page_first' 6 3 'Structure model' '_citation.page_last' 7 4 'Structure model' '_audit_author.name' 8 4 'Structure model' '_entity.pdbx_description' 9 5 'Structure model' '_database_2.pdbx_DOI' 10 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5NGH _pdbx_database_status.recvd_initial_deposition_date 2017-03-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Cambillau, C.' 1 0000-0001-5502-4729 'Spinelli, S.' 2 ? 'Pelosi, P.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Proc. Natl. Acad. Sci. U.S.A.' _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 114 _citation.language ? _citation.page_first E9802 _citation.page_last E9810 _citation.title ;Reverse chemical ecology: Olfactory proteins from the giant panda and their interactions with putative pheromones and bamboo volatiles. ; _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1711437114 _citation.pdbx_database_id_PubMed 29078359 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhu, J.' 1 ? primary 'Arena, S.' 2 ? primary 'Spinelli, S.' 3 ? primary 'Liu, D.' 4 ? primary 'Zhang, G.' 5 ? primary 'Wei, R.' 6 ? primary 'Cambillau, C.' 7 ? primary 'Scaloni, A.' 8 ? primary 'Wang, G.' 9 ? primary 'Pelosi, P.' 10 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Odorant Binding Protein 3' 19671.947 1 ? ? ? ? 2 non-polymer syn 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 122.143 2 ? ? ? ? 3 water nat water 18.015 16 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;HEEGNDVRRNFDVSKISGYWYSVLLASDVREKTEENSSMRVFVNHIEVLSNSSLLFNMHIKVDGKCTEIALVSDKTEKDG EYSVEYDGYNVFRIVETDYTDYIIFHLVNFKEKDSFQMMELSAREPDTSEEVRKRFVEYCQKHGIVKENIFDLTEVDRCL QARGSEKA ; _entity_poly.pdbx_seq_one_letter_code_can ;HEEGNDVRRNFDVSKISGYWYSVLLASDVREKTEENSSMRVFVNHIEVLSNSSLLFNMHIKVDGKCTEIALVSDKTEKDG EYSVEYDGYNVFRIVETDYTDYIIFHLVNFKEKDSFQMMELSAREPDTSEEVRKRFVEYCQKHGIVKENIFDLTEVDRCL QARGSEKA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL TRS 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 GLU n 1 3 GLU n 1 4 GLY n 1 5 ASN n 1 6 ASP n 1 7 VAL n 1 8 ARG n 1 9 ARG n 1 10 ASN n 1 11 PHE n 1 12 ASP n 1 13 VAL n 1 14 SER n 1 15 LYS n 1 16 ILE n 1 17 SER n 1 18 GLY n 1 19 TYR n 1 20 TRP n 1 21 TYR n 1 22 SER n 1 23 VAL n 1 24 LEU n 1 25 LEU n 1 26 ALA n 1 27 SER n 1 28 ASP n 1 29 VAL n 1 30 ARG n 1 31 GLU n 1 32 LYS n 1 33 THR n 1 34 GLU n 1 35 GLU n 1 36 ASN n 1 37 SER n 1 38 SER n 1 39 MET n 1 40 ARG n 1 41 VAL n 1 42 PHE n 1 43 VAL n 1 44 ASN n 1 45 HIS n 1 46 ILE n 1 47 GLU n 1 48 VAL n 1 49 LEU n 1 50 SER n 1 51 ASN n 1 52 SER n 1 53 SER n 1 54 LEU n 1 55 LEU n 1 56 PHE n 1 57 ASN n 1 58 MET n 1 59 HIS n 1 60 ILE n 1 61 LYS n 1 62 VAL n 1 63 ASP n 1 64 GLY n 1 65 LYS n 1 66 CYS n 1 67 THR n 1 68 GLU n 1 69 ILE n 1 70 ALA n 1 71 LEU n 1 72 VAL n 1 73 SER n 1 74 ASP n 1 75 LYS n 1 76 THR n 1 77 GLU n 1 78 LYS n 1 79 ASP n 1 80 GLY n 1 81 GLU n 1 82 TYR n 1 83 SER n 1 84 VAL n 1 85 GLU n 1 86 TYR n 1 87 ASP n 1 88 GLY n 1 89 TYR n 1 90 ASN n 1 91 VAL n 1 92 PHE n 1 93 ARG n 1 94 ILE n 1 95 VAL n 1 96 GLU n 1 97 THR n 1 98 ASP n 1 99 TYR n 1 100 THR n 1 101 ASP n 1 102 TYR n 1 103 ILE n 1 104 ILE n 1 105 PHE n 1 106 HIS n 1 107 LEU n 1 108 VAL n 1 109 ASN n 1 110 PHE n 1 111 LYS n 1 112 GLU n 1 113 LYS n 1 114 ASP n 1 115 SER n 1 116 PHE n 1 117 GLN n 1 118 MET n 1 119 MET n 1 120 GLU n 1 121 LEU n 1 122 SER n 1 123 ALA n 1 124 ARG n 1 125 GLU n 1 126 PRO n 1 127 ASP n 1 128 THR n 1 129 SER n 1 130 GLU n 1 131 GLU n 1 132 VAL n 1 133 ARG n 1 134 LYS n 1 135 ARG n 1 136 PHE n 1 137 VAL n 1 138 GLU n 1 139 TYR n 1 140 CYS n 1 141 GLN n 1 142 LYS n 1 143 HIS n 1 144 GLY n 1 145 ILE n 1 146 VAL n 1 147 LYS n 1 148 GLU n 1 149 ASN n 1 150 ILE n 1 151 PHE n 1 152 ASP n 1 153 LEU n 1 154 THR n 1 155 GLU n 1 156 VAL n 1 157 ASP n 1 158 ARG n 1 159 CYS n 1 160 LEU n 1 161 GLN n 1 162 ALA n 1 163 ARG n 1 164 GLY n 1 165 SER n 1 166 GLU n 1 167 LYS n 1 168 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 168 _entity_src_gen.gene_src_common_name 'Giant panda' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Ailuropoda melanoleuca' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9646 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TRS non-polymer . 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 'TRIS BUFFER' 'C4 H12 N O3 1' 122.143 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 TRP 20 20 20 TRP TRP A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 MET 39 39 39 MET MET A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 HIS 45 45 45 HIS HIS A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 MET 58 58 58 MET MET A . n A 1 59 HIS 59 59 59 HIS HIS A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 CYS 66 66 66 CYS CYS A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 TYR 82 82 82 TYR TYR A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 TYR 86 86 86 TYR TYR A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 TYR 89 89 89 TYR TYR A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 PHE 92 92 92 PHE PHE A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 TYR 99 99 99 TYR TYR A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 TYR 102 102 102 TYR TYR A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 PHE 105 105 105 PHE PHE A . n A 1 106 HIS 106 106 106 HIS HIS A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 PHE 116 116 116 PHE PHE A . n A 1 117 GLN 117 117 117 GLN GLN A . n A 1 118 MET 118 118 118 MET MET A . n A 1 119 MET 119 119 119 MET MET A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 SER 122 122 122 SER SER A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 PRO 126 126 126 PRO PRO A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 THR 128 128 128 THR THR A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 ARG 133 133 133 ARG ARG A . n A 1 134 LYS 134 134 134 LYS LYS A . n A 1 135 ARG 135 135 135 ARG ARG A . n A 1 136 PHE 136 136 136 PHE PHE A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 TYR 139 139 139 TYR TYR A . n A 1 140 CYS 140 140 140 CYS CYS A . n A 1 141 GLN 141 141 141 GLN GLN A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 HIS 143 143 143 HIS HIS A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 VAL 146 146 146 VAL VAL A . n A 1 147 LYS 147 147 147 LYS LYS A . n A 1 148 GLU 148 148 148 GLU GLU A . n A 1 149 ASN 149 149 149 ASN ASN A . n A 1 150 ILE 150 150 150 ILE ILE A . n A 1 151 PHE 151 151 151 PHE PHE A . n A 1 152 ASP 152 152 152 ASP ASP A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 GLU 155 155 155 GLU GLU A . n A 1 156 VAL 156 156 156 VAL VAL A . n A 1 157 ASP 157 157 157 ASP ASP A . n A 1 158 ARG 158 158 158 ARG ARG A . n A 1 159 CYS 159 159 159 CYS CYS A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 GLN 161 161 161 GLN GLN A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 ARG 163 163 163 ARG ARG A . n A 1 164 GLY 164 164 164 GLY GLY A . n A 1 165 SER 165 165 ? ? ? A . n A 1 166 GLU 166 166 ? ? ? A . n A 1 167 LYS 167 167 ? ? ? A . n A 1 168 ALA 168 168 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 TRS 1 201 1 TRS TRS A . C 2 TRS 1 202 2 TRS TRS A . D 3 HOH 1 301 25 HOH HOH A . D 3 HOH 2 302 13 HOH HOH A . D 3 HOH 3 303 7 HOH HOH A . D 3 HOH 4 304 2 HOH HOH A . D 3 HOH 5 305 20 HOH HOH A . D 3 HOH 6 306 6 HOH HOH A . D 3 HOH 7 307 1 HOH HOH A . D 3 HOH 8 308 14 HOH HOH A . D 3 HOH 9 309 12 HOH HOH A . D 3 HOH 10 310 9 HOH HOH A . D 3 HOH 11 311 18 HOH HOH A . D 3 HOH 12 312 27 HOH HOH A . D 3 HOH 13 313 22 HOH HOH A . D 3 HOH 14 314 8 HOH HOH A . D 3 HOH 15 315 17 HOH HOH A . D 3 HOH 16 316 5 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 3 ? CG ? A GLU 3 CG 2 1 Y 1 A GLU 3 ? CD ? A GLU 3 CD 3 1 Y 1 A GLU 3 ? OE1 ? A GLU 3 OE1 4 1 Y 1 A GLU 3 ? OE2 ? A GLU 3 OE2 5 1 Y 1 A ARG 8 ? CZ ? A ARG 8 CZ 6 1 Y 1 A ARG 8 ? NH1 ? A ARG 8 NH1 7 1 Y 1 A ARG 8 ? NH2 ? A ARG 8 NH2 8 1 Y 1 A ARG 9 ? CG ? A ARG 9 CG 9 1 Y 1 A ARG 9 ? CD ? A ARG 9 CD 10 1 Y 1 A ARG 9 ? NE ? A ARG 9 NE 11 1 Y 1 A ARG 9 ? CZ ? A ARG 9 CZ 12 1 Y 1 A ARG 9 ? NH1 ? A ARG 9 NH1 13 1 Y 1 A ARG 9 ? NH2 ? A ARG 9 NH2 14 1 Y 1 A LYS 15 ? CD ? A LYS 15 CD 15 1 Y 1 A LYS 15 ? CE ? A LYS 15 CE 16 1 Y 1 A LYS 15 ? NZ ? A LYS 15 NZ 17 1 Y 1 A ASN 44 ? CG ? A ASN 44 CG 18 1 Y 1 A ASN 44 ? OD1 ? A ASN 44 OD1 19 1 Y 1 A ASN 44 ? ND2 ? A ASN 44 ND2 20 1 Y 1 A LYS 61 ? CD ? A LYS 61 CD 21 1 Y 1 A LYS 61 ? CE ? A LYS 61 CE 22 1 Y 1 A LYS 61 ? NZ ? A LYS 61 NZ 23 1 Y 1 A LYS 65 ? CD ? A LYS 65 CD 24 1 Y 1 A LYS 65 ? CE ? A LYS 65 CE 25 1 Y 1 A LYS 65 ? NZ ? A LYS 65 NZ 26 1 Y 1 A LYS 78 ? CD ? A LYS 78 CD 27 1 Y 1 A LYS 78 ? CE ? A LYS 78 CE 28 1 Y 1 A LYS 78 ? NZ ? A LYS 78 NZ 29 1 Y 1 A PHE 110 ? CG ? A PHE 110 CG 30 1 Y 1 A PHE 110 ? CD1 ? A PHE 110 CD1 31 1 Y 1 A PHE 110 ? CD2 ? A PHE 110 CD2 32 1 Y 1 A PHE 110 ? CE1 ? A PHE 110 CE1 33 1 Y 1 A PHE 110 ? CE2 ? A PHE 110 CE2 34 1 Y 1 A PHE 110 ? CZ ? A PHE 110 CZ 35 1 Y 1 A LYS 111 ? CG ? A LYS 111 CG 36 1 Y 1 A LYS 111 ? CD ? A LYS 111 CD 37 1 Y 1 A LYS 111 ? CE ? A LYS 111 CE 38 1 Y 1 A LYS 111 ? NZ ? A LYS 111 NZ 39 1 Y 1 A LYS 113 ? CG ? A LYS 113 CG 40 1 Y 1 A LYS 113 ? CD ? A LYS 113 CD 41 1 Y 1 A LYS 113 ? CE ? A LYS 113 CE 42 1 Y 1 A LYS 113 ? NZ ? A LYS 113 NZ 43 1 Y 1 A PHE 116 ? CG ? A PHE 116 CG 44 1 Y 1 A PHE 116 ? CD1 ? A PHE 116 CD1 45 1 Y 1 A PHE 116 ? CD2 ? A PHE 116 CD2 46 1 Y 1 A PHE 116 ? CE1 ? A PHE 116 CE1 47 1 Y 1 A PHE 116 ? CE2 ? A PHE 116 CE2 48 1 Y 1 A PHE 116 ? CZ ? A PHE 116 CZ 49 1 Y 1 A LYS 134 ? CG ? A LYS 134 CG 50 1 Y 1 A LYS 134 ? CD ? A LYS 134 CD 51 1 Y 1 A LYS 134 ? CE ? A LYS 134 CE 52 1 Y 1 A LYS 134 ? NZ ? A LYS 134 NZ 53 1 Y 1 A LYS 142 ? CD ? A LYS 142 CD 54 1 Y 1 A LYS 142 ? CE ? A LYS 142 CE 55 1 Y 1 A LYS 142 ? NZ ? A LYS 142 NZ 56 1 Y 1 A PHE 151 ? CG ? A PHE 151 CG 57 1 Y 1 A PHE 151 ? CD1 ? A PHE 151 CD1 58 1 Y 1 A PHE 151 ? CD2 ? A PHE 151 CD2 59 1 Y 1 A PHE 151 ? CE1 ? A PHE 151 CE1 60 1 Y 1 A PHE 151 ? CE2 ? A PHE 151 CE2 61 1 Y 1 A PHE 151 ? CZ ? A PHE 151 CZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.10.1 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5NGH _cell.details ? _cell.formula_units_Z ? _cell.length_a 94.030 _cell.length_a_esd ? _cell.length_b 94.030 _cell.length_b_esd ? _cell.length_c 114.530 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5NGH _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5NGH _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.71 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 66.89 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 273 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2.2 M Ammonium Sulfate and 0.2M Potassium Nitrate at pH 7.0' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-07-21 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SOLEIL BEAMLINE PROXIMA 1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'PROXIMA 1' _diffrn_source.pdbx_synchrotron_site SOLEIL # _reflns.B_iso_Wilson_estimate 104.93 _reflns.entry_id 5NGH _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.8 _reflns.d_resolution_low 80.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7821 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.4 _reflns.pdbx_Rmerge_I_obs 0.2 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.8 _reflns_shell.d_res_low 2.97 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1218 _reflns_shell.percent_possible_all 99.8 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 10.3 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.93 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -27.4321 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] -27.4321 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 54.8641 _refine.B_iso_max ? _refine.B_iso_mean 93.18 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.8079 _refine.correlation_coeff_Fo_to_Fc_free 0.8051 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5NGH _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.80 _refine.ls_d_res_low 24.73 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7784 _refine.ls_number_reflns_R_free 389 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.65 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2772 _refine.ls_R_factor_R_free 0.2877 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2766 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3KFF _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.329 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.334 _refine.pdbx_overall_SU_R_Blow_DPI 0.601 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.551 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 5NGH _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.679 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 1272 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 16 _refine_hist.number_atoms_solvent 16 _refine_hist.number_atoms_total 1304 _refine_hist.d_res_high 2.80 _refine_hist.d_res_low 24.73 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 ? 1307 ? t_bond_d 2.00 HARMONIC 'X-RAY DIFFRACTION' ? 1.26 ? 1770 ? t_angle_deg 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 459 ? t_dihedral_angle_d 2.00 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? ? ? t_incorr_chiral_ct ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? 41 ? t_trig_c_planes 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 188 ? t_gen_planes 5.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1307 ? t_it 20.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ? 'X-RAY DIFFRACTION' ? 2.93 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 25.38 ? ? ? t_other_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 172 ? t_chiral_improper_torsion 5.00 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 1453 ? t_ideal_dist_contact 4.00 SEMIHARMONIC # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.80 _refine_ls_shell.d_res_low 3.13 _refine_ls_shell.number_reflns_all 2131 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 106 _refine_ls_shell.number_reflns_R_work 2025 _refine_ls_shell.percent_reflns_obs 99.65 _refine_ls_shell.percent_reflns_R_free 4.97 _refine_ls_shell.R_factor_all 0.3879 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.4047 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.3870 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 5 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5NGH _struct.title 'Structure of Odorant Binding Protein 3 from Giant Panda (Ailuropoda melanoleuca)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5NGH _struct_keywords.text 'Odorant Binding Protein Giant Panda Ailuropoda melanoleuca, protein binding' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code G1LK14_AILME _struct_ref.pdbx_db_accession G1LK14 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;HEEGNDVRRNFDVSKISGYWYSVLLASDVREKTEENSSMRVFVNHIEVLSNSSLLFNMHIKVDGKCTEIALVSDKTEKDG EYSVEYDGYNVFRIVETDYTDYIIFHLVNFKEKDSFQMMELSAREPDTSEEVRKRFVEYCQKHGIVKENIFDLTEVDRCL QARGSEKA ; _struct_ref.pdbx_align_begin 16 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5NGH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 168 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession G1LK14 _struct_ref_seq.db_align_beg 16 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 183 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 168 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 560 ? 1 MORE 4 ? 1 'SSA (A^2)' 8500 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 12 ? ILE A 16 ? ASP A 12 ILE A 16 5 ? 5 HELX_P HELX_P2 AA2 ARG A 30 ? GLU A 34 ? ARG A 30 GLU A 34 5 ? 5 HELX_P HELX_P3 AA3 SER A 129 ? HIS A 143 ? SER A 129 HIS A 143 1 ? 15 HELX_P HELX_P4 AA4 VAL A 146 ? GLU A 148 ? VAL A 146 GLU A 148 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 66 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 159 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 66 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 159 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.041 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ARG _struct_mon_prot_cis.label_seq_id 163 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ARG _struct_mon_prot_cis.auth_seq_id 163 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 GLY _struct_mon_prot_cis.pdbx_label_seq_id_2 164 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 GLY _struct_mon_prot_cis.pdbx_auth_seq_id_2 164 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.76 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 10 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA1 9 10 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 18 ? TYR A 19 ? GLY A 18 TYR A 19 AA1 2 PHE A 42 ? VAL A 48 ? PHE A 42 VAL A 48 AA1 3 LEU A 54 ? VAL A 62 ? LEU A 54 VAL A 62 AA1 4 LYS A 65 ? LYS A 75 ? LYS A 65 LYS A 75 AA1 5 GLU A 81 ? GLU A 85 ? GLU A 81 GLU A 85 AA1 6 TYR A 89 ? ASP A 98 ? TYR A 89 ASP A 98 AA1 7 TYR A 102 ? LYS A 111 ? TYR A 102 LYS A 111 AA1 8 ASP A 114 ? ALA A 123 ? ASP A 114 ALA A 123 AA1 9 LEU A 24 ? SER A 27 ? LEU A 24 SER A 27 AA1 10 ILE A 150 ? ASP A 152 ? ILE A 150 ASP A 152 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 18 ? N GLY A 18 O ILE A 46 ? O ILE A 46 AA1 2 3 N PHE A 42 ? N PHE A 42 O HIS A 59 ? O HIS A 59 AA1 3 4 N ILE A 60 ? N ILE A 60 O THR A 67 ? O THR A 67 AA1 4 5 N ASP A 74 ? N ASP A 74 O SER A 83 ? O SER A 83 AA1 5 6 N TYR A 82 ? N TYR A 82 O PHE A 92 ? O PHE A 92 AA1 6 7 N TYR A 89 ? N TYR A 89 O PHE A 110 ? O PHE A 110 AA1 7 8 N ASN A 109 ? N ASN A 109 O PHE A 116 ? O PHE A 116 AA1 8 9 O LEU A 121 ? O LEU A 121 N LEU A 24 ? N LEU A 24 AA1 9 10 N LEU A 25 ? N LEU A 25 O PHE A 151 ? O PHE A 151 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A TRS 201 ? 2 'binding site for residue TRS A 201' AC2 Software A TRS 202 ? 1 'binding site for residue TRS A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 VAL A 41 ? VAL A 41 . ? 1_555 ? 2 AC1 2 GLU A 120 ? GLU A 120 . ? 1_555 ? 3 AC2 1 ARG A 8 ? ARG A 8 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 5 ? ? -150.24 39.83 2 1 ARG A 9 ? ? -101.51 -91.32 3 1 TYR A 21 ? ? -118.67 -159.26 4 1 VAL A 23 ? ? -90.53 -61.21 5 1 SER A 52 ? ? 89.43 20.24 6 1 ASP A 101 ? ? -138.59 -50.02 7 1 LYS A 113 ? ? 77.57 -3.97 8 1 SER A 129 ? ? -34.81 144.12 9 1 ALA A 162 ? ? -56.21 -9.37 # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 9.7879 -34.6054 -0.3782 0.0011 0.0009 0.0018 -0.0002 -0.0008 0.0000 0.0053 -0.0010 0.0048 -0.0018 0.0008 -0.0015 -0.0002 0.0002 -0.0002 0.0002 0.0000 0.0004 0.0004 -0.0001 0.0002 'X-RAY DIFFRACTION' 2 ? refined 16.3228 -26.1755 -2.7427 0.0002 0.0010 -0.0034 -0.0012 -0.0032 -0.0029 -0.0102 0.0102 0.0069 0.0059 0.0031 -0.0032 0.0000 -0.0001 0.0011 0.0002 0.0002 0.0005 0.0000 -0.0004 -0.0002 'X-RAY DIFFRACTION' 3 ? refined 22.7371 -32.2594 9.3009 0.0001 -0.0004 -0.0015 -0.0002 -0.0033 0.0005 0.0180 -0.0180 0.0590 -0.0104 0.0303 -0.0176 0.0000 0.0001 0.0042 -0.0011 -0.0005 0.0039 0.0004 0.0007 0.0005 'X-RAY DIFFRACTION' 4 ? refined 37.9236 -44.6727 0.7468 0.0007 0.0026 0.0013 0.0015 0.0001 -0.0003 0.0030 0.0055 0.0030 -0.0042 -0.0016 0.0135 -0.0001 0.0000 -0.0004 0.0000 0.0000 0.0002 0.0002 -0.0002 0.0001 'X-RAY DIFFRACTION' 5 ? refined 39.4028 -41.6225 8.1855 -0.0003 0.0046 -0.0010 0.0017 -0.0016 -0.0017 -0.0058 0.0058 0.0037 0.0034 0.0094 -0.0024 0.0000 -0.0008 -0.0010 0.0007 -0.0001 -0.0003 0.0006 0.0004 0.0001 'X-RAY DIFFRACTION' 6 ? refined 30.5388 -33.4820 11.6028 -0.0051 0.0042 -0.0012 0.0004 0.0030 -0.0017 0.0030 -0.0030 0.0000 -0.0017 -0.0107 0.0009 0.0000 0.0001 0.0002 0.0000 0.0004 0.0000 0.0006 0.0011 -0.0005 'X-RAY DIFFRACTION' 7 ? refined 26.5840 -19.9683 5.7041 0.0024 0.0003 -0.0014 -0.0034 0.0028 -0.0035 0.0097 0.0114 0.0000 0.0127 -0.0068 -0.0016 0.0000 0.0005 0.0001 -0.0005 -0.0004 -0.0006 -0.0011 -0.0002 0.0003 'X-RAY DIFFRACTION' 8 ? refined 37.4766 -32.2044 16.0052 -0.0047 0.0091 -0.0013 -0.0001 0.0023 -0.0035 0.0351 -0.0223 0.0124 -0.0091 -0.0331 -0.0452 -0.0005 0.0003 -0.0007 0.0008 0.0003 -0.0016 0.0010 0.0006 0.0002 'X-RAY DIFFRACTION' 9 ? refined 29.7229 -22.3791 -2.6385 0.0052 -0.0008 -0.0031 -0.0043 0.0027 -0.0011 0.0008 0.0156 0.0008 0.0137 -0.0059 -0.0323 0.0011 0.0004 0.0007 -0.0016 -0.0009 0.0012 -0.0011 0.0002 -0.0003 'X-RAY DIFFRACTION' 10 ? refined 35.6355 -27.0957 -0.3602 -0.0033 0.0026 -0.0004 -0.0023 0.0008 -0.0010 0.0515 -0.0515 0.0000 -0.0297 -0.0010 -0.0424 0.0000 0.0003 -0.0004 -0.0005 0.0003 -0.0020 -0.0007 0.0011 -0.0003 'X-RAY DIFFRACTION' 11 ? refined 32.9041 -29.2038 -3.6623 -0.0014 0.0045 -0.0007 -0.0007 0.0017 -0.0014 -0.0053 0.0098 0.0205 0.0070 0.0035 0.0101 0.0001 -0.0006 0.0003 0.0001 0.0003 -0.0008 0.0004 0.0007 -0.0004 'X-RAY DIFFRACTION' 12 ? refined 17.2813 -31.9803 0.7856 -0.0010 0.0038 -0.0023 -0.0001 -0.0045 0.0001 0.0172 -0.0172 0.0061 -0.0100 0.0117 0.0013 0.0002 -0.0008 0.0010 0.0008 -0.0004 0.0007 -0.0001 -0.0003 0.0003 'X-RAY DIFFRACTION' 13 ? refined 18.9646 -34.6472 4.3292 0.0018 0.0018 -0.0048 -0.0017 -0.0011 -0.0017 0.0203 -0.0203 0.0125 -0.0117 0.0087 0.0277 0.0002 -0.0002 0.0003 -0.0002 0.0001 -0.0010 0.0003 -0.0006 -0.0002 'X-RAY DIFFRACTION' 14 ? refined 39.0641 -34.5156 -5.5514 -0.0002 0.0054 -0.0052 -0.0022 0.0003 -0.0034 0.0442 -0.0442 0.0253 -0.0255 0.0149 0.0466 0.0005 -0.0001 -0.0003 -0.0011 -0.0003 -0.0047 0.0007 -0.0003 -0.0002 'X-RAY DIFFRACTION' 15 ? refined 28.2822 -37.8219 1.7800 0.0037 -0.0051 0.0017 -0.0064 -0.0014 -0.0054 -0.0624 0.1127 0.0000 0.0796 -0.0372 0.0781 0.0003 0.0008 0.0008 -0.0002 -0.0011 0.0004 0.0010 0.0020 0.0008 'X-RAY DIFFRACTION' 16 ? refined 17.9637 -38.1242 12.5144 -0.0030 -0.0030 0.0021 -0.0047 0.0023 0.0000 -0.0004 0.0128 0.0064 0.0110 0.0193 -0.0181 0.0001 0.0004 0.0001 -0.0009 -0.0001 0.0004 0.0005 -0.0007 0.0000 'X-RAY DIFFRACTION' 17 ? refined 18.0299 -45.0359 1.9350 0.0041 -0.0019 0.0008 -0.0019 -0.0004 -0.0023 -0.0067 0.0328 0.0114 0.0264 0.0065 0.0316 0.0007 -0.0002 -0.0018 -0.0002 -0.0007 0.0002 0.0010 -0.0004 0.0000 'X-RAY DIFFRACTION' 18 ? refined 24.5046 -43.2854 -6.3373 0.0016 -0.0029 -0.0014 -0.0011 0.0001 0.0021 -0.0058 0.0104 0.0000 0.0074 -0.0050 0.0031 -0.0002 -0.0004 -0.0005 0.0004 0.0003 -0.0004 0.0009 0.0000 0.0000 'X-RAY DIFFRACTION' 19 ? refined 29.2808 -48.0663 2.3900 0.0063 -0.0009 -0.0010 -0.0016 0.0029 -0.0020 -0.0150 0.0586 0.0089 0.0215 0.0017 -0.0121 0.0001 -0.0001 0.0002 0.0000 0.0000 -0.0006 0.0002 0.0003 0.0000 'X-RAY DIFFRACTION' 20 ? refined 29.1311 -39.0741 18.2839 -0.0005 0.0053 -0.0058 -0.0005 0.0003 -0.0007 -0.0166 0.0166 0.0113 0.0096 -0.0040 0.0019 -0.0001 -0.0008 -0.0003 0.0003 0.0001 -0.0004 0.0010 0.0005 0.0001 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? '{A|3 - A|7}' 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? '{A|8 - A|13}' 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? '{A|14 - A|26}' 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? '{A|27 - A|32}' 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? '{A|33 - A|39}' 'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? '{A|40 - A|45}' 'X-RAY DIFFRACTION' 7 7 ? ? ? ? ? ? ? ? ? '{A|46 - A|56}' 'X-RAY DIFFRACTION' 8 8 ? ? ? ? ? ? ? ? ? '{A|57 - A|69}' 'X-RAY DIFFRACTION' 9 9 ? ? ? ? ? ? ? ? ? '{A|70 - A|80}' 'X-RAY DIFFRACTION' 10 10 ? ? ? ? ? ? ? ? ? '{A|81 - A|88}' 'X-RAY DIFFRACTION' 11 11 ? ? ? ? ? ? ? ? ? '{A|89 - A|93}' 'X-RAY DIFFRACTION' 12 12 ? ? ? ? ? ? ? ? ? '{A|94 - A|99}' 'X-RAY DIFFRACTION' 13 13 ? ? ? ? ? ? ? ? ? '{A|100 - A|105}' 'X-RAY DIFFRACTION' 14 14 ? ? ? ? ? ? ? ? ? '{A|106 - A|115}' 'X-RAY DIFFRACTION' 15 15 ? ? ? ? ? ? ? ? ? '{A|116 - A|123}' 'X-RAY DIFFRACTION' 16 16 ? ? ? ? ? ? ? ? ? '{A|124 - A|129}' 'X-RAY DIFFRACTION' 17 17 ? ? ? ? ? ? ? ? ? '{A|130 - A|138}' 'X-RAY DIFFRACTION' 18 18 ? ? ? ? ? ? ? ? ? '{A|139 - A|144}' 'X-RAY DIFFRACTION' 19 19 ? ? ? ? ? ? ? ? ? '{A|145 - A|153}' 'X-RAY DIFFRACTION' 20 20 ? ? ? ? ? ? ? ? ? '{A|154 - A|163}' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 1 ? A HIS 1 2 1 Y 1 A GLU 2 ? A GLU 2 3 1 Y 1 A SER 165 ? A SER 165 4 1 Y 1 A GLU 166 ? A GLU 166 5 1 Y 1 A LYS 167 ? A LYS 167 6 1 Y 1 A ALA 168 ? A ALA 168 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TRS C C N N 348 TRS C1 C N N 349 TRS C2 C N N 350 TRS C3 C N N 351 TRS N N N N 352 TRS O1 O N N 353 TRS O2 O N N 354 TRS O3 O N N 355 TRS H11 H N N 356 TRS H12 H N N 357 TRS H21 H N N 358 TRS H22 H N N 359 TRS H31 H N N 360 TRS H32 H N N 361 TRS HN1 H N N 362 TRS HN2 H N N 363 TRS HN3 H N N 364 TRS HO1 H N N 365 TRS HO2 H N N 366 TRS HO3 H N N 367 TYR N N N N 368 TYR CA C N S 369 TYR C C N N 370 TYR O O N N 371 TYR CB C N N 372 TYR CG C Y N 373 TYR CD1 C Y N 374 TYR CD2 C Y N 375 TYR CE1 C Y N 376 TYR CE2 C Y N 377 TYR CZ C Y N 378 TYR OH O N N 379 TYR OXT O N N 380 TYR H H N N 381 TYR H2 H N N 382 TYR HA H N N 383 TYR HB2 H N N 384 TYR HB3 H N N 385 TYR HD1 H N N 386 TYR HD2 H N N 387 TYR HE1 H N N 388 TYR HE2 H N N 389 TYR HH H N N 390 TYR HXT H N N 391 VAL N N N N 392 VAL CA C N S 393 VAL C C N N 394 VAL O O N N 395 VAL CB C N N 396 VAL CG1 C N N 397 VAL CG2 C N N 398 VAL OXT O N N 399 VAL H H N N 400 VAL H2 H N N 401 VAL HA H N N 402 VAL HB H N N 403 VAL HG11 H N N 404 VAL HG12 H N N 405 VAL HG13 H N N 406 VAL HG21 H N N 407 VAL HG22 H N N 408 VAL HG23 H N N 409 VAL HXT H N N 410 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TRS C C1 sing N N 334 TRS C C2 sing N N 335 TRS C C3 sing N N 336 TRS C N sing N N 337 TRS C1 O1 sing N N 338 TRS C1 H11 sing N N 339 TRS C1 H12 sing N N 340 TRS C2 O2 sing N N 341 TRS C2 H21 sing N N 342 TRS C2 H22 sing N N 343 TRS C3 O3 sing N N 344 TRS C3 H31 sing N N 345 TRS C3 H32 sing N N 346 TRS N HN1 sing N N 347 TRS N HN2 sing N N 348 TRS N HN3 sing N N 349 TRS O1 HO1 sing N N 350 TRS O2 HO2 sing N N 351 TRS O3 HO3 sing N N 352 TYR N CA sing N N 353 TYR N H sing N N 354 TYR N H2 sing N N 355 TYR CA C sing N N 356 TYR CA CB sing N N 357 TYR CA HA sing N N 358 TYR C O doub N N 359 TYR C OXT sing N N 360 TYR CB CG sing N N 361 TYR CB HB2 sing N N 362 TYR CB HB3 sing N N 363 TYR CG CD1 doub Y N 364 TYR CG CD2 sing Y N 365 TYR CD1 CE1 sing Y N 366 TYR CD1 HD1 sing N N 367 TYR CD2 CE2 doub Y N 368 TYR CD2 HD2 sing N N 369 TYR CE1 CZ doub Y N 370 TYR CE1 HE1 sing N N 371 TYR CE2 CZ sing Y N 372 TYR CE2 HE2 sing N N 373 TYR CZ OH sing N N 374 TYR OH HH sing N N 375 TYR OXT HXT sing N N 376 VAL N CA sing N N 377 VAL N H sing N N 378 VAL N H2 sing N N 379 VAL CA C sing N N 380 VAL CA CB sing N N 381 VAL CA HA sing N N 382 VAL C O doub N N 383 VAL C OXT sing N N 384 VAL CB CG1 sing N N 385 VAL CB CG2 sing N N 386 VAL CB HB sing N N 387 VAL CG1 HG11 sing N N 388 VAL CG1 HG12 sing N N 389 VAL CG1 HG13 sing N N 390 VAL CG2 HG21 sing N N 391 VAL CG2 HG22 sing N N 392 VAL CG2 HG23 sing N N 393 VAL OXT HXT sing N N 394 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3KFF _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 5NGH _atom_sites.fract_transf_matrix[1][1] 0.010635 _atom_sites.fract_transf_matrix[1][2] 0.006140 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012280 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008731 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_