data_5NHO # _entry.id 5NHO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5NHO WWPDB D_1200004148 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5NHO _pdbx_database_status.recvd_initial_deposition_date 2017-03-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Debreczeni, J.E.' 1 ? 'Ward, R.A.' 2 ? 'Bethel, P.' 3 ? 'Cook, C.' 4 ? 'Davies, E.' 5 ? 'Eckersley, K.' 6 ? 'Fairley, G.' 7 ? 'Feron, L.' 8 ? 'Flemington, V.' 9 ? 'Graham, M.A.' 10 ? 'Greenwood, R.' 11 ? 'Hopcroft, P.' 12 ? 'Howard, T.D.' 13 ? 'Hudson, J.' 14 ? 'James, M.' 15 ? 'Jones, C.D.' 16 ? 'Jones, C.R.' 17 ? 'Lamont, S.' 18 ? 'Lewis, R.' 19 ? 'Lindsay, N.' 20 ? 'Roberts, K.' 21 ? 'Simpson, I.' 22 ? 'StGallay, S.' 23 ? 'Swallow, S.' 24 ? 'Tonge, M.' 25 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Med. Chem.' _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 1520-4804 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 60 _citation.language ? _citation.page_first 3438 _citation.page_last 3450 _citation.title ;Structure-Guided Discovery of Potent and Selective Inhibitors of ERK1/2 from a Modestly Active and Promiscuous Chemical Start Point. ; _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.7b00267 _citation.pdbx_database_id_PubMed 28376306 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Ward, R.A.' 1 primary 'Bethel, P.' 2 primary 'Cook, C.' 3 primary 'Davies, E.' 4 primary 'Debreczeni, J.E.' 5 primary 'Fairley, G.' 6 primary 'Feron, L.' 7 primary 'Flemington, V.' 8 primary 'Graham, M.A.' 9 primary 'Greenwood, R.' 10 primary 'Griffin, N.' 11 primary 'Hanson, L.' 12 primary 'Hopcroft, P.' 13 primary 'Howard, T.D.' 14 primary 'Hudson, J.' 15 primary 'James, M.' 16 primary 'Jones, C.D.' 17 primary 'Jones, C.R.' 18 primary 'Lamont, S.' 19 primary 'Lewis, R.' 20 primary 'Lindsay, N.' 21 primary 'Roberts, K.' 22 primary 'Simpson, I.' 23 primary 'St-Gallay, S.' 24 primary 'Swallow, S.' 25 primary 'Tang, J.' 26 primary 'Tonge, M.' 27 primary 'Wang, Z.' 28 primary 'Zhai, B.' 29 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 111.43 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5NHO _cell.details ? _cell.formula_units_Z ? _cell.length_a 48.910 _cell.length_a_esd ? _cell.length_b 71.800 _cell.length_b_esd ? _cell.length_c 61.250 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5NHO _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Mitogen-activated protein kinase 1' 43909.297 1 2.7.11.24 ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 non-polymer syn ;(6~{S})-5-(2-methoxyethyl)-6-methyl-2-[5-methyl-2-[(2-methylpyrazol-3-yl)amino]pyrimidin-4-yl]-6,7-dihydro-1~{H}-pyrrolo[3,2-c]pyridin-4-one ; 395.458 1 ? ? ? ? 4 water nat water 18.015 87 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'MAPK 1,ERT1,Extracellular signal-regulated kinase 2,ERK-2,MAP kinase isoform p42,p42-MAPK,Mitogen-activated protein kinase 2,MAPK 2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHGGGENLYFQGSHMAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEH QTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIH SANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEM LSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKR IEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRSLE ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHGGGENLYFQGSHMAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEH QTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIH SANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEM LSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKR IEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRSLE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 GLY n 1 9 GLY n 1 10 GLY n 1 11 GLU n 1 12 ASN n 1 13 LEU n 1 14 TYR n 1 15 PHE n 1 16 GLN n 1 17 GLY n 1 18 SER n 1 19 HIS n 1 20 MET n 1 21 ALA n 1 22 ALA n 1 23 ALA n 1 24 ALA n 1 25 ALA n 1 26 ALA n 1 27 GLY n 1 28 ALA n 1 29 GLY n 1 30 PRO n 1 31 GLU n 1 32 MET n 1 33 VAL n 1 34 ARG n 1 35 GLY n 1 36 GLN n 1 37 VAL n 1 38 PHE n 1 39 ASP n 1 40 VAL n 1 41 GLY n 1 42 PRO n 1 43 ARG n 1 44 TYR n 1 45 THR n 1 46 ASN n 1 47 LEU n 1 48 SER n 1 49 TYR n 1 50 ILE n 1 51 GLY n 1 52 GLU n 1 53 GLY n 1 54 ALA n 1 55 TYR n 1 56 GLY n 1 57 MET n 1 58 VAL n 1 59 CYS n 1 60 SER n 1 61 ALA n 1 62 TYR n 1 63 ASP n 1 64 ASN n 1 65 LEU n 1 66 ASN n 1 67 LYS n 1 68 VAL n 1 69 ARG n 1 70 VAL n 1 71 ALA n 1 72 ILE n 1 73 LYS n 1 74 LYS n 1 75 ILE n 1 76 SER n 1 77 PRO n 1 78 PHE n 1 79 GLU n 1 80 HIS n 1 81 GLN n 1 82 THR n 1 83 TYR n 1 84 CYS n 1 85 GLN n 1 86 ARG n 1 87 THR n 1 88 LEU n 1 89 ARG n 1 90 GLU n 1 91 ILE n 1 92 LYS n 1 93 ILE n 1 94 LEU n 1 95 LEU n 1 96 ARG n 1 97 PHE n 1 98 ARG n 1 99 HIS n 1 100 GLU n 1 101 ASN n 1 102 ILE n 1 103 ILE n 1 104 GLY n 1 105 ILE n 1 106 ASN n 1 107 ASP n 1 108 ILE n 1 109 ILE n 1 110 ARG n 1 111 ALA n 1 112 PRO n 1 113 THR n 1 114 ILE n 1 115 GLU n 1 116 GLN n 1 117 MET n 1 118 LYS n 1 119 ASP n 1 120 VAL n 1 121 TYR n 1 122 ILE n 1 123 VAL n 1 124 GLN n 1 125 ASP n 1 126 LEU n 1 127 MET n 1 128 GLU n 1 129 THR n 1 130 ASP n 1 131 LEU n 1 132 TYR n 1 133 LYS n 1 134 LEU n 1 135 LEU n 1 136 LYS n 1 137 THR n 1 138 GLN n 1 139 HIS n 1 140 LEU n 1 141 SER n 1 142 ASN n 1 143 ASP n 1 144 HIS n 1 145 ILE n 1 146 CYS n 1 147 TYR n 1 148 PHE n 1 149 LEU n 1 150 TYR n 1 151 GLN n 1 152 ILE n 1 153 LEU n 1 154 ARG n 1 155 GLY n 1 156 LEU n 1 157 LYS n 1 158 TYR n 1 159 ILE n 1 160 HIS n 1 161 SER n 1 162 ALA n 1 163 ASN n 1 164 VAL n 1 165 LEU n 1 166 HIS n 1 167 ARG n 1 168 ASP n 1 169 LEU n 1 170 LYS n 1 171 PRO n 1 172 SER n 1 173 ASN n 1 174 LEU n 1 175 LEU n 1 176 LEU n 1 177 ASN n 1 178 THR n 1 179 THR n 1 180 CYS n 1 181 ASP n 1 182 LEU n 1 183 LYS n 1 184 ILE n 1 185 CYS n 1 186 ASP n 1 187 PHE n 1 188 GLY n 1 189 LEU n 1 190 ALA n 1 191 ARG n 1 192 VAL n 1 193 ALA n 1 194 ASP n 1 195 PRO n 1 196 ASP n 1 197 HIS n 1 198 ASP n 1 199 HIS n 1 200 THR n 1 201 GLY n 1 202 PHE n 1 203 LEU n 1 204 THR n 1 205 GLU n 1 206 TYR n 1 207 VAL n 1 208 ALA n 1 209 THR n 1 210 ARG n 1 211 TRP n 1 212 TYR n 1 213 ARG n 1 214 ALA n 1 215 PRO n 1 216 GLU n 1 217 ILE n 1 218 MET n 1 219 LEU n 1 220 ASN n 1 221 SER n 1 222 LYS n 1 223 GLY n 1 224 TYR n 1 225 THR n 1 226 LYS n 1 227 SER n 1 228 ILE n 1 229 ASP n 1 230 ILE n 1 231 TRP n 1 232 SER n 1 233 VAL n 1 234 GLY n 1 235 CYS n 1 236 ILE n 1 237 LEU n 1 238 ALA n 1 239 GLU n 1 240 MET n 1 241 LEU n 1 242 SER n 1 243 ASN n 1 244 ARG n 1 245 PRO n 1 246 ILE n 1 247 PHE n 1 248 PRO n 1 249 GLY n 1 250 LYS n 1 251 HIS n 1 252 TYR n 1 253 LEU n 1 254 ASP n 1 255 GLN n 1 256 LEU n 1 257 ASN n 1 258 HIS n 1 259 ILE n 1 260 LEU n 1 261 GLY n 1 262 ILE n 1 263 LEU n 1 264 GLY n 1 265 SER n 1 266 PRO n 1 267 SER n 1 268 GLN n 1 269 GLU n 1 270 ASP n 1 271 LEU n 1 272 ASN n 1 273 CYS n 1 274 ILE n 1 275 ILE n 1 276 ASN n 1 277 LEU n 1 278 LYS n 1 279 ALA n 1 280 ARG n 1 281 ASN n 1 282 TYR n 1 283 LEU n 1 284 LEU n 1 285 SER n 1 286 LEU n 1 287 PRO n 1 288 HIS n 1 289 LYS n 1 290 ASN n 1 291 LYS n 1 292 VAL n 1 293 PRO n 1 294 TRP n 1 295 ASN n 1 296 ARG n 1 297 LEU n 1 298 PHE n 1 299 PRO n 1 300 ASN n 1 301 ALA n 1 302 ASP n 1 303 SER n 1 304 LYS n 1 305 ALA n 1 306 LEU n 1 307 ASP n 1 308 LEU n 1 309 LEU n 1 310 ASP n 1 311 LYS n 1 312 MET n 1 313 LEU n 1 314 THR n 1 315 PHE n 1 316 ASN n 1 317 PRO n 1 318 HIS n 1 319 LYS n 1 320 ARG n 1 321 ILE n 1 322 GLU n 1 323 VAL n 1 324 GLU n 1 325 GLN n 1 326 ALA n 1 327 LEU n 1 328 ALA n 1 329 HIS n 1 330 PRO n 1 331 TYR n 1 332 LEU n 1 333 GLU n 1 334 GLN n 1 335 TYR n 1 336 TYR n 1 337 ASP n 1 338 PRO n 1 339 SER n 1 340 ASP n 1 341 GLU n 1 342 PRO n 1 343 ILE n 1 344 ALA n 1 345 GLU n 1 346 ALA n 1 347 PRO n 1 348 PHE n 1 349 LYS n 1 350 PHE n 1 351 ASP n 1 352 MET n 1 353 GLU n 1 354 LEU n 1 355 ASP n 1 356 ASP n 1 357 LEU n 1 358 PRO n 1 359 LYS n 1 360 GLU n 1 361 LYS n 1 362 LEU n 1 363 LYS n 1 364 GLU n 1 365 LEU n 1 366 ILE n 1 367 PHE n 1 368 GLU n 1 369 GLU n 1 370 THR n 1 371 ALA n 1 372 ARG n 1 373 PHE n 1 374 GLN n 1 375 PRO n 1 376 GLY n 1 377 TYR n 1 378 ARG n 1 379 SER n 1 380 LEU n 1 381 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 381 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MAPK1, ERK2, PRKM1, PRKM2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MK01_HUMAN _struct_ref.pdbx_db_accession P28482 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRH ENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTT CDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPS DEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5NHO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 20 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 379 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P28482 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 360 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 360 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5NHO MET A 1 ? UNP P28482 ? ? 'initiating methionine' -18 1 1 5NHO HIS A 2 ? UNP P28482 ? ? 'expression tag' -17 2 1 5NHO HIS A 3 ? UNP P28482 ? ? 'expression tag' -16 3 1 5NHO HIS A 4 ? UNP P28482 ? ? 'expression tag' -15 4 1 5NHO HIS A 5 ? UNP P28482 ? ? 'expression tag' -14 5 1 5NHO HIS A 6 ? UNP P28482 ? ? 'expression tag' -13 6 1 5NHO HIS A 7 ? UNP P28482 ? ? 'expression tag' -12 7 1 5NHO GLY A 8 ? UNP P28482 ? ? 'expression tag' -11 8 1 5NHO GLY A 9 ? UNP P28482 ? ? 'expression tag' -10 9 1 5NHO GLY A 10 ? UNP P28482 ? ? 'expression tag' -9 10 1 5NHO GLU A 11 ? UNP P28482 ? ? 'expression tag' -8 11 1 5NHO ASN A 12 ? UNP P28482 ? ? 'expression tag' -7 12 1 5NHO LEU A 13 ? UNP P28482 ? ? 'expression tag' -6 13 1 5NHO TYR A 14 ? UNP P28482 ? ? 'expression tag' -5 14 1 5NHO PHE A 15 ? UNP P28482 ? ? 'expression tag' -4 15 1 5NHO GLN A 16 ? UNP P28482 ? ? 'expression tag' -3 16 1 5NHO GLY A 17 ? UNP P28482 ? ? 'expression tag' -2 17 1 5NHO SER A 18 ? UNP P28482 ? ? 'expression tag' -1 18 1 5NHO HIS A 19 ? UNP P28482 ? ? 'expression tag' 0 19 1 5NHO LEU A 65 ? UNP P28482 VAL 46 conflict 46 20 1 5NHO LEU A 380 ? UNP P28482 ? ? 'expression tag' 361 21 1 5NHO GLU A 381 ? UNP P28482 ? ? 'expression tag' 362 22 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 8XN non-polymer . ;(6~{S})-5-(2-methoxyethyl)-6-methyl-2-[5-methyl-2-[(2-methylpyrazol-3-yl)amino]pyrimidin-4-yl]-6,7-dihydro-1~{H}-pyrrolo[3,2-c]pyridin-4-one ; ? 'C20 H25 N7 O2' 395.458 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5NHO _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.28 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.05 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '30% PegMME2K, 100mM HEPES pH 7.6, 200mM Ammonium sulfate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-07-18 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97625 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I03' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97625 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I03 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 57.53 _reflns.entry_id 5NHO _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.24 _reflns.d_resolution_low 21.18 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 18618 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.2 _reflns.pdbx_Rmerge_I_obs 0.058 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.055 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.24 _reflns_shell.d_res_low 2.3 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.7 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1351 _reflns_shell.percent_possible_all 97.7 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.612 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.2 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.571 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 13.17100 _refine.aniso_B[1][2] 0.00000 _refine.aniso_B[1][3] 3.56410 _refine.aniso_B[2][2] -8.37750 _refine.aniso_B[2][3] 0.00000 _refine.aniso_B[3][3] -4.79350 _refine.B_iso_max ? _refine.B_iso_mean 64.43 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.946 _refine.correlation_coeff_Fo_to_Fc_free 0.911 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5NHO _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.24 _refine.ls_d_res_low 21.18 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 18601 _refine.ls_number_reflns_R_free 1166 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.6 _refine.ls_percent_reflns_R_free 6.270 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.201 _refine.ls_R_factor_R_free 0.231 _refine.ls_R_factor_R_free_error 0.000 _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.198 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.202 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.197 _refine.pdbx_overall_SU_R_Blow_DPI 0.266 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.275 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 5NHO _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.32 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 2686 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 34 _refine_hist.number_atoms_solvent 87 _refine_hist.number_atoms_total 2807 _refine_hist.d_res_high 2.24 _refine_hist.d_res_low 21.18 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 ? 2788 ? t_bond_d 2.00 HARMONIC 'X-RAY DIFFRACTION' ? 1.08 ? 3804 ? t_angle_deg 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 925 ? t_dihedral_angle_d 2.00 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? ? ? t_incorr_chiral_ct ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? 63 ? t_trig_c_planes 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 434 ? t_gen_planes 5.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 2788 ? t_it 20.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ? 'X-RAY DIFFRACTION' ? 2.94 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 18.98 ? ? ? t_other_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 370 ? t_chiral_improper_torsion 5.00 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 3327 ? t_ideal_dist_contact 4.00 SEMIHARMONIC # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.24 _refine_ls_shell.d_res_low 2.38 _refine_ls_shell.number_reflns_all 2984 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 171 _refine_ls_shell.number_reflns_R_work 2813 _refine_ls_shell.percent_reflns_obs 97.58 _refine_ls_shell.percent_reflns_R_free 5.73 _refine_ls_shell.R_factor_all 0.274 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.312 _refine_ls_shell.R_factor_R_free_error 0.000 _refine_ls_shell.R_factor_R_work 0.272 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 9 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5NHO _struct.title 'Human Erk2 with an Erk1/2 inhibitor' _struct.pdbx_descriptor 'Mitogen-activated protein kinase 1 (E.C.2.7.11.24)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5NHO _struct_keywords.text 'Erk2, kinase, inhibitor, oncology, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 80 ? PHE A 97 ? HIS A 61 PHE A 78 1 ? 18 HELX_P HELX_P2 AA2 LEU A 131 ? GLN A 138 ? LEU A 112 GLN A 119 1 ? 8 HELX_P HELX_P3 AA3 SER A 141 ? ALA A 162 ? SER A 122 ALA A 143 1 ? 22 HELX_P HELX_P4 AA4 LYS A 170 ? SER A 172 ? LYS A 151 SER A 153 5 ? 3 HELX_P HELX_P5 AA5 ASP A 194 ? ASP A 198 ? ASP A 175 ASP A 179 5 ? 5 HELX_P HELX_P6 AA6 THR A 209 ? ARG A 213 ? THR A 190 ARG A 194 5 ? 5 HELX_P HELX_P7 AA7 ALA A 214 ? ASN A 220 ? ALA A 195 ASN A 201 1 ? 7 HELX_P HELX_P8 AA8 LYS A 226 ? ASN A 243 ? LYS A 207 ASN A 224 1 ? 18 HELX_P HELX_P9 AA9 HIS A 251 ? GLY A 264 ? HIS A 232 GLY A 245 1 ? 14 HELX_P HELX_P10 AB1 SER A 267 ? CYS A 273 ? SER A 248 CYS A 254 1 ? 7 HELX_P HELX_P11 AB2 ASN A 276 ? LEU A 286 ? ASN A 257 LEU A 267 1 ? 11 HELX_P HELX_P12 AB3 PRO A 293 ? PHE A 298 ? PRO A 274 PHE A 279 1 ? 6 HELX_P HELX_P13 AB4 ASP A 302 ? LEU A 313 ? ASP A 283 LEU A 294 1 ? 12 HELX_P HELX_P14 AB5 GLU A 322 ? ALA A 328 ? GLU A 303 ALA A 309 1 ? 7 HELX_P HELX_P15 AB6 HIS A 329 ? GLU A 333 ? HIS A 310 GLU A 314 5 ? 5 HELX_P HELX_P16 AB7 ASP A 337 ? GLU A 341 ? ASP A 318 GLU A 322 5 ? 5 HELX_P HELX_P17 AB8 PRO A 358 ? THR A 370 ? PRO A 339 THR A 351 1 ? 13 HELX_P HELX_P18 AB9 ALA A 371 ? GLN A 374 ? ALA A 352 GLN A 355 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 41 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id 22 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 42 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 23 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -6.26 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 5 ? AA3 ? 3 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 MET A 32 ? VAL A 33 ? MET A 13 VAL A 14 AA1 2 GLN A 36 ? VAL A 37 ? GLN A 17 VAL A 18 AA2 1 TYR A 44 ? GLU A 52 ? TYR A 25 GLU A 33 AA2 2 GLY A 56 ? ASP A 63 ? GLY A 37 ASP A 44 AA2 3 VAL A 68 ? ILE A 75 ? VAL A 49 ILE A 56 AA2 4 VAL A 120 ? ASP A 125 ? VAL A 101 ASP A 106 AA2 5 ASP A 107 ? ILE A 109 ? ASP A 88 ILE A 90 AA3 1 THR A 129 ? ASP A 130 ? THR A 110 ASP A 111 AA3 2 LEU A 174 ? LEU A 176 ? LEU A 155 LEU A 157 AA3 3 LEU A 182 ? ILE A 184 ? LEU A 163 ILE A 165 AA4 1 VAL A 164 ? LEU A 165 ? VAL A 145 LEU A 146 AA4 2 ARG A 191 ? VAL A 192 ? ARG A 172 VAL A 173 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 33 ? N VAL A 14 O GLN A 36 ? O GLN A 17 AA2 1 2 N THR A 45 ? N THR A 26 O TYR A 62 ? O TYR A 43 AA2 2 3 N ALA A 61 ? N ALA A 42 O VAL A 70 ? O VAL A 51 AA2 3 4 N ALA A 71 ? N ALA A 52 O GLN A 124 ? O GLN A 105 AA2 4 5 O VAL A 123 ? O VAL A 104 N ASP A 107 ? N ASP A 88 AA3 1 2 N THR A 129 ? N THR A 110 O LEU A 176 ? O LEU A 157 AA3 2 3 N LEU A 175 ? N LEU A 156 O LYS A 183 ? O LYS A 164 AA4 1 2 N LEU A 165 ? N LEU A 146 O ARG A 191 ? O ARG A 172 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 401 ? 4 'binding site for residue SO4 A 401' AC2 Software A 8XN 402 ? 12 'binding site for residue 8XN A 402' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 ARG A 210 ? ARG A 191 . ? 1_555 ? 2 AC1 4 ARG A 213 ? ARG A 194 . ? 1_555 ? 3 AC1 4 TYR A 252 ? TYR A 233 . ? 1_555 ? 4 AC1 4 HOH D . ? HOH A 511 . ? 1_555 ? 5 AC2 12 ILE A 50 ? ILE A 31 . ? 1_555 ? 6 AC2 12 GLY A 56 ? GLY A 37 . ? 1_555 ? 7 AC2 12 ALA A 71 ? ALA A 52 . ? 1_555 ? 8 AC2 12 LYS A 73 ? LYS A 54 . ? 1_555 ? 9 AC2 12 GLN A 124 ? GLN A 105 . ? 1_555 ? 10 AC2 12 ASP A 125 ? ASP A 106 . ? 1_555 ? 11 AC2 12 MET A 127 ? MET A 108 . ? 1_555 ? 12 AC2 12 GLU A 128 ? GLU A 109 . ? 1_555 ? 13 AC2 12 ASP A 130 ? ASP A 111 . ? 1_555 ? 14 AC2 12 LEU A 175 ? LEU A 156 . ? 1_555 ? 15 AC2 12 ASP A 186 ? ASP A 167 . ? 1_555 ? 16 AC2 12 HOH D . ? HOH A 540 . ? 1_555 ? # _atom_sites.entry_id 5NHO _atom_sites.fract_transf_matrix[1][1] 0.020446 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.008025 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013928 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017539 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -18 ? ? ? A . n A 1 2 HIS 2 -17 ? ? ? A . n A 1 3 HIS 3 -16 ? ? ? A . n A 1 4 HIS 4 -15 ? ? ? A . n A 1 5 HIS 5 -14 ? ? ? A . n A 1 6 HIS 6 -13 ? ? ? A . n A 1 7 HIS 7 -12 ? ? ? A . n A 1 8 GLY 8 -11 ? ? ? A . n A 1 9 GLY 9 -10 ? ? ? A . n A 1 10 GLY 10 -9 ? ? ? A . n A 1 11 GLU 11 -8 ? ? ? A . n A 1 12 ASN 12 -7 ? ? ? A . n A 1 13 LEU 13 -6 ? ? ? A . n A 1 14 TYR 14 -5 ? ? ? A . n A 1 15 PHE 15 -4 ? ? ? A . n A 1 16 GLN 16 -3 ? ? ? A . n A 1 17 GLY 17 -2 ? ? ? A . n A 1 18 SER 18 -1 ? ? ? A . n A 1 19 HIS 19 0 ? ? ? A . n A 1 20 MET 20 1 ? ? ? A . n A 1 21 ALA 21 2 ? ? ? A . n A 1 22 ALA 22 3 ? ? ? A . n A 1 23 ALA 23 4 ? ? ? A . n A 1 24 ALA 24 5 ? ? ? A . n A 1 25 ALA 25 6 ? ? ? A . n A 1 26 ALA 26 7 ? ? ? A . n A 1 27 GLY 27 8 ? ? ? A . n A 1 28 ALA 28 9 ? ? ? A . n A 1 29 GLY 29 10 ? ? ? A . n A 1 30 PRO 30 11 11 PRO PRO A . n A 1 31 GLU 31 12 12 GLU GLU A . n A 1 32 MET 32 13 13 MET MET A . n A 1 33 VAL 33 14 14 VAL VAL A . n A 1 34 ARG 34 15 15 ARG ARG A . n A 1 35 GLY 35 16 16 GLY GLY A . n A 1 36 GLN 36 17 17 GLN GLN A . n A 1 37 VAL 37 18 18 VAL VAL A . n A 1 38 PHE 38 19 19 PHE PHE A . n A 1 39 ASP 39 20 20 ASP ASP A . n A 1 40 VAL 40 21 21 VAL VAL A . n A 1 41 GLY 41 22 22 GLY GLY A . n A 1 42 PRO 42 23 23 PRO PRO A . n A 1 43 ARG 43 24 24 ARG ARG A . n A 1 44 TYR 44 25 25 TYR TYR A . n A 1 45 THR 45 26 26 THR THR A . n A 1 46 ASN 46 27 27 ASN ASN A . n A 1 47 LEU 47 28 28 LEU LEU A . n A 1 48 SER 48 29 29 SER SER A . n A 1 49 TYR 49 30 30 TYR TYR A . n A 1 50 ILE 50 31 31 ILE ILE A . n A 1 51 GLY 51 32 32 GLY GLY A . n A 1 52 GLU 52 33 33 GLU GLU A . n A 1 53 GLY 53 34 34 GLY GLY A . n A 1 54 ALA 54 35 35 ALA ALA A . n A 1 55 TYR 55 36 36 TYR TYR A . n A 1 56 GLY 56 37 37 GLY GLY A . n A 1 57 MET 57 38 38 MET MET A . n A 1 58 VAL 58 39 39 VAL VAL A . n A 1 59 CYS 59 40 40 CYS CYS A . n A 1 60 SER 60 41 41 SER SER A . n A 1 61 ALA 61 42 42 ALA ALA A . n A 1 62 TYR 62 43 43 TYR TYR A . n A 1 63 ASP 63 44 44 ASP ASP A . n A 1 64 ASN 64 45 45 ASN ASN A . n A 1 65 LEU 65 46 46 LEU LEU A . n A 1 66 ASN 66 47 47 ASN ASN A . n A 1 67 LYS 67 48 48 LYS LYS A . n A 1 68 VAL 68 49 49 VAL VAL A . n A 1 69 ARG 69 50 50 ARG ARG A . n A 1 70 VAL 70 51 51 VAL VAL A . n A 1 71 ALA 71 52 52 ALA ALA A . n A 1 72 ILE 72 53 53 ILE ILE A . n A 1 73 LYS 73 54 54 LYS LYS A . n A 1 74 LYS 74 55 55 LYS LYS A . n A 1 75 ILE 75 56 56 ILE ILE A . n A 1 76 SER 76 57 57 SER SER A . n A 1 77 PRO 77 58 58 PRO PRO A . n A 1 78 PHE 78 59 59 PHE PHE A . n A 1 79 GLU 79 60 60 GLU GLU A . n A 1 80 HIS 80 61 61 HIS HIS A . n A 1 81 GLN 81 62 62 GLN GLN A . n A 1 82 THR 82 63 63 THR THR A . n A 1 83 TYR 83 64 64 TYR TYR A . n A 1 84 CYS 84 65 65 CYS CYS A . n A 1 85 GLN 85 66 66 GLN GLN A . n A 1 86 ARG 86 67 67 ARG ARG A . n A 1 87 THR 87 68 68 THR THR A . n A 1 88 LEU 88 69 69 LEU LEU A . n A 1 89 ARG 89 70 70 ARG ARG A . n A 1 90 GLU 90 71 71 GLU GLU A . n A 1 91 ILE 91 72 72 ILE ILE A . n A 1 92 LYS 92 73 73 LYS LYS A . n A 1 93 ILE 93 74 74 ILE ILE A . n A 1 94 LEU 94 75 75 LEU LEU A . n A 1 95 LEU 95 76 76 LEU LEU A . n A 1 96 ARG 96 77 77 ARG ARG A . n A 1 97 PHE 97 78 78 PHE PHE A . n A 1 98 ARG 98 79 79 ARG ARG A . n A 1 99 HIS 99 80 80 HIS HIS A . n A 1 100 GLU 100 81 81 GLU GLU A . n A 1 101 ASN 101 82 82 ASN ASN A . n A 1 102 ILE 102 83 83 ILE ILE A . n A 1 103 ILE 103 84 84 ILE ILE A . n A 1 104 GLY 104 85 85 GLY GLY A . n A 1 105 ILE 105 86 86 ILE ILE A . n A 1 106 ASN 106 87 87 ASN ASN A . n A 1 107 ASP 107 88 88 ASP ASP A . n A 1 108 ILE 108 89 89 ILE ILE A . n A 1 109 ILE 109 90 90 ILE ILE A . n A 1 110 ARG 110 91 91 ARG ARG A . n A 1 111 ALA 111 92 92 ALA ALA A . n A 1 112 PRO 112 93 93 PRO PRO A . n A 1 113 THR 113 94 94 THR THR A . n A 1 114 ILE 114 95 95 ILE ILE A . n A 1 115 GLU 115 96 96 GLU GLU A . n A 1 116 GLN 116 97 97 GLN GLN A . n A 1 117 MET 117 98 98 MET MET A . n A 1 118 LYS 118 99 99 LYS LYS A . n A 1 119 ASP 119 100 100 ASP ASP A . n A 1 120 VAL 120 101 101 VAL VAL A . n A 1 121 TYR 121 102 102 TYR TYR A . n A 1 122 ILE 122 103 103 ILE ILE A . n A 1 123 VAL 123 104 104 VAL VAL A . n A 1 124 GLN 124 105 105 GLN GLN A . n A 1 125 ASP 125 106 106 ASP ASP A . n A 1 126 LEU 126 107 107 LEU LEU A . n A 1 127 MET 127 108 108 MET MET A . n A 1 128 GLU 128 109 109 GLU GLU A . n A 1 129 THR 129 110 110 THR THR A . n A 1 130 ASP 130 111 111 ASP ASP A . n A 1 131 LEU 131 112 112 LEU LEU A . n A 1 132 TYR 132 113 113 TYR TYR A . n A 1 133 LYS 133 114 114 LYS LYS A . n A 1 134 LEU 134 115 115 LEU LEU A . n A 1 135 LEU 135 116 116 LEU LEU A . n A 1 136 LYS 136 117 117 LYS LYS A . n A 1 137 THR 137 118 118 THR THR A . n A 1 138 GLN 138 119 119 GLN GLN A . n A 1 139 HIS 139 120 120 HIS HIS A . n A 1 140 LEU 140 121 121 LEU LEU A . n A 1 141 SER 141 122 122 SER SER A . n A 1 142 ASN 142 123 123 ASN ASN A . n A 1 143 ASP 143 124 124 ASP ASP A . n A 1 144 HIS 144 125 125 HIS HIS A . n A 1 145 ILE 145 126 126 ILE ILE A . n A 1 146 CYS 146 127 127 CYS CYS A . n A 1 147 TYR 147 128 128 TYR TYR A . n A 1 148 PHE 148 129 129 PHE PHE A . n A 1 149 LEU 149 130 130 LEU LEU A . n A 1 150 TYR 150 131 131 TYR TYR A . n A 1 151 GLN 151 132 132 GLN GLN A . n A 1 152 ILE 152 133 133 ILE ILE A . n A 1 153 LEU 153 134 134 LEU LEU A . n A 1 154 ARG 154 135 135 ARG ARG A . n A 1 155 GLY 155 136 136 GLY GLY A . n A 1 156 LEU 156 137 137 LEU LEU A . n A 1 157 LYS 157 138 138 LYS LYS A . n A 1 158 TYR 158 139 139 TYR TYR A . n A 1 159 ILE 159 140 140 ILE ILE A . n A 1 160 HIS 160 141 141 HIS HIS A . n A 1 161 SER 161 142 142 SER SER A . n A 1 162 ALA 162 143 143 ALA ALA A . n A 1 163 ASN 163 144 144 ASN ASN A . n A 1 164 VAL 164 145 145 VAL VAL A . n A 1 165 LEU 165 146 146 LEU LEU A . n A 1 166 HIS 166 147 147 HIS HIS A . n A 1 167 ARG 167 148 148 ARG ARG A . n A 1 168 ASP 168 149 149 ASP ASP A . n A 1 169 LEU 169 150 150 LEU LEU A . n A 1 170 LYS 170 151 151 LYS LYS A . n A 1 171 PRO 171 152 152 PRO PRO A . n A 1 172 SER 172 153 153 SER SER A . n A 1 173 ASN 173 154 154 ASN ASN A . n A 1 174 LEU 174 155 155 LEU LEU A . n A 1 175 LEU 175 156 156 LEU LEU A . n A 1 176 LEU 176 157 157 LEU LEU A . n A 1 177 ASN 177 158 158 ASN ASN A . n A 1 178 THR 178 159 159 THR THR A . n A 1 179 THR 179 160 160 THR THR A . n A 1 180 CYS 180 161 161 CYS CYS A . n A 1 181 ASP 181 162 162 ASP ASP A . n A 1 182 LEU 182 163 163 LEU LEU A . n A 1 183 LYS 183 164 164 LYS LYS A . n A 1 184 ILE 184 165 165 ILE ILE A . n A 1 185 CYS 185 166 166 CYS CYS A . n A 1 186 ASP 186 167 167 ASP ASP A . n A 1 187 PHE 187 168 168 PHE PHE A . n A 1 188 GLY 188 169 169 GLY GLY A . n A 1 189 LEU 189 170 170 LEU LEU A . n A 1 190 ALA 190 171 171 ALA ALA A . n A 1 191 ARG 191 172 172 ARG ARG A . n A 1 192 VAL 192 173 173 VAL VAL A . n A 1 193 ALA 193 174 174 ALA ALA A . n A 1 194 ASP 194 175 175 ASP ASP A . n A 1 195 PRO 195 176 176 PRO PRO A . n A 1 196 ASP 196 177 177 ASP ASP A . n A 1 197 HIS 197 178 178 HIS HIS A . n A 1 198 ASP 198 179 179 ASP ASP A . n A 1 199 HIS 199 180 180 HIS HIS A . n A 1 200 THR 200 181 181 THR THR A . n A 1 201 GLY 201 182 182 GLY GLY A . n A 1 202 PHE 202 183 183 PHE PHE A . n A 1 203 LEU 203 184 184 LEU LEU A . n A 1 204 THR 204 185 185 THR THR A . n A 1 205 GLU 205 186 186 GLU GLU A . n A 1 206 TYR 206 187 187 TYR TYR A . n A 1 207 VAL 207 188 188 VAL VAL A . n A 1 208 ALA 208 189 189 ALA ALA A . n A 1 209 THR 209 190 190 THR THR A . n A 1 210 ARG 210 191 191 ARG ARG A . n A 1 211 TRP 211 192 192 TRP TRP A . n A 1 212 TYR 212 193 193 TYR TYR A . n A 1 213 ARG 213 194 194 ARG ARG A . n A 1 214 ALA 214 195 195 ALA ALA A . n A 1 215 PRO 215 196 196 PRO PRO A . n A 1 216 GLU 216 197 197 GLU GLU A . n A 1 217 ILE 217 198 198 ILE ILE A . n A 1 218 MET 218 199 199 MET MET A . n A 1 219 LEU 219 200 200 LEU LEU A . n A 1 220 ASN 220 201 201 ASN ASN A . n A 1 221 SER 221 202 202 SER SER A . n A 1 222 LYS 222 203 203 LYS LYS A . n A 1 223 GLY 223 204 204 GLY GLY A . n A 1 224 TYR 224 205 205 TYR TYR A . n A 1 225 THR 225 206 206 THR THR A . n A 1 226 LYS 226 207 207 LYS LYS A . n A 1 227 SER 227 208 208 SER SER A . n A 1 228 ILE 228 209 209 ILE ILE A . n A 1 229 ASP 229 210 210 ASP ASP A . n A 1 230 ILE 230 211 211 ILE ILE A . n A 1 231 TRP 231 212 212 TRP TRP A . n A 1 232 SER 232 213 213 SER SER A . n A 1 233 VAL 233 214 214 VAL VAL A . n A 1 234 GLY 234 215 215 GLY GLY A . n A 1 235 CYS 235 216 216 CYS CYS A . n A 1 236 ILE 236 217 217 ILE ILE A . n A 1 237 LEU 237 218 218 LEU LEU A . n A 1 238 ALA 238 219 219 ALA ALA A . n A 1 239 GLU 239 220 220 GLU GLU A . n A 1 240 MET 240 221 221 MET MET A . n A 1 241 LEU 241 222 222 LEU LEU A . n A 1 242 SER 242 223 223 SER SER A . n A 1 243 ASN 243 224 224 ASN ASN A . n A 1 244 ARG 244 225 225 ARG ARG A . n A 1 245 PRO 245 226 226 PRO PRO A . n A 1 246 ILE 246 227 227 ILE ILE A . n A 1 247 PHE 247 228 228 PHE PHE A . n A 1 248 PRO 248 229 229 PRO PRO A . n A 1 249 GLY 249 230 230 GLY GLY A . n A 1 250 LYS 250 231 231 LYS LYS A . n A 1 251 HIS 251 232 232 HIS HIS A . n A 1 252 TYR 252 233 233 TYR TYR A . n A 1 253 LEU 253 234 234 LEU LEU A . n A 1 254 ASP 254 235 235 ASP ASP A . n A 1 255 GLN 255 236 236 GLN GLN A . n A 1 256 LEU 256 237 237 LEU LEU A . n A 1 257 ASN 257 238 238 ASN ASN A . n A 1 258 HIS 258 239 239 HIS HIS A . n A 1 259 ILE 259 240 240 ILE ILE A . n A 1 260 LEU 260 241 241 LEU LEU A . n A 1 261 GLY 261 242 242 GLY GLY A . n A 1 262 ILE 262 243 243 ILE ILE A . n A 1 263 LEU 263 244 244 LEU LEU A . n A 1 264 GLY 264 245 245 GLY GLY A . n A 1 265 SER 265 246 246 SER SER A . n A 1 266 PRO 266 247 247 PRO PRO A . n A 1 267 SER 267 248 248 SER SER A . n A 1 268 GLN 268 249 249 GLN GLN A . n A 1 269 GLU 269 250 250 GLU GLU A . n A 1 270 ASP 270 251 251 ASP ASP A . n A 1 271 LEU 271 252 252 LEU LEU A . n A 1 272 ASN 272 253 253 ASN ASN A . n A 1 273 CYS 273 254 254 CYS CYS A . n A 1 274 ILE 274 255 255 ILE ILE A . n A 1 275 ILE 275 256 256 ILE ILE A . n A 1 276 ASN 276 257 257 ASN ASN A . n A 1 277 LEU 277 258 258 LEU LEU A . n A 1 278 LYS 278 259 259 LYS LYS A . n A 1 279 ALA 279 260 260 ALA ALA A . n A 1 280 ARG 280 261 261 ARG ARG A . n A 1 281 ASN 281 262 262 ASN ASN A . n A 1 282 TYR 282 263 263 TYR TYR A . n A 1 283 LEU 283 264 264 LEU LEU A . n A 1 284 LEU 284 265 265 LEU LEU A . n A 1 285 SER 285 266 266 SER SER A . n A 1 286 LEU 286 267 267 LEU LEU A . n A 1 287 PRO 287 268 268 PRO PRO A . n A 1 288 HIS 288 269 269 HIS HIS A . n A 1 289 LYS 289 270 270 LYS LYS A . n A 1 290 ASN 290 271 271 ASN ASN A . n A 1 291 LYS 291 272 272 LYS LYS A . n A 1 292 VAL 292 273 273 VAL VAL A . n A 1 293 PRO 293 274 274 PRO PRO A . n A 1 294 TRP 294 275 275 TRP TRP A . n A 1 295 ASN 295 276 276 ASN ASN A . n A 1 296 ARG 296 277 277 ARG ARG A . n A 1 297 LEU 297 278 278 LEU LEU A . n A 1 298 PHE 298 279 279 PHE PHE A . n A 1 299 PRO 299 280 280 PRO PRO A . n A 1 300 ASN 300 281 281 ASN ASN A . n A 1 301 ALA 301 282 282 ALA ALA A . n A 1 302 ASP 302 283 283 ASP ASP A . n A 1 303 SER 303 284 284 SER SER A . n A 1 304 LYS 304 285 285 LYS LYS A . n A 1 305 ALA 305 286 286 ALA ALA A . n A 1 306 LEU 306 287 287 LEU LEU A . n A 1 307 ASP 307 288 288 ASP ASP A . n A 1 308 LEU 308 289 289 LEU LEU A . n A 1 309 LEU 309 290 290 LEU LEU A . n A 1 310 ASP 310 291 291 ASP ASP A . n A 1 311 LYS 311 292 292 LYS LYS A . n A 1 312 MET 312 293 293 MET MET A . n A 1 313 LEU 313 294 294 LEU LEU A . n A 1 314 THR 314 295 295 THR THR A . n A 1 315 PHE 315 296 296 PHE PHE A . n A 1 316 ASN 316 297 297 ASN ASN A . n A 1 317 PRO 317 298 298 PRO PRO A . n A 1 318 HIS 318 299 299 HIS HIS A . n A 1 319 LYS 319 300 300 LYS LYS A . n A 1 320 ARG 320 301 301 ARG ARG A . n A 1 321 ILE 321 302 302 ILE ILE A . n A 1 322 GLU 322 303 303 GLU GLU A . n A 1 323 VAL 323 304 304 VAL VAL A . n A 1 324 GLU 324 305 305 GLU GLU A . n A 1 325 GLN 325 306 306 GLN GLN A . n A 1 326 ALA 326 307 307 ALA ALA A . n A 1 327 LEU 327 308 308 LEU LEU A . n A 1 328 ALA 328 309 309 ALA ALA A . n A 1 329 HIS 329 310 310 HIS HIS A . n A 1 330 PRO 330 311 311 PRO PRO A . n A 1 331 TYR 331 312 312 TYR TYR A . n A 1 332 LEU 332 313 313 LEU LEU A . n A 1 333 GLU 333 314 314 GLU GLU A . n A 1 334 GLN 334 315 315 GLN GLN A . n A 1 335 TYR 335 316 316 TYR TYR A . n A 1 336 TYR 336 317 317 TYR TYR A . n A 1 337 ASP 337 318 318 ASP ASP A . n A 1 338 PRO 338 319 319 PRO PRO A . n A 1 339 SER 339 320 320 SER SER A . n A 1 340 ASP 340 321 321 ASP ASP A . n A 1 341 GLU 341 322 322 GLU GLU A . n A 1 342 PRO 342 323 323 PRO PRO A . n A 1 343 ILE 343 324 324 ILE ILE A . n A 1 344 ALA 344 325 325 ALA ALA A . n A 1 345 GLU 345 326 326 GLU GLU A . n A 1 346 ALA 346 327 327 ALA ALA A . n A 1 347 PRO 347 328 328 PRO PRO A . n A 1 348 PHE 348 329 329 PHE PHE A . n A 1 349 LYS 349 330 330 LYS LYS A . n A 1 350 PHE 350 331 331 PHE PHE A . n A 1 351 ASP 351 332 ? ? ? A . n A 1 352 MET 352 333 ? ? ? A . n A 1 353 GLU 353 334 334 GLU GLU A . n A 1 354 LEU 354 335 335 LEU LEU A . n A 1 355 ASP 355 336 336 ASP ASP A . n A 1 356 ASP 356 337 337 ASP ASP A . n A 1 357 LEU 357 338 338 LEU LEU A . n A 1 358 PRO 358 339 339 PRO PRO A . n A 1 359 LYS 359 340 340 LYS LYS A . n A 1 360 GLU 360 341 341 GLU GLU A . n A 1 361 LYS 361 342 342 LYS LYS A . n A 1 362 LEU 362 343 343 LEU LEU A . n A 1 363 LYS 363 344 344 LYS LYS A . n A 1 364 GLU 364 345 345 GLU GLU A . n A 1 365 LEU 365 346 346 LEU LEU A . n A 1 366 ILE 366 347 347 ILE ILE A . n A 1 367 PHE 367 348 348 PHE PHE A . n A 1 368 GLU 368 349 349 GLU GLU A . n A 1 369 GLU 369 350 350 GLU GLU A . n A 1 370 THR 370 351 351 THR THR A . n A 1 371 ALA 371 352 352 ALA ALA A . n A 1 372 ARG 372 353 353 ARG ARG A . n A 1 373 PHE 373 354 354 PHE PHE A . n A 1 374 GLN 374 355 355 GLN GLN A . n A 1 375 PRO 375 356 ? ? ? A . n A 1 376 GLY 376 357 ? ? ? A . n A 1 377 TYR 377 358 ? ? ? A . n A 1 378 ARG 378 359 ? ? ? A . n A 1 379 SER 379 360 ? ? ? A . n A 1 380 LEU 380 361 ? ? ? A . n A 1 381 GLU 381 362 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 401 1 SO4 SO4 A . C 3 8XN 1 402 1 8XN INH A . D 4 HOH 1 501 91 HOH HOH A . D 4 HOH 2 502 67 HOH HOH A . D 4 HOH 3 503 43 HOH HOH A . D 4 HOH 4 504 47 HOH HOH A . D 4 HOH 5 505 9 HOH HOH A . D 4 HOH 6 506 6 HOH HOH A . D 4 HOH 7 507 27 HOH HOH A . D 4 HOH 8 508 32 HOH HOH A . D 4 HOH 9 509 92 HOH HOH A . D 4 HOH 10 510 52 HOH HOH A . D 4 HOH 11 511 96 HOH HOH A . D 4 HOH 12 512 33 HOH HOH A . D 4 HOH 13 513 44 HOH HOH A . D 4 HOH 14 514 34 HOH HOH A . D 4 HOH 15 515 73 HOH HOH A . D 4 HOH 16 516 64 HOH HOH A . D 4 HOH 17 517 35 HOH HOH A . D 4 HOH 18 518 46 HOH HOH A . D 4 HOH 19 519 36 HOH HOH A . D 4 HOH 20 520 57 HOH HOH A . D 4 HOH 21 521 55 HOH HOH A . D 4 HOH 22 522 26 HOH HOH A . D 4 HOH 23 523 53 HOH HOH A . D 4 HOH 24 524 72 HOH HOH A . D 4 HOH 25 525 95 HOH HOH A . D 4 HOH 26 526 70 HOH HOH A . D 4 HOH 27 527 42 HOH HOH A . D 4 HOH 28 528 62 HOH HOH A . D 4 HOH 29 529 66 HOH HOH A . D 4 HOH 30 530 7 HOH HOH A . D 4 HOH 31 531 56 HOH HOH A . D 4 HOH 32 532 10 HOH HOH A . D 4 HOH 33 533 93 HOH HOH A . D 4 HOH 34 534 45 HOH HOH A . D 4 HOH 35 535 29 HOH HOH A . D 4 HOH 36 536 15 HOH HOH A . D 4 HOH 37 537 38 HOH HOH A . D 4 HOH 38 538 5 HOH HOH A . D 4 HOH 39 539 40 HOH HOH A . D 4 HOH 40 540 59 HOH HOH A . D 4 HOH 41 541 11 HOH HOH A . D 4 HOH 42 542 37 HOH HOH A . D 4 HOH 43 543 41 HOH HOH A . D 4 HOH 44 544 61 HOH HOH A . D 4 HOH 45 545 84 HOH HOH A . D 4 HOH 46 546 18 HOH HOH A . D 4 HOH 47 547 28 HOH HOH A . D 4 HOH 48 548 94 HOH HOH A . D 4 HOH 49 549 79 HOH HOH A . D 4 HOH 50 550 89 HOH HOH A . D 4 HOH 51 551 48 HOH HOH A . D 4 HOH 52 552 49 HOH HOH A . D 4 HOH 53 553 58 HOH HOH A . D 4 HOH 54 554 75 HOH HOH A . D 4 HOH 55 555 65 HOH HOH A . D 4 HOH 56 556 19 HOH HOH A . D 4 HOH 57 557 54 HOH HOH A . D 4 HOH 58 558 63 HOH HOH A . D 4 HOH 59 559 81 HOH HOH A . D 4 HOH 60 560 25 HOH HOH A . D 4 HOH 61 561 22 HOH HOH A . D 4 HOH 62 562 71 HOH HOH A . D 4 HOH 63 563 12 HOH HOH A . D 4 HOH 64 564 74 HOH HOH A . D 4 HOH 65 565 90 HOH HOH A . D 4 HOH 66 566 78 HOH HOH A . D 4 HOH 67 567 88 HOH HOH A . D 4 HOH 68 568 80 HOH HOH A . D 4 HOH 69 569 51 HOH HOH A . D 4 HOH 70 570 86 HOH HOH A . D 4 HOH 71 571 39 HOH HOH A . D 4 HOH 72 572 85 HOH HOH A . D 4 HOH 73 573 69 HOH HOH A . D 4 HOH 74 574 21 HOH HOH A . D 4 HOH 75 575 23 HOH HOH A . D 4 HOH 76 576 82 HOH HOH A . D 4 HOH 77 577 97 HOH HOH A . D 4 HOH 78 578 77 HOH HOH A . D 4 HOH 79 579 16 HOH HOH A . D 4 HOH 80 580 76 HOH HOH A . D 4 HOH 81 581 31 HOH HOH A . D 4 HOH 82 582 13 HOH HOH A . D 4 HOH 83 583 30 HOH HOH A . D 4 HOH 84 584 50 HOH HOH A . D 4 HOH 85 585 20 HOH HOH A . D 4 HOH 86 586 68 HOH HOH A . D 4 HOH 87 587 24 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 180 ? 1 MORE -12 ? 1 'SSA (A^2)' 15580 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-04-19 2 'Structure model' 1 1 2017-05-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -6.1051 _pdbx_refine_tls.origin_y 8.4550 _pdbx_refine_tls.origin_z 47.3647 _pdbx_refine_tls.T[1][1] -0.1618 _pdbx_refine_tls.T[2][2] -0.1444 _pdbx_refine_tls.T[3][3] -0.1002 _pdbx_refine_tls.T[1][2] -0.0149 _pdbx_refine_tls.T[1][3] 0.0588 _pdbx_refine_tls.T[2][3] 0.0217 _pdbx_refine_tls.L[1][1] 1.8631 _pdbx_refine_tls.L[2][2] 1.0544 _pdbx_refine_tls.L[3][3] 1.8361 _pdbx_refine_tls.L[1][2] 0.5235 _pdbx_refine_tls.L[1][3] 0.5954 _pdbx_refine_tls.L[2][3] 0.6704 _pdbx_refine_tls.S[1][1] -0.1259 _pdbx_refine_tls.S[1][2] -0.0064 _pdbx_refine_tls.S[1][3] 0.1108 _pdbx_refine_tls.S[2][1] -0.1270 _pdbx_refine_tls.S[2][2] 0.0392 _pdbx_refine_tls.S[2][3] 0.0708 _pdbx_refine_tls.S[3][1] -0.0741 _pdbx_refine_tls.S[3][2] 0.0187 _pdbx_refine_tls.S[3][3] 0.0868 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details '{ A|* }' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.11.6 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 C _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 GLY _pdbx_validate_rmsd_angle.auth_seq_id_1 22 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 N _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 PRO _pdbx_validate_rmsd_angle.auth_seq_id_2 23 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CD _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 PRO _pdbx_validate_rmsd_angle.auth_seq_id_3 23 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 95.61 _pdbx_validate_rmsd_angle.angle_target_value 120.60 _pdbx_validate_rmsd_angle.angle_deviation -24.99 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.20 _pdbx_validate_rmsd_angle.linker_flag Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 98 ? ? -68.05 97.47 2 1 THR A 110 ? ? -161.00 -169.88 3 1 ARG A 148 ? ? 79.23 -4.46 4 1 ASP A 149 ? ? -140.19 41.18 5 1 ASN A 201 ? ? -145.84 17.93 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 12 ? CG ? A GLU 31 CG 2 1 Y 1 A GLU 12 ? CD ? A GLU 31 CD 3 1 Y 1 A GLU 12 ? OE1 ? A GLU 31 OE1 4 1 Y 1 A GLU 12 ? OE2 ? A GLU 31 OE2 5 1 Y 1 A MET 13 ? CG ? A MET 32 CG 6 1 Y 1 A MET 13 ? SD ? A MET 32 SD 7 1 Y 1 A MET 13 ? CE ? A MET 32 CE 8 1 Y 1 A VAL 14 ? CG1 ? A VAL 33 CG1 9 1 Y 1 A VAL 14 ? CG2 ? A VAL 33 CG2 10 1 Y 1 A ARG 15 ? CG ? A ARG 34 CG 11 1 Y 1 A ARG 15 ? CD ? A ARG 34 CD 12 1 Y 1 A ARG 15 ? NE ? A ARG 34 NE 13 1 Y 1 A ARG 15 ? CZ ? A ARG 34 CZ 14 1 Y 1 A ARG 15 ? NH1 ? A ARG 34 NH1 15 1 Y 1 A ARG 15 ? NH2 ? A ARG 34 NH2 16 1 Y 1 A VAL 18 ? CG1 ? A VAL 37 CG1 17 1 Y 1 A VAL 18 ? CG2 ? A VAL 37 CG2 18 1 Y 1 A ASP 20 ? CG ? A ASP 39 CG 19 1 Y 1 A ASP 20 ? OD1 ? A ASP 39 OD1 20 1 Y 1 A ASP 20 ? OD2 ? A ASP 39 OD2 21 1 Y 1 A LEU 46 ? CG ? A LEU 65 CG 22 1 Y 1 A LEU 46 ? CD1 ? A LEU 65 CD1 23 1 Y 1 A LEU 46 ? CD2 ? A LEU 65 CD2 24 1 Y 1 A LYS 48 ? CG ? A LYS 67 CG 25 1 Y 1 A LYS 48 ? CD ? A LYS 67 CD 26 1 Y 1 A LYS 48 ? CE ? A LYS 67 CE 27 1 Y 1 A LYS 48 ? NZ ? A LYS 67 NZ 28 1 Y 1 A LYS 55 ? CD ? A LYS 74 CD 29 1 Y 1 A LYS 55 ? CE ? A LYS 74 CE 30 1 Y 1 A LYS 55 ? NZ ? A LYS 74 NZ 31 1 Y 1 A ILE 56 ? CD1 ? A ILE 75 CD1 32 1 Y 1 A GLU 60 ? CG ? A GLU 79 CG 33 1 Y 1 A GLU 60 ? CD ? A GLU 79 CD 34 1 Y 1 A GLU 60 ? OE1 ? A GLU 79 OE1 35 1 Y 1 A GLU 60 ? OE2 ? A GLU 79 OE2 36 1 Y 1 A LYS 73 ? NZ ? A LYS 92 NZ 37 1 Y 1 A ASP 88 ? CG ? A ASP 107 CG 38 1 Y 1 A ASP 88 ? OD1 ? A ASP 107 OD1 39 1 Y 1 A ASP 88 ? OD2 ? A ASP 107 OD2 40 1 Y 1 A LYS 99 ? CG ? A LYS 118 CG 41 1 Y 1 A LYS 99 ? CD ? A LYS 118 CD 42 1 Y 1 A LYS 99 ? CE ? A LYS 118 CE 43 1 Y 1 A LYS 99 ? NZ ? A LYS 118 NZ 44 1 Y 1 A LYS 114 ? CE ? A LYS 133 CE 45 1 Y 1 A LYS 114 ? NZ ? A LYS 133 NZ 46 1 Y 1 A LYS 117 ? CG ? A LYS 136 CG 47 1 Y 1 A LYS 117 ? CD ? A LYS 136 CD 48 1 Y 1 A LYS 117 ? CE ? A LYS 136 CE 49 1 Y 1 A LYS 117 ? NZ ? A LYS 136 NZ 50 1 Y 1 A ASP 124 ? CG ? A ASP 143 CG 51 1 Y 1 A ASP 124 ? OD1 ? A ASP 143 OD1 52 1 Y 1 A ASP 124 ? OD2 ? A ASP 143 OD2 53 1 Y 1 A GLU 186 ? CG ? A GLU 205 CG 54 1 Y 1 A GLU 186 ? CD ? A GLU 205 CD 55 1 Y 1 A GLU 186 ? OE1 ? A GLU 205 OE1 56 1 Y 1 A GLU 186 ? OE2 ? A GLU 205 OE2 57 1 Y 1 A LYS 231 ? CG ? A LYS 250 CG 58 1 Y 1 A LYS 231 ? CD ? A LYS 250 CD 59 1 Y 1 A LYS 231 ? CE ? A LYS 250 CE 60 1 Y 1 A LYS 231 ? NZ ? A LYS 250 NZ 61 1 Y 1 A GLU 250 ? CG ? A GLU 269 CG 62 1 Y 1 A GLU 250 ? CD ? A GLU 269 CD 63 1 Y 1 A GLU 250 ? OE1 ? A GLU 269 OE1 64 1 Y 1 A GLU 250 ? OE2 ? A GLU 269 OE2 65 1 Y 1 A LYS 259 ? CD ? A LYS 278 CD 66 1 Y 1 A LYS 259 ? CE ? A LYS 278 CE 67 1 Y 1 A LYS 259 ? NZ ? A LYS 278 NZ 68 1 Y 1 A LYS 270 ? CG ? A LYS 289 CG 69 1 Y 1 A LYS 270 ? CD ? A LYS 289 CD 70 1 Y 1 A LYS 270 ? CE ? A LYS 289 CE 71 1 Y 1 A LYS 270 ? NZ ? A LYS 289 NZ 72 1 Y 1 A LYS 272 ? CD ? A LYS 291 CD 73 1 Y 1 A LYS 272 ? CE ? A LYS 291 CE 74 1 Y 1 A LYS 272 ? NZ ? A LYS 291 NZ 75 1 Y 1 A ARG 277 ? CG ? A ARG 296 CG 76 1 Y 1 A ARG 277 ? CD ? A ARG 296 CD 77 1 Y 1 A ARG 277 ? NE ? A ARG 296 NE 78 1 Y 1 A ARG 277 ? CZ ? A ARG 296 CZ 79 1 Y 1 A ARG 277 ? NH1 ? A ARG 296 NH1 80 1 Y 1 A ARG 277 ? NH2 ? A ARG 296 NH2 81 1 Y 1 A LYS 285 ? CD ? A LYS 304 CD 82 1 Y 1 A LYS 285 ? CE ? A LYS 304 CE 83 1 Y 1 A LYS 285 ? NZ ? A LYS 304 NZ 84 1 Y 1 A LYS 300 ? CD ? A LYS 319 CD 85 1 Y 1 A LYS 300 ? CE ? A LYS 319 CE 86 1 Y 1 A LYS 300 ? NZ ? A LYS 319 NZ 87 1 Y 1 A GLU 303 ? CG ? A GLU 322 CG 88 1 Y 1 A GLU 303 ? CD ? A GLU 322 CD 89 1 Y 1 A GLU 303 ? OE1 ? A GLU 322 OE1 90 1 Y 1 A GLU 303 ? OE2 ? A GLU 322 OE2 91 1 Y 1 A LYS 330 ? CG ? A LYS 349 CG 92 1 Y 1 A LYS 330 ? CD ? A LYS 349 CD 93 1 Y 1 A LYS 330 ? CE ? A LYS 349 CE 94 1 Y 1 A LYS 330 ? NZ ? A LYS 349 NZ 95 1 Y 1 A PHE 331 ? CG ? A PHE 350 CG 96 1 Y 1 A PHE 331 ? CD1 ? A PHE 350 CD1 97 1 Y 1 A PHE 331 ? CD2 ? A PHE 350 CD2 98 1 Y 1 A PHE 331 ? CE1 ? A PHE 350 CE1 99 1 Y 1 A PHE 331 ? CE2 ? A PHE 350 CE2 100 1 Y 1 A PHE 331 ? CZ ? A PHE 350 CZ 101 1 Y 1 A GLU 334 ? CG ? A GLU 353 CG 102 1 Y 1 A GLU 334 ? CD ? A GLU 353 CD 103 1 Y 1 A GLU 334 ? OE1 ? A GLU 353 OE1 104 1 Y 1 A GLU 334 ? OE2 ? A GLU 353 OE2 105 1 Y 1 A ASP 336 ? CG ? A ASP 355 CG 106 1 Y 1 A ASP 336 ? OD1 ? A ASP 355 OD1 107 1 Y 1 A ASP 336 ? OD2 ? A ASP 355 OD2 108 1 Y 1 A LYS 340 ? CG ? A LYS 359 CG 109 1 Y 1 A LYS 340 ? CD ? A LYS 359 CD 110 1 Y 1 A LYS 340 ? CE ? A LYS 359 CE 111 1 Y 1 A LYS 340 ? NZ ? A LYS 359 NZ 112 1 Y 1 A LYS 342 ? CD ? A LYS 361 CD 113 1 Y 1 A LYS 342 ? CE ? A LYS 361 CE 114 1 Y 1 A LYS 342 ? NZ ? A LYS 361 NZ 115 1 Y 1 A GLU 349 ? CG ? A GLU 368 CG 116 1 Y 1 A GLU 349 ? CD ? A GLU 368 CD 117 1 Y 1 A GLU 349 ? OE1 ? A GLU 368 OE1 118 1 Y 1 A GLU 349 ? OE2 ? A GLU 368 OE2 119 1 Y 1 A GLU 350 ? CG ? A GLU 369 CG 120 1 Y 1 A GLU 350 ? CD ? A GLU 369 CD 121 1 Y 1 A GLU 350 ? OE1 ? A GLU 369 OE1 122 1 Y 1 A GLU 350 ? OE2 ? A GLU 369 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -18 ? A MET 1 2 1 Y 1 A HIS -17 ? A HIS 2 3 1 Y 1 A HIS -16 ? A HIS 3 4 1 Y 1 A HIS -15 ? A HIS 4 5 1 Y 1 A HIS -14 ? A HIS 5 6 1 Y 1 A HIS -13 ? A HIS 6 7 1 Y 1 A HIS -12 ? A HIS 7 8 1 Y 1 A GLY -11 ? A GLY 8 9 1 Y 1 A GLY -10 ? A GLY 9 10 1 Y 1 A GLY -9 ? A GLY 10 11 1 Y 1 A GLU -8 ? A GLU 11 12 1 Y 1 A ASN -7 ? A ASN 12 13 1 Y 1 A LEU -6 ? A LEU 13 14 1 Y 1 A TYR -5 ? A TYR 14 15 1 Y 1 A PHE -4 ? A PHE 15 16 1 Y 1 A GLN -3 ? A GLN 16 17 1 Y 1 A GLY -2 ? A GLY 17 18 1 Y 1 A SER -1 ? A SER 18 19 1 Y 1 A HIS 0 ? A HIS 19 20 1 Y 1 A MET 1 ? A MET 20 21 1 Y 1 A ALA 2 ? A ALA 21 22 1 Y 1 A ALA 3 ? A ALA 22 23 1 Y 1 A ALA 4 ? A ALA 23 24 1 Y 1 A ALA 5 ? A ALA 24 25 1 Y 1 A ALA 6 ? A ALA 25 26 1 Y 1 A ALA 7 ? A ALA 26 27 1 Y 1 A GLY 8 ? A GLY 27 28 1 Y 1 A ALA 9 ? A ALA 28 29 1 Y 1 A GLY 10 ? A GLY 29 30 1 Y 1 A ASP 332 ? A ASP 351 31 1 Y 1 A MET 333 ? A MET 352 32 1 Y 1 A PRO 356 ? A PRO 375 33 1 Y 1 A GLY 357 ? A GLY 376 34 1 Y 1 A TYR 358 ? A TYR 377 35 1 Y 1 A ARG 359 ? A ARG 378 36 1 Y 1 A SER 360 ? A SER 379 37 1 Y 1 A LEU 361 ? A LEU 380 38 1 Y 1 A GLU 362 ? A GLU 381 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 ;(6~{S})-5-(2-methoxyethyl)-6-methyl-2-[5-methyl-2-[(2-methylpyrazol-3-yl)amino]pyrimidin-4-yl]-6,7-dihydro-1~{H}-pyrrolo[3,2-c]pyridin-4-one ; 8XN 4 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #