data_5NHV # _entry.id 5NHV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5NHV WWPDB D_1200004157 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5NHV _pdbx_database_status.recvd_initial_deposition_date 2017-03-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Debreczeni, J.E.' 1 ? 'Ward, R.A.' 2 ? 'Bethel, P.' 3 ? 'Cook, C.' 4 ? 'Davies, E.' 5 ? 'Eckersley, K.' 6 ? 'Fairley, G.' 7 ? 'Feron, L.' 8 ? 'Flemington, V.' 9 ? 'Graham, M.A.' 10 ? 'Greenwood, R.' 11 ? 'Hopcroft, P.' 12 ? 'Howard, T.D.' 13 ? 'Hudson, J.' 14 ? 'James, M.' 15 ? 'Jones, C.D.' 16 ? 'Jones, C.R.' 17 ? 'Lamont, S.' 18 ? 'Lewis, R.' 19 ? 'Lindsay, N.' 20 ? 'Roberts, K.' 21 ? 'Simpson, I.' 22 ? 'StGallay, S.' 23 ? 'Swallow, S.' 24 ? 'Tonge, M.' 25 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Med. Chem.' _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 1520-4804 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 60 _citation.language ? _citation.page_first 3438 _citation.page_last 3450 _citation.title ;Structure-Guided Discovery of Potent and Selective Inhibitors of ERK1/2 from a Modestly Active and Promiscuous Chemical Start Point. ; _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.7b00267 _citation.pdbx_database_id_PubMed 28376306 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Ward, R.A.' 1 primary 'Bethel, P.' 2 primary 'Cook, C.' 3 primary 'Davies, E.' 4 primary 'Debreczeni, J.E.' 5 primary 'Fairley, G.' 6 primary 'Feron, L.' 7 primary 'Flemington, V.' 8 primary 'Graham, M.A.' 9 primary 'Greenwood, R.' 10 primary 'Griffin, N.' 11 primary 'Hanson, L.' 12 primary 'Hopcroft, P.' 13 primary 'Howard, T.D.' 14 primary 'Hudson, J.' 15 primary 'James, M.' 16 primary 'Jones, C.D.' 17 primary 'Jones, C.R.' 18 primary 'Lamont, S.' 19 primary 'Lewis, R.' 20 primary 'Lindsay, N.' 21 primary 'Roberts, K.' 22 primary 'Simpson, I.' 23 primary 'St-Gallay, S.' 24 primary 'Swallow, S.' 25 primary 'Tang, J.' 26 primary 'Tonge, M.' 27 primary 'Wang, Z.' 28 primary 'Zhai, B.' 29 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 110.43 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5NHV _cell.details ? _cell.formula_units_Z ? _cell.length_a 48.883 _cell.length_a_esd ? _cell.length_b 70.597 _cell.length_b_esd ? _cell.length_c 60.988 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5NHV _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Mitogen-activated protein kinase 1' 43909.297 1 2.7.11.24 ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 non-polymer syn '7-[2-(oxan-4-ylamino)pyrimidin-4-yl]-3,4-dihydro-2~{H}-pyrrolo[1,2-a]pyrazin-1-one' 313.354 1 ? ? ? ? 4 water nat water 18.015 176 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'MAPK 1,ERT1,Extracellular signal-regulated kinase 2,ERK-2,MAP kinase isoform p42,p42-MAPK,Mitogen-activated protein kinase 2,MAPK 2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHGGGENLYFQGSHMAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEH QTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIH SANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEM LSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKR IEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRSLE ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHGGGENLYFQGSHMAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEH QTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIH SANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEM LSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKR IEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRSLE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 GLY n 1 9 GLY n 1 10 GLY n 1 11 GLU n 1 12 ASN n 1 13 LEU n 1 14 TYR n 1 15 PHE n 1 16 GLN n 1 17 GLY n 1 18 SER n 1 19 HIS n 1 20 MET n 1 21 ALA n 1 22 ALA n 1 23 ALA n 1 24 ALA n 1 25 ALA n 1 26 ALA n 1 27 GLY n 1 28 ALA n 1 29 GLY n 1 30 PRO n 1 31 GLU n 1 32 MET n 1 33 VAL n 1 34 ARG n 1 35 GLY n 1 36 GLN n 1 37 VAL n 1 38 PHE n 1 39 ASP n 1 40 VAL n 1 41 GLY n 1 42 PRO n 1 43 ARG n 1 44 TYR n 1 45 THR n 1 46 ASN n 1 47 LEU n 1 48 SER n 1 49 TYR n 1 50 ILE n 1 51 GLY n 1 52 GLU n 1 53 GLY n 1 54 ALA n 1 55 TYR n 1 56 GLY n 1 57 MET n 1 58 VAL n 1 59 CYS n 1 60 SER n 1 61 ALA n 1 62 TYR n 1 63 ASP n 1 64 ASN n 1 65 LEU n 1 66 ASN n 1 67 LYS n 1 68 VAL n 1 69 ARG n 1 70 VAL n 1 71 ALA n 1 72 ILE n 1 73 LYS n 1 74 LYS n 1 75 ILE n 1 76 SER n 1 77 PRO n 1 78 PHE n 1 79 GLU n 1 80 HIS n 1 81 GLN n 1 82 THR n 1 83 TYR n 1 84 CYS n 1 85 GLN n 1 86 ARG n 1 87 THR n 1 88 LEU n 1 89 ARG n 1 90 GLU n 1 91 ILE n 1 92 LYS n 1 93 ILE n 1 94 LEU n 1 95 LEU n 1 96 ARG n 1 97 PHE n 1 98 ARG n 1 99 HIS n 1 100 GLU n 1 101 ASN n 1 102 ILE n 1 103 ILE n 1 104 GLY n 1 105 ILE n 1 106 ASN n 1 107 ASP n 1 108 ILE n 1 109 ILE n 1 110 ARG n 1 111 ALA n 1 112 PRO n 1 113 THR n 1 114 ILE n 1 115 GLU n 1 116 GLN n 1 117 MET n 1 118 LYS n 1 119 ASP n 1 120 VAL n 1 121 TYR n 1 122 ILE n 1 123 VAL n 1 124 GLN n 1 125 ASP n 1 126 LEU n 1 127 MET n 1 128 GLU n 1 129 THR n 1 130 ASP n 1 131 LEU n 1 132 TYR n 1 133 LYS n 1 134 LEU n 1 135 LEU n 1 136 LYS n 1 137 THR n 1 138 GLN n 1 139 HIS n 1 140 LEU n 1 141 SER n 1 142 ASN n 1 143 ASP n 1 144 HIS n 1 145 ILE n 1 146 CYS n 1 147 TYR n 1 148 PHE n 1 149 LEU n 1 150 TYR n 1 151 GLN n 1 152 ILE n 1 153 LEU n 1 154 ARG n 1 155 GLY n 1 156 LEU n 1 157 LYS n 1 158 TYR n 1 159 ILE n 1 160 HIS n 1 161 SER n 1 162 ALA n 1 163 ASN n 1 164 VAL n 1 165 LEU n 1 166 HIS n 1 167 ARG n 1 168 ASP n 1 169 LEU n 1 170 LYS n 1 171 PRO n 1 172 SER n 1 173 ASN n 1 174 LEU n 1 175 LEU n 1 176 LEU n 1 177 ASN n 1 178 THR n 1 179 THR n 1 180 CYS n 1 181 ASP n 1 182 LEU n 1 183 LYS n 1 184 ILE n 1 185 CYS n 1 186 ASP n 1 187 PHE n 1 188 GLY n 1 189 LEU n 1 190 ALA n 1 191 ARG n 1 192 VAL n 1 193 ALA n 1 194 ASP n 1 195 PRO n 1 196 ASP n 1 197 HIS n 1 198 ASP n 1 199 HIS n 1 200 THR n 1 201 GLY n 1 202 PHE n 1 203 LEU n 1 204 THR n 1 205 GLU n 1 206 TYR n 1 207 VAL n 1 208 ALA n 1 209 THR n 1 210 ARG n 1 211 TRP n 1 212 TYR n 1 213 ARG n 1 214 ALA n 1 215 PRO n 1 216 GLU n 1 217 ILE n 1 218 MET n 1 219 LEU n 1 220 ASN n 1 221 SER n 1 222 LYS n 1 223 GLY n 1 224 TYR n 1 225 THR n 1 226 LYS n 1 227 SER n 1 228 ILE n 1 229 ASP n 1 230 ILE n 1 231 TRP n 1 232 SER n 1 233 VAL n 1 234 GLY n 1 235 CYS n 1 236 ILE n 1 237 LEU n 1 238 ALA n 1 239 GLU n 1 240 MET n 1 241 LEU n 1 242 SER n 1 243 ASN n 1 244 ARG n 1 245 PRO n 1 246 ILE n 1 247 PHE n 1 248 PRO n 1 249 GLY n 1 250 LYS n 1 251 HIS n 1 252 TYR n 1 253 LEU n 1 254 ASP n 1 255 GLN n 1 256 LEU n 1 257 ASN n 1 258 HIS n 1 259 ILE n 1 260 LEU n 1 261 GLY n 1 262 ILE n 1 263 LEU n 1 264 GLY n 1 265 SER n 1 266 PRO n 1 267 SER n 1 268 GLN n 1 269 GLU n 1 270 ASP n 1 271 LEU n 1 272 ASN n 1 273 CYS n 1 274 ILE n 1 275 ILE n 1 276 ASN n 1 277 LEU n 1 278 LYS n 1 279 ALA n 1 280 ARG n 1 281 ASN n 1 282 TYR n 1 283 LEU n 1 284 LEU n 1 285 SER n 1 286 LEU n 1 287 PRO n 1 288 HIS n 1 289 LYS n 1 290 ASN n 1 291 LYS n 1 292 VAL n 1 293 PRO n 1 294 TRP n 1 295 ASN n 1 296 ARG n 1 297 LEU n 1 298 PHE n 1 299 PRO n 1 300 ASN n 1 301 ALA n 1 302 ASP n 1 303 SER n 1 304 LYS n 1 305 ALA n 1 306 LEU n 1 307 ASP n 1 308 LEU n 1 309 LEU n 1 310 ASP n 1 311 LYS n 1 312 MET n 1 313 LEU n 1 314 THR n 1 315 PHE n 1 316 ASN n 1 317 PRO n 1 318 HIS n 1 319 LYS n 1 320 ARG n 1 321 ILE n 1 322 GLU n 1 323 VAL n 1 324 GLU n 1 325 GLN n 1 326 ALA n 1 327 LEU n 1 328 ALA n 1 329 HIS n 1 330 PRO n 1 331 TYR n 1 332 LEU n 1 333 GLU n 1 334 GLN n 1 335 TYR n 1 336 TYR n 1 337 ASP n 1 338 PRO n 1 339 SER n 1 340 ASP n 1 341 GLU n 1 342 PRO n 1 343 ILE n 1 344 ALA n 1 345 GLU n 1 346 ALA n 1 347 PRO n 1 348 PHE n 1 349 LYS n 1 350 PHE n 1 351 ASP n 1 352 MET n 1 353 GLU n 1 354 LEU n 1 355 ASP n 1 356 ASP n 1 357 LEU n 1 358 PRO n 1 359 LYS n 1 360 GLU n 1 361 LYS n 1 362 LEU n 1 363 LYS n 1 364 GLU n 1 365 LEU n 1 366 ILE n 1 367 PHE n 1 368 GLU n 1 369 GLU n 1 370 THR n 1 371 ALA n 1 372 ARG n 1 373 PHE n 1 374 GLN n 1 375 PRO n 1 376 GLY n 1 377 TYR n 1 378 ARG n 1 379 SER n 1 380 LEU n 1 381 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 381 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MAPK1, ERK2, PRKM1, PRKM2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MK01_HUMAN _struct_ref.pdbx_db_accession P28482 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRH ENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTT CDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPS DEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5NHV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 20 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 379 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P28482 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 360 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 360 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5NHV MET A 1 ? UNP P28482 ? ? 'initiating methionine' -18 1 1 5NHV HIS A 2 ? UNP P28482 ? ? 'expression tag' -17 2 1 5NHV HIS A 3 ? UNP P28482 ? ? 'expression tag' -16 3 1 5NHV HIS A 4 ? UNP P28482 ? ? 'expression tag' -15 4 1 5NHV HIS A 5 ? UNP P28482 ? ? 'expression tag' -14 5 1 5NHV HIS A 6 ? UNP P28482 ? ? 'expression tag' -13 6 1 5NHV HIS A 7 ? UNP P28482 ? ? 'expression tag' -12 7 1 5NHV GLY A 8 ? UNP P28482 ? ? 'expression tag' -11 8 1 5NHV GLY A 9 ? UNP P28482 ? ? 'expression tag' -10 9 1 5NHV GLY A 10 ? UNP P28482 ? ? 'expression tag' -9 10 1 5NHV GLU A 11 ? UNP P28482 ? ? 'expression tag' -8 11 1 5NHV ASN A 12 ? UNP P28482 ? ? 'expression tag' -7 12 1 5NHV LEU A 13 ? UNP P28482 ? ? 'expression tag' -6 13 1 5NHV TYR A 14 ? UNP P28482 ? ? 'expression tag' -5 14 1 5NHV PHE A 15 ? UNP P28482 ? ? 'expression tag' -4 15 1 5NHV GLN A 16 ? UNP P28482 ? ? 'expression tag' -3 16 1 5NHV GLY A 17 ? UNP P28482 ? ? 'expression tag' -2 17 1 5NHV SER A 18 ? UNP P28482 ? ? 'expression tag' -1 18 1 5NHV HIS A 19 ? UNP P28482 ? ? 'expression tag' 0 19 1 5NHV LEU A 65 ? UNP P28482 VAL 46 conflict 46 20 1 5NHV LEU A 380 ? UNP P28482 ? ? 'expression tag' 361 21 1 5NHV GLU A 381 ? UNP P28482 ? ? 'expression tag' 362 22 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 8QB non-polymer . '7-[2-(oxan-4-ylamino)pyrimidin-4-yl]-3,4-dihydro-2~{H}-pyrrolo[1,2-a]pyrazin-1-one' ? 'C16 H19 N5 O2' 313.354 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5NHV _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.25 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.23 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '30% PegMME2K, 100mM HEPES pH 7.6, 200mM Ammonium sulfate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-06-16 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID29' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.979 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID29 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 31.66 _reflns.entry_id 5NHV _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.00 _reflns.d_resolution_low 70.60 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 25618 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.4 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.4 _reflns.pdbx_Rmerge_I_obs 0.072 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.067 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.00 _reflns_shell.d_res_low 2.31 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.5 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 8914 _reflns_shell.percent_possible_all 97.1 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.368 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.4 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.34 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -1.0854 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 2.7051 _refine.aniso_B[2][2] 0.2213 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 0.8641 _refine.B_iso_max ? _refine.B_iso_mean 37.64 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.9476 _refine.correlation_coeff_Fo_to_Fc_free 0.9121 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5NHV _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.00 _refine.ls_d_res_low 45.81 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 25601 _refine.ls_number_reflns_R_free 1596 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.99 _refine.ls_percent_reflns_R_free 6.23 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1858 _refine.ls_R_factor_R_free 0.2283 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1828 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.157 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.156 _refine.pdbx_overall_SU_R_Blow_DPI 0.172 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.172 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 5NHV _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.232 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 2771 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 28 _refine_hist.number_atoms_solvent 176 _refine_hist.number_atoms_total 2975 _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 45.81 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 ? 2868 ? t_bond_d 2.00 HARMONIC 'X-RAY DIFFRACTION' ? 1.00 ? 3897 ? t_angle_deg 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 995 ? t_dihedral_angle_d 2.00 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? ? ? t_incorr_chiral_ct ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? 71 ? t_trig_c_planes 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 407 ? t_gen_planes 5.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 2868 ? t_it 20.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ? 'X-RAY DIFFRACTION' ? 3.00 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 19.15 ? ? ? t_other_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 373 ? t_chiral_improper_torsion 5.00 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 3356 ? t_ideal_dist_contact 4.00 SEMIHARMONIC # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.00 _refine_ls_shell.d_res_low 2.08 _refine_ls_shell.number_reflns_all 2850 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 174 _refine_ls_shell.number_reflns_R_work 2676 _refine_ls_shell.percent_reflns_obs 96.99 _refine_ls_shell.percent_reflns_R_free 6.11 _refine_ls_shell.R_factor_all 0.2260 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2825 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2222 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 13 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5NHV _struct.title 'Human Erk2 with an Erk1/2 inhibitor' _struct.pdbx_descriptor 'Mitogen-activated protein kinase 1 (E.C.2.7.11.24)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5NHV _struct_keywords.text 'Erk2, kinase, inhibitor, oncology, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 80 ? PHE A 97 ? HIS A 61 PHE A 78 1 ? 18 HELX_P HELX_P2 AA2 LEU A 131 ? GLN A 138 ? LEU A 112 GLN A 119 1 ? 8 HELX_P HELX_P3 AA3 SER A 141 ? ALA A 162 ? SER A 122 ALA A 143 1 ? 22 HELX_P HELX_P4 AA4 LYS A 170 ? SER A 172 ? LYS A 151 SER A 153 5 ? 3 HELX_P HELX_P5 AA5 ASP A 194 ? ASP A 198 ? ASP A 175 ASP A 179 5 ? 5 HELX_P HELX_P6 AA6 THR A 209 ? ARG A 213 ? THR A 190 ARG A 194 5 ? 5 HELX_P HELX_P7 AA7 ALA A 214 ? ASN A 220 ? ALA A 195 ASN A 201 1 ? 7 HELX_P HELX_P8 AA8 LYS A 226 ? ASN A 243 ? LYS A 207 ASN A 224 1 ? 18 HELX_P HELX_P9 AA9 HIS A 251 ? GLY A 264 ? HIS A 232 GLY A 245 1 ? 14 HELX_P HELX_P10 AB1 SER A 267 ? ASN A 272 ? SER A 248 ASN A 253 1 ? 6 HELX_P HELX_P11 AB2 ASN A 276 ? LEU A 286 ? ASN A 257 LEU A 267 1 ? 11 HELX_P HELX_P12 AB3 PRO A 293 ? PHE A 298 ? PRO A 274 PHE A 279 1 ? 6 HELX_P HELX_P13 AB4 ASP A 302 ? LEU A 313 ? ASP A 283 LEU A 294 1 ? 12 HELX_P HELX_P14 AB5 GLU A 322 ? ALA A 328 ? GLU A 303 ALA A 309 1 ? 7 HELX_P HELX_P15 AB6 HIS A 329 ? GLU A 333 ? HIS A 310 GLU A 314 5 ? 5 HELX_P HELX_P16 AB7 ASP A 337 ? GLU A 341 ? ASP A 318 GLU A 322 5 ? 5 HELX_P HELX_P17 AB8 GLU A 360 ? THR A 370 ? GLU A 341 THR A 351 1 ? 11 HELX_P HELX_P18 AB9 ALA A 371 ? GLN A 374 ? ALA A 352 GLN A 355 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 41 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id 22 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 42 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 23 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 1.90 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 3 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 44 ? GLY A 53 ? TYR A 25 GLY A 34 AA1 2 GLY A 56 ? ASP A 63 ? GLY A 37 ASP A 44 AA1 3 VAL A 68 ? ILE A 75 ? VAL A 49 ILE A 56 AA1 4 VAL A 120 ? ASP A 125 ? VAL A 101 ASP A 106 AA1 5 ASP A 107 ? ILE A 109 ? ASP A 88 ILE A 90 AA2 1 THR A 129 ? ASP A 130 ? THR A 110 ASP A 111 AA2 2 LEU A 174 ? LEU A 176 ? LEU A 155 LEU A 157 AA2 3 LEU A 182 ? ILE A 184 ? LEU A 163 ILE A 165 AA3 1 VAL A 164 ? LEU A 165 ? VAL A 145 LEU A 146 AA3 2 ARG A 191 ? VAL A 192 ? ARG A 172 VAL A 173 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N SER A 48 ? N SER A 29 O SER A 60 ? O SER A 41 AA1 2 3 N MET A 57 ? N MET A 38 O LYS A 74 ? O LYS A 55 AA1 3 4 N ILE A 75 ? N ILE A 56 O VAL A 120 ? O VAL A 101 AA1 4 5 O VAL A 123 ? O VAL A 104 N ASP A 107 ? N ASP A 88 AA2 1 2 N THR A 129 ? N THR A 110 O LEU A 176 ? O LEU A 157 AA2 2 3 N LEU A 175 ? N LEU A 156 O LYS A 183 ? O LYS A 164 AA3 1 2 N LEU A 165 ? N LEU A 146 O ARG A 191 ? O ARG A 172 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 401 ? 4 'binding site for residue SO4 A 401' AC2 Software A 8QB 402 ? 11 'binding site for residue 8QB A 402' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 ARG A 210 ? ARG A 191 . ? 1_555 ? 2 AC1 4 ARG A 213 ? ARG A 194 . ? 1_555 ? 3 AC1 4 TYR A 252 ? TYR A 233 . ? 1_555 ? 4 AC1 4 HOH D . ? HOH A 539 . ? 1_555 ? 5 AC2 11 TYR A 55 ? TYR A 36 . ? 1_555 ? 6 AC2 11 ALA A 71 ? ALA A 52 . ? 1_555 ? 7 AC2 11 LYS A 73 ? LYS A 54 . ? 1_555 ? 8 AC2 11 ASP A 125 ? ASP A 106 . ? 1_555 ? 9 AC2 11 MET A 127 ? MET A 108 . ? 1_555 ? 10 AC2 11 THR A 129 ? THR A 110 . ? 1_555 ? 11 AC2 11 ASP A 130 ? ASP A 111 . ? 1_555 ? 12 AC2 11 LYS A 133 ? LYS A 114 . ? 1_555 ? 13 AC2 11 LEU A 175 ? LEU A 156 . ? 1_555 ? 14 AC2 11 ASP A 186 ? ASP A 167 . ? 1_555 ? 15 AC2 11 HOH D . ? HOH A 606 . ? 1_555 ? # _atom_sites.entry_id 5NHV _atom_sites.fract_transf_matrix[1][1] 0.020457 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.007620 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014165 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017497 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -18 ? ? ? A . n A 1 2 HIS 2 -17 ? ? ? A . n A 1 3 HIS 3 -16 ? ? ? A . n A 1 4 HIS 4 -15 ? ? ? A . n A 1 5 HIS 5 -14 ? ? ? A . n A 1 6 HIS 6 -13 ? ? ? A . n A 1 7 HIS 7 -12 ? ? ? A . n A 1 8 GLY 8 -11 ? ? ? A . n A 1 9 GLY 9 -10 ? ? ? A . n A 1 10 GLY 10 -9 ? ? ? A . n A 1 11 GLU 11 -8 ? ? ? A . n A 1 12 ASN 12 -7 ? ? ? A . n A 1 13 LEU 13 -6 ? ? ? A . n A 1 14 TYR 14 -5 ? ? ? A . n A 1 15 PHE 15 -4 ? ? ? A . n A 1 16 GLN 16 -3 ? ? ? A . n A 1 17 GLY 17 -2 ? ? ? A . n A 1 18 SER 18 -1 ? ? ? A . n A 1 19 HIS 19 0 ? ? ? A . n A 1 20 MET 20 1 ? ? ? A . n A 1 21 ALA 21 2 ? ? ? A . n A 1 22 ALA 22 3 ? ? ? A . n A 1 23 ALA 23 4 ? ? ? A . n A 1 24 ALA 24 5 ? ? ? A . n A 1 25 ALA 25 6 ? ? ? A . n A 1 26 ALA 26 7 ? ? ? A . n A 1 27 GLY 27 8 ? ? ? A . n A 1 28 ALA 28 9 ? ? ? A . n A 1 29 GLY 29 10 ? ? ? A . n A 1 30 PRO 30 11 11 PRO PRO A . n A 1 31 GLU 31 12 12 GLU GLU A . n A 1 32 MET 32 13 13 MET MET A . n A 1 33 VAL 33 14 14 VAL VAL A . n A 1 34 ARG 34 15 15 ARG ARG A . n A 1 35 GLY 35 16 16 GLY GLY A . n A 1 36 GLN 36 17 17 GLN GLN A . n A 1 37 VAL 37 18 18 VAL VAL A . n A 1 38 PHE 38 19 19 PHE PHE A . n A 1 39 ASP 39 20 20 ASP ASP A . n A 1 40 VAL 40 21 21 VAL VAL A . n A 1 41 GLY 41 22 22 GLY GLY A . n A 1 42 PRO 42 23 23 PRO PRO A . n A 1 43 ARG 43 24 24 ARG ARG A . n A 1 44 TYR 44 25 25 TYR TYR A . n A 1 45 THR 45 26 26 THR THR A . n A 1 46 ASN 46 27 27 ASN ASN A . n A 1 47 LEU 47 28 28 LEU LEU A . n A 1 48 SER 48 29 29 SER SER A . n A 1 49 TYR 49 30 30 TYR TYR A . n A 1 50 ILE 50 31 31 ILE ILE A . n A 1 51 GLY 51 32 32 GLY GLY A . n A 1 52 GLU 52 33 33 GLU GLU A . n A 1 53 GLY 53 34 34 GLY GLY A . n A 1 54 ALA 54 35 35 ALA ALA A . n A 1 55 TYR 55 36 36 TYR TYR A . n A 1 56 GLY 56 37 37 GLY GLY A . n A 1 57 MET 57 38 38 MET MET A . n A 1 58 VAL 58 39 39 VAL VAL A . n A 1 59 CYS 59 40 40 CYS CYS A . n A 1 60 SER 60 41 41 SER SER A . n A 1 61 ALA 61 42 42 ALA ALA A . n A 1 62 TYR 62 43 43 TYR TYR A . n A 1 63 ASP 63 44 44 ASP ASP A . n A 1 64 ASN 64 45 45 ASN ASN A . n A 1 65 LEU 65 46 46 LEU LEU A . n A 1 66 ASN 66 47 47 ASN ASN A . n A 1 67 LYS 67 48 48 LYS LYS A . n A 1 68 VAL 68 49 49 VAL VAL A . n A 1 69 ARG 69 50 50 ARG ARG A . n A 1 70 VAL 70 51 51 VAL VAL A . n A 1 71 ALA 71 52 52 ALA ALA A . n A 1 72 ILE 72 53 53 ILE ILE A . n A 1 73 LYS 73 54 54 LYS LYS A . n A 1 74 LYS 74 55 55 LYS LYS A . n A 1 75 ILE 75 56 56 ILE ILE A . n A 1 76 SER 76 57 57 SER SER A . n A 1 77 PRO 77 58 58 PRO PRO A . n A 1 78 PHE 78 59 59 PHE PHE A . n A 1 79 GLU 79 60 60 GLU GLU A . n A 1 80 HIS 80 61 61 HIS HIS A . n A 1 81 GLN 81 62 62 GLN GLN A . n A 1 82 THR 82 63 63 THR THR A . n A 1 83 TYR 83 64 64 TYR TYR A . n A 1 84 CYS 84 65 65 CYS CYS A . n A 1 85 GLN 85 66 66 GLN GLN A . n A 1 86 ARG 86 67 67 ARG ARG A . n A 1 87 THR 87 68 68 THR THR A . n A 1 88 LEU 88 69 69 LEU LEU A . n A 1 89 ARG 89 70 70 ARG ARG A . n A 1 90 GLU 90 71 71 GLU GLU A . n A 1 91 ILE 91 72 72 ILE ILE A . n A 1 92 LYS 92 73 73 LYS LYS A . n A 1 93 ILE 93 74 74 ILE ILE A . n A 1 94 LEU 94 75 75 LEU LEU A . n A 1 95 LEU 95 76 76 LEU LEU A . n A 1 96 ARG 96 77 77 ARG ARG A . n A 1 97 PHE 97 78 78 PHE PHE A . n A 1 98 ARG 98 79 79 ARG ARG A . n A 1 99 HIS 99 80 80 HIS HIS A . n A 1 100 GLU 100 81 81 GLU GLU A . n A 1 101 ASN 101 82 82 ASN ASN A . n A 1 102 ILE 102 83 83 ILE ILE A . n A 1 103 ILE 103 84 84 ILE ILE A . n A 1 104 GLY 104 85 85 GLY GLY A . n A 1 105 ILE 105 86 86 ILE ILE A . n A 1 106 ASN 106 87 87 ASN ASN A . n A 1 107 ASP 107 88 88 ASP ASP A . n A 1 108 ILE 108 89 89 ILE ILE A . n A 1 109 ILE 109 90 90 ILE ILE A . n A 1 110 ARG 110 91 91 ARG ARG A . n A 1 111 ALA 111 92 92 ALA ALA A . n A 1 112 PRO 112 93 93 PRO PRO A . n A 1 113 THR 113 94 94 THR THR A . n A 1 114 ILE 114 95 95 ILE ILE A . n A 1 115 GLU 115 96 96 GLU GLU A . n A 1 116 GLN 116 97 97 GLN GLN A . n A 1 117 MET 117 98 98 MET MET A . n A 1 118 LYS 118 99 99 LYS LYS A . n A 1 119 ASP 119 100 100 ASP ASP A . n A 1 120 VAL 120 101 101 VAL VAL A . n A 1 121 TYR 121 102 102 TYR TYR A . n A 1 122 ILE 122 103 103 ILE ILE A . n A 1 123 VAL 123 104 104 VAL VAL A . n A 1 124 GLN 124 105 105 GLN GLN A . n A 1 125 ASP 125 106 106 ASP ASP A . n A 1 126 LEU 126 107 107 LEU LEU A . n A 1 127 MET 127 108 108 MET MET A . n A 1 128 GLU 128 109 109 GLU GLU A . n A 1 129 THR 129 110 110 THR THR A . n A 1 130 ASP 130 111 111 ASP ASP A . n A 1 131 LEU 131 112 112 LEU LEU A . n A 1 132 TYR 132 113 113 TYR TYR A . n A 1 133 LYS 133 114 114 LYS LYS A . n A 1 134 LEU 134 115 115 LEU LEU A . n A 1 135 LEU 135 116 116 LEU LEU A . n A 1 136 LYS 136 117 117 LYS LYS A . n A 1 137 THR 137 118 118 THR THR A . n A 1 138 GLN 138 119 119 GLN GLN A . n A 1 139 HIS 139 120 120 HIS HIS A . n A 1 140 LEU 140 121 121 LEU LEU A . n A 1 141 SER 141 122 122 SER SER A . n A 1 142 ASN 142 123 123 ASN ASN A . n A 1 143 ASP 143 124 124 ASP ASP A . n A 1 144 HIS 144 125 125 HIS HIS A . n A 1 145 ILE 145 126 126 ILE ILE A . n A 1 146 CYS 146 127 127 CYS CYS A . n A 1 147 TYR 147 128 128 TYR TYR A . n A 1 148 PHE 148 129 129 PHE PHE A . n A 1 149 LEU 149 130 130 LEU LEU A . n A 1 150 TYR 150 131 131 TYR TYR A . n A 1 151 GLN 151 132 132 GLN GLN A . n A 1 152 ILE 152 133 133 ILE ILE A . n A 1 153 LEU 153 134 134 LEU LEU A . n A 1 154 ARG 154 135 135 ARG ARG A . n A 1 155 GLY 155 136 136 GLY GLY A . n A 1 156 LEU 156 137 137 LEU LEU A . n A 1 157 LYS 157 138 138 LYS LYS A . n A 1 158 TYR 158 139 139 TYR TYR A . n A 1 159 ILE 159 140 140 ILE ILE A . n A 1 160 HIS 160 141 141 HIS HIS A . n A 1 161 SER 161 142 142 SER SER A . n A 1 162 ALA 162 143 143 ALA ALA A . n A 1 163 ASN 163 144 144 ASN ASN A . n A 1 164 VAL 164 145 145 VAL VAL A . n A 1 165 LEU 165 146 146 LEU LEU A . n A 1 166 HIS 166 147 147 HIS HIS A . n A 1 167 ARG 167 148 148 ARG ARG A . n A 1 168 ASP 168 149 149 ASP ASP A . n A 1 169 LEU 169 150 150 LEU LEU A . n A 1 170 LYS 170 151 151 LYS LYS A . n A 1 171 PRO 171 152 152 PRO PRO A . n A 1 172 SER 172 153 153 SER SER A . n A 1 173 ASN 173 154 154 ASN ASN A . n A 1 174 LEU 174 155 155 LEU LEU A . n A 1 175 LEU 175 156 156 LEU LEU A . n A 1 176 LEU 176 157 157 LEU LEU A . n A 1 177 ASN 177 158 158 ASN ASN A . n A 1 178 THR 178 159 159 THR THR A . n A 1 179 THR 179 160 160 THR THR A . n A 1 180 CYS 180 161 161 CYS CYS A . n A 1 181 ASP 181 162 162 ASP ASP A . n A 1 182 LEU 182 163 163 LEU LEU A . n A 1 183 LYS 183 164 164 LYS LYS A . n A 1 184 ILE 184 165 165 ILE ILE A . n A 1 185 CYS 185 166 166 CYS CYS A . n A 1 186 ASP 186 167 167 ASP ASP A . n A 1 187 PHE 187 168 168 PHE PHE A . n A 1 188 GLY 188 169 169 GLY GLY A . n A 1 189 LEU 189 170 170 LEU LEU A . n A 1 190 ALA 190 171 171 ALA ALA A . n A 1 191 ARG 191 172 172 ARG ARG A . n A 1 192 VAL 192 173 173 VAL VAL A . n A 1 193 ALA 193 174 174 ALA ALA A . n A 1 194 ASP 194 175 175 ASP ASP A . n A 1 195 PRO 195 176 176 PRO PRO A . n A 1 196 ASP 196 177 177 ASP ASP A . n A 1 197 HIS 197 178 178 HIS HIS A . n A 1 198 ASP 198 179 179 ASP ASP A . n A 1 199 HIS 199 180 180 HIS HIS A . n A 1 200 THR 200 181 181 THR THR A . n A 1 201 GLY 201 182 182 GLY GLY A . n A 1 202 PHE 202 183 183 PHE PHE A . n A 1 203 LEU 203 184 184 LEU LEU A . n A 1 204 THR 204 185 185 THR THR A . n A 1 205 GLU 205 186 186 GLU GLU A . n A 1 206 TYR 206 187 187 TYR TYR A . n A 1 207 VAL 207 188 188 VAL VAL A . n A 1 208 ALA 208 189 189 ALA ALA A . n A 1 209 THR 209 190 190 THR THR A . n A 1 210 ARG 210 191 191 ARG ARG A . n A 1 211 TRP 211 192 192 TRP TRP A . n A 1 212 TYR 212 193 193 TYR TYR A . n A 1 213 ARG 213 194 194 ARG ARG A . n A 1 214 ALA 214 195 195 ALA ALA A . n A 1 215 PRO 215 196 196 PRO PRO A . n A 1 216 GLU 216 197 197 GLU GLU A . n A 1 217 ILE 217 198 198 ILE ILE A . n A 1 218 MET 218 199 199 MET MET A . n A 1 219 LEU 219 200 200 LEU LEU A . n A 1 220 ASN 220 201 201 ASN ASN A . n A 1 221 SER 221 202 202 SER SER A . n A 1 222 LYS 222 203 203 LYS LYS A . n A 1 223 GLY 223 204 204 GLY GLY A . n A 1 224 TYR 224 205 205 TYR TYR A . n A 1 225 THR 225 206 206 THR THR A . n A 1 226 LYS 226 207 207 LYS LYS A . n A 1 227 SER 227 208 208 SER SER A . n A 1 228 ILE 228 209 209 ILE ILE A . n A 1 229 ASP 229 210 210 ASP ASP A . n A 1 230 ILE 230 211 211 ILE ILE A . n A 1 231 TRP 231 212 212 TRP TRP A . n A 1 232 SER 232 213 213 SER SER A . n A 1 233 VAL 233 214 214 VAL VAL A . n A 1 234 GLY 234 215 215 GLY GLY A . n A 1 235 CYS 235 216 216 CYS CYS A . n A 1 236 ILE 236 217 217 ILE ILE A . n A 1 237 LEU 237 218 218 LEU LEU A . n A 1 238 ALA 238 219 219 ALA ALA A . n A 1 239 GLU 239 220 220 GLU GLU A . n A 1 240 MET 240 221 221 MET MET A . n A 1 241 LEU 241 222 222 LEU LEU A . n A 1 242 SER 242 223 223 SER SER A . n A 1 243 ASN 243 224 224 ASN ASN A . n A 1 244 ARG 244 225 225 ARG ARG A . n A 1 245 PRO 245 226 226 PRO PRO A . n A 1 246 ILE 246 227 227 ILE ILE A . n A 1 247 PHE 247 228 228 PHE PHE A . n A 1 248 PRO 248 229 229 PRO PRO A . n A 1 249 GLY 249 230 230 GLY GLY A . n A 1 250 LYS 250 231 231 LYS LYS A . n A 1 251 HIS 251 232 232 HIS HIS A . n A 1 252 TYR 252 233 233 TYR TYR A . n A 1 253 LEU 253 234 234 LEU LEU A . n A 1 254 ASP 254 235 235 ASP ASP A . n A 1 255 GLN 255 236 236 GLN GLN A . n A 1 256 LEU 256 237 237 LEU LEU A . n A 1 257 ASN 257 238 238 ASN ASN A . n A 1 258 HIS 258 239 239 HIS HIS A . n A 1 259 ILE 259 240 240 ILE ILE A . n A 1 260 LEU 260 241 241 LEU LEU A . n A 1 261 GLY 261 242 242 GLY GLY A . n A 1 262 ILE 262 243 243 ILE ILE A . n A 1 263 LEU 263 244 244 LEU LEU A . n A 1 264 GLY 264 245 245 GLY GLY A . n A 1 265 SER 265 246 246 SER SER A . n A 1 266 PRO 266 247 247 PRO PRO A . n A 1 267 SER 267 248 248 SER SER A . n A 1 268 GLN 268 249 249 GLN GLN A . n A 1 269 GLU 269 250 250 GLU GLU A . n A 1 270 ASP 270 251 251 ASP ASP A . n A 1 271 LEU 271 252 252 LEU LEU A . n A 1 272 ASN 272 253 253 ASN ASN A . n A 1 273 CYS 273 254 254 CYS CYS A . n A 1 274 ILE 274 255 255 ILE ILE A . n A 1 275 ILE 275 256 256 ILE ILE A . n A 1 276 ASN 276 257 257 ASN ASN A . n A 1 277 LEU 277 258 258 LEU LEU A . n A 1 278 LYS 278 259 259 LYS LYS A . n A 1 279 ALA 279 260 260 ALA ALA A . n A 1 280 ARG 280 261 261 ARG ARG A . n A 1 281 ASN 281 262 262 ASN ASN A . n A 1 282 TYR 282 263 263 TYR TYR A . n A 1 283 LEU 283 264 264 LEU LEU A . n A 1 284 LEU 284 265 265 LEU LEU A . n A 1 285 SER 285 266 266 SER SER A . n A 1 286 LEU 286 267 267 LEU LEU A . n A 1 287 PRO 287 268 268 PRO PRO A . n A 1 288 HIS 288 269 269 HIS HIS A . n A 1 289 LYS 289 270 270 LYS LYS A . n A 1 290 ASN 290 271 271 ASN ASN A . n A 1 291 LYS 291 272 272 LYS LYS A . n A 1 292 VAL 292 273 273 VAL VAL A . n A 1 293 PRO 293 274 274 PRO PRO A . n A 1 294 TRP 294 275 275 TRP TRP A . n A 1 295 ASN 295 276 276 ASN ASN A . n A 1 296 ARG 296 277 277 ARG ARG A . n A 1 297 LEU 297 278 278 LEU LEU A . n A 1 298 PHE 298 279 279 PHE PHE A . n A 1 299 PRO 299 280 280 PRO PRO A . n A 1 300 ASN 300 281 281 ASN ASN A . n A 1 301 ALA 301 282 282 ALA ALA A . n A 1 302 ASP 302 283 283 ASP ASP A . n A 1 303 SER 303 284 284 SER SER A . n A 1 304 LYS 304 285 285 LYS LYS A . n A 1 305 ALA 305 286 286 ALA ALA A . n A 1 306 LEU 306 287 287 LEU LEU A . n A 1 307 ASP 307 288 288 ASP ASP A . n A 1 308 LEU 308 289 289 LEU LEU A . n A 1 309 LEU 309 290 290 LEU LEU A . n A 1 310 ASP 310 291 291 ASP ASP A . n A 1 311 LYS 311 292 292 LYS LYS A . n A 1 312 MET 312 293 293 MET MET A . n A 1 313 LEU 313 294 294 LEU LEU A . n A 1 314 THR 314 295 295 THR THR A . n A 1 315 PHE 315 296 296 PHE PHE A . n A 1 316 ASN 316 297 297 ASN ASN A . n A 1 317 PRO 317 298 298 PRO PRO A . n A 1 318 HIS 318 299 299 HIS HIS A . n A 1 319 LYS 319 300 300 LYS LYS A . n A 1 320 ARG 320 301 301 ARG ARG A . n A 1 321 ILE 321 302 302 ILE ILE A . n A 1 322 GLU 322 303 303 GLU GLU A . n A 1 323 VAL 323 304 304 VAL VAL A . n A 1 324 GLU 324 305 305 GLU GLU A . n A 1 325 GLN 325 306 306 GLN GLN A . n A 1 326 ALA 326 307 307 ALA ALA A . n A 1 327 LEU 327 308 308 LEU LEU A . n A 1 328 ALA 328 309 309 ALA ALA A . n A 1 329 HIS 329 310 310 HIS HIS A . n A 1 330 PRO 330 311 311 PRO PRO A . n A 1 331 TYR 331 312 312 TYR TYR A . n A 1 332 LEU 332 313 313 LEU LEU A . n A 1 333 GLU 333 314 314 GLU GLU A . n A 1 334 GLN 334 315 315 GLN GLN A . n A 1 335 TYR 335 316 316 TYR TYR A . n A 1 336 TYR 336 317 317 TYR TYR A . n A 1 337 ASP 337 318 318 ASP ASP A . n A 1 338 PRO 338 319 319 PRO PRO A . n A 1 339 SER 339 320 320 SER SER A . n A 1 340 ASP 340 321 321 ASP ASP A . n A 1 341 GLU 341 322 322 GLU GLU A . n A 1 342 PRO 342 323 323 PRO PRO A . n A 1 343 ILE 343 324 324 ILE ILE A . n A 1 344 ALA 344 325 325 ALA ALA A . n A 1 345 GLU 345 326 326 GLU GLU A . n A 1 346 ALA 346 327 327 ALA ALA A . n A 1 347 PRO 347 328 328 PRO PRO A . n A 1 348 PHE 348 329 329 PHE PHE A . n A 1 349 LYS 349 330 330 LYS LYS A . n A 1 350 PHE 350 331 331 PHE PHE A . n A 1 351 ASP 351 332 332 ASP ASP A . n A 1 352 MET 352 333 333 MET MET A . n A 1 353 GLU 353 334 334 GLU GLU A . n A 1 354 LEU 354 335 335 LEU LEU A . n A 1 355 ASP 355 336 336 ASP ASP A . n A 1 356 ASP 356 337 337 ASP ASP A . n A 1 357 LEU 357 338 338 LEU LEU A . n A 1 358 PRO 358 339 339 PRO PRO A . n A 1 359 LYS 359 340 340 LYS LYS A . n A 1 360 GLU 360 341 341 GLU GLU A . n A 1 361 LYS 361 342 342 LYS LYS A . n A 1 362 LEU 362 343 343 LEU LEU A . n A 1 363 LYS 363 344 344 LYS LYS A . n A 1 364 GLU 364 345 345 GLU GLU A . n A 1 365 LEU 365 346 346 LEU LEU A . n A 1 366 ILE 366 347 347 ILE ILE A . n A 1 367 PHE 367 348 348 PHE PHE A . n A 1 368 GLU 368 349 349 GLU GLU A . n A 1 369 GLU 369 350 350 GLU GLU A . n A 1 370 THR 370 351 351 THR THR A . n A 1 371 ALA 371 352 352 ALA ALA A . n A 1 372 ARG 372 353 353 ARG ARG A . n A 1 373 PHE 373 354 354 PHE PHE A . n A 1 374 GLN 374 355 355 GLN GLN A . n A 1 375 PRO 375 356 ? ? ? A . n A 1 376 GLY 376 357 ? ? ? A . n A 1 377 TYR 377 358 ? ? ? A . n A 1 378 ARG 378 359 ? ? ? A . n A 1 379 SER 379 360 ? ? ? A . n A 1 380 LEU 380 361 ? ? ? A . n A 1 381 GLU 381 362 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 401 1 SO4 SO4 A . C 3 8QB 1 402 1 8QB INH A . D 4 HOH 1 501 2 HOH HOH A . D 4 HOH 2 502 115 HOH HOH A . D 4 HOH 3 503 177 HOH HOH A . D 4 HOH 4 504 176 HOH HOH A . D 4 HOH 5 505 175 HOH HOH A . D 4 HOH 6 506 171 HOH HOH A . D 4 HOH 7 507 14 HOH HOH A . D 4 HOH 8 508 149 HOH HOH A . D 4 HOH 9 509 5 HOH HOH A . D 4 HOH 10 510 32 HOH HOH A . D 4 HOH 11 511 59 HOH HOH A . D 4 HOH 12 512 54 HOH HOH A . D 4 HOH 13 513 26 HOH HOH A . D 4 HOH 14 514 19 HOH HOH A . D 4 HOH 15 515 132 HOH HOH A . D 4 HOH 16 516 9 HOH HOH A . D 4 HOH 17 517 31 HOH HOH A . D 4 HOH 18 518 68 HOH HOH A . D 4 HOH 19 519 125 HOH HOH A . D 4 HOH 20 520 116 HOH HOH A . D 4 HOH 21 521 78 HOH HOH A . D 4 HOH 22 522 33 HOH HOH A . D 4 HOH 23 523 15 HOH HOH A . D 4 HOH 24 524 41 HOH HOH A . D 4 HOH 25 525 172 HOH HOH A . D 4 HOH 26 526 3 HOH HOH A . D 4 HOH 27 527 118 HOH HOH A . D 4 HOH 28 528 95 HOH HOH A . D 4 HOH 29 529 81 HOH HOH A . D 4 HOH 30 530 56 HOH HOH A . D 4 HOH 31 531 117 HOH HOH A . D 4 HOH 32 532 24 HOH HOH A . D 4 HOH 33 533 57 HOH HOH A . D 4 HOH 34 534 111 HOH HOH A . D 4 HOH 35 535 29 HOH HOH A . D 4 HOH 36 536 11 HOH HOH A . D 4 HOH 37 537 136 HOH HOH A . D 4 HOH 38 538 127 HOH HOH A . D 4 HOH 39 539 88 HOH HOH A . D 4 HOH 40 540 7 HOH HOH A . D 4 HOH 41 541 53 HOH HOH A . D 4 HOH 42 542 40 HOH HOH A . D 4 HOH 43 543 46 HOH HOH A . D 4 HOH 44 544 92 HOH HOH A . D 4 HOH 45 545 13 HOH HOH A . D 4 HOH 46 546 67 HOH HOH A . D 4 HOH 47 547 34 HOH HOH A . D 4 HOH 48 548 87 HOH HOH A . D 4 HOH 49 549 155 HOH HOH A . D 4 HOH 50 550 17 HOH HOH A . D 4 HOH 51 551 153 HOH HOH A . D 4 HOH 52 552 80 HOH HOH A . D 4 HOH 53 553 107 HOH HOH A . D 4 HOH 54 554 48 HOH HOH A . D 4 HOH 55 555 6 HOH HOH A . D 4 HOH 56 556 100 HOH HOH A . D 4 HOH 57 557 8 HOH HOH A . D 4 HOH 58 558 64 HOH HOH A . D 4 HOH 59 559 12 HOH HOH A . D 4 HOH 60 560 20 HOH HOH A . D 4 HOH 61 561 1 HOH HOH A . D 4 HOH 62 562 38 HOH HOH A . D 4 HOH 63 563 55 HOH HOH A . D 4 HOH 64 564 72 HOH HOH A . D 4 HOH 65 565 157 HOH HOH A . D 4 HOH 66 566 16 HOH HOH A . D 4 HOH 67 567 49 HOH HOH A . D 4 HOH 68 568 75 HOH HOH A . D 4 HOH 69 569 101 HOH HOH A . D 4 HOH 70 570 178 HOH HOH A . D 4 HOH 71 571 91 HOH HOH A . D 4 HOH 72 572 122 HOH HOH A . D 4 HOH 73 573 169 HOH HOH A . D 4 HOH 74 574 145 HOH HOH A . D 4 HOH 75 575 36 HOH HOH A . D 4 HOH 76 576 133 HOH HOH A . D 4 HOH 77 577 52 HOH HOH A . D 4 HOH 78 578 143 HOH HOH A . D 4 HOH 79 579 164 HOH HOH A . D 4 HOH 80 580 4 HOH HOH A . D 4 HOH 81 581 161 HOH HOH A . D 4 HOH 82 582 110 HOH HOH A . D 4 HOH 83 583 168 HOH HOH A . D 4 HOH 84 584 65 HOH HOH A . D 4 HOH 85 585 76 HOH HOH A . D 4 HOH 86 586 154 HOH HOH A . D 4 HOH 87 587 94 HOH HOH A . D 4 HOH 88 588 103 HOH HOH A . D 4 HOH 89 589 60 HOH HOH A . D 4 HOH 90 590 27 HOH HOH A . D 4 HOH 91 591 163 HOH HOH A . D 4 HOH 92 592 21 HOH HOH A . D 4 HOH 93 593 108 HOH HOH A . D 4 HOH 94 594 10 HOH HOH A . D 4 HOH 95 595 23 HOH HOH A . D 4 HOH 96 596 112 HOH HOH A . D 4 HOH 97 597 135 HOH HOH A . D 4 HOH 98 598 121 HOH HOH A . D 4 HOH 99 599 25 HOH HOH A . D 4 HOH 100 600 98 HOH HOH A . D 4 HOH 101 601 62 HOH HOH A . D 4 HOH 102 602 113 HOH HOH A . D 4 HOH 103 603 37 HOH HOH A . D 4 HOH 104 604 74 HOH HOH A . D 4 HOH 105 605 28 HOH HOH A . D 4 HOH 106 606 22 HOH HOH A . D 4 HOH 107 607 97 HOH HOH A . D 4 HOH 108 608 124 HOH HOH A . D 4 HOH 109 609 158 HOH HOH A . D 4 HOH 110 610 47 HOH HOH A . D 4 HOH 111 611 159 HOH HOH A . D 4 HOH 112 612 70 HOH HOH A . D 4 HOH 113 613 39 HOH HOH A . D 4 HOH 114 614 44 HOH HOH A . D 4 HOH 115 615 89 HOH HOH A . D 4 HOH 116 616 43 HOH HOH A . D 4 HOH 117 617 130 HOH HOH A . D 4 HOH 118 618 18 HOH HOH A . D 4 HOH 119 619 170 HOH HOH A . D 4 HOH 120 620 137 HOH HOH A . D 4 HOH 121 621 151 HOH HOH A . D 4 HOH 122 622 50 HOH HOH A . D 4 HOH 123 623 166 HOH HOH A . D 4 HOH 124 624 114 HOH HOH A . D 4 HOH 125 625 79 HOH HOH A . D 4 HOH 126 626 156 HOH HOH A . D 4 HOH 127 627 71 HOH HOH A . D 4 HOH 128 628 109 HOH HOH A . D 4 HOH 129 629 147 HOH HOH A . D 4 HOH 130 630 131 HOH HOH A . D 4 HOH 131 631 93 HOH HOH A . D 4 HOH 132 632 126 HOH HOH A . D 4 HOH 133 633 173 HOH HOH A . D 4 HOH 134 634 85 HOH HOH A . D 4 HOH 135 635 102 HOH HOH A . D 4 HOH 136 636 45 HOH HOH A . D 4 HOH 137 637 142 HOH HOH A . D 4 HOH 138 638 134 HOH HOH A . D 4 HOH 139 639 61 HOH HOH A . D 4 HOH 140 640 66 HOH HOH A . D 4 HOH 141 641 106 HOH HOH A . D 4 HOH 142 642 162 HOH HOH A . D 4 HOH 143 643 82 HOH HOH A . D 4 HOH 144 644 167 HOH HOH A . D 4 HOH 145 645 150 HOH HOH A . D 4 HOH 146 646 42 HOH HOH A . D 4 HOH 147 647 123 HOH HOH A . D 4 HOH 148 648 129 HOH HOH A . D 4 HOH 149 649 83 HOH HOH A . D 4 HOH 150 650 73 HOH HOH A . D 4 HOH 151 651 119 HOH HOH A . D 4 HOH 152 652 139 HOH HOH A . D 4 HOH 153 653 35 HOH HOH A . D 4 HOH 154 654 104 HOH HOH A . D 4 HOH 155 655 174 HOH HOH A . D 4 HOH 156 656 144 HOH HOH A . D 4 HOH 157 657 90 HOH HOH A . D 4 HOH 158 658 86 HOH HOH A . D 4 HOH 159 659 120 HOH HOH A . D 4 HOH 160 660 152 HOH HOH A . D 4 HOH 161 661 30 HOH HOH A . D 4 HOH 162 662 84 HOH HOH A . D 4 HOH 163 663 51 HOH HOH A . D 4 HOH 164 664 138 HOH HOH A . D 4 HOH 165 665 99 HOH HOH A . D 4 HOH 166 666 63 HOH HOH A . D 4 HOH 167 667 128 HOH HOH A . D 4 HOH 168 668 105 HOH HOH A . D 4 HOH 169 669 165 HOH HOH A . D 4 HOH 170 670 146 HOH HOH A . D 4 HOH 171 671 141 HOH HOH A . D 4 HOH 172 672 96 HOH HOH A . D 4 HOH 173 673 160 HOH HOH A . D 4 HOH 174 674 148 HOH HOH A . D 4 HOH 175 675 77 HOH HOH A . D 4 HOH 176 676 140 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 180 ? 1 MORE -12 ? 1 'SSA (A^2)' 15910 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-04-19 2 'Structure model' 1 1 2017-05-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -5.5209 _pdbx_refine_tls.origin_y 8.5364 _pdbx_refine_tls.origin_z 47.2975 _pdbx_refine_tls.T[1][1] -0.0320 _pdbx_refine_tls.T[2][2] -0.0849 _pdbx_refine_tls.T[3][3] -0.0391 _pdbx_refine_tls.T[1][2] -0.0066 _pdbx_refine_tls.T[1][3] 0.0088 _pdbx_refine_tls.T[2][3] 0.0147 _pdbx_refine_tls.L[1][1] 0.6905 _pdbx_refine_tls.L[2][2] 0.4410 _pdbx_refine_tls.L[3][3] 0.9113 _pdbx_refine_tls.L[1][2] 0.2852 _pdbx_refine_tls.L[1][3] 0.3075 _pdbx_refine_tls.L[2][3] 0.3085 _pdbx_refine_tls.S[1][1] -0.0438 _pdbx_refine_tls.S[1][2] 0.1008 _pdbx_refine_tls.S[1][3] 0.0547 _pdbx_refine_tls.S[2][1] -0.0555 _pdbx_refine_tls.S[2][2] 0.0355 _pdbx_refine_tls.S[2][3] -0.0006 _pdbx_refine_tls.S[3][1] -0.0674 _pdbx_refine_tls.S[3][2] 0.0533 _pdbx_refine_tls.S[3][3] 0.0083 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details '{ A|* }' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.11.6 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE1 A GLU 109 ? ? CG2 A THR 159 ? ? 1.90 2 1 NE2 A GLN 66 ? ? O A LEU 335 ? ? 2.16 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OD1 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 ASP _pdbx_validate_symm_contact.auth_seq_id_1 20 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 ND2 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 ASN _pdbx_validate_symm_contact.auth_seq_id_2 271 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 1_454 _pdbx_validate_symm_contact.dist 2.16 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 15 ? ? 38.15 90.17 2 1 GLN A 17 ? ? 179.81 142.47 3 1 ILE A 31 ? ? -111.46 -73.33 4 1 ASP A 149 ? ? -142.75 39.15 5 1 ASP A 167 ? ? 58.53 89.42 6 1 GLU A 186 ? ? -37.75 137.55 7 1 ASN A 201 ? ? -162.43 14.41 8 1 LEU A 294 ? ? -100.53 51.06 9 1 LYS A 340 ? ? -56.66 -7.33 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 676 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.39 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 60 ? CG ? A GLU 79 CG 2 1 Y 1 A GLU 60 ? CD ? A GLU 79 CD 3 1 Y 1 A GLU 60 ? OE1 ? A GLU 79 OE1 4 1 Y 1 A GLU 60 ? OE2 ? A GLU 79 OE2 5 1 Y 1 A ARG 79 ? CD ? A ARG 98 CD 6 1 Y 1 A ARG 79 ? NE ? A ARG 98 NE 7 1 Y 1 A ARG 79 ? CZ ? A ARG 98 CZ 8 1 Y 1 A ARG 79 ? NH1 ? A ARG 98 NH1 9 1 Y 1 A ARG 79 ? NH2 ? A ARG 98 NH2 10 1 Y 1 A LYS 99 ? CG ? A LYS 118 CG 11 1 Y 1 A LYS 99 ? CD ? A LYS 118 CD 12 1 Y 1 A LYS 99 ? CE ? A LYS 118 CE 13 1 Y 1 A LYS 99 ? NZ ? A LYS 118 NZ 14 1 Y 1 A LYS 114 ? CE ? A LYS 133 CE 15 1 Y 1 A LYS 114 ? NZ ? A LYS 133 NZ 16 1 Y 1 A GLU 186 ? CG ? A GLU 205 CG 17 1 Y 1 A GLU 186 ? CD ? A GLU 205 CD 18 1 Y 1 A GLU 186 ? OE1 ? A GLU 205 OE1 19 1 Y 1 A GLU 186 ? OE2 ? A GLU 205 OE2 20 1 Y 1 A GLU 250 ? CG ? A GLU 269 CG 21 1 Y 1 A GLU 250 ? CD ? A GLU 269 CD 22 1 Y 1 A GLU 250 ? OE1 ? A GLU 269 OE1 23 1 Y 1 A GLU 250 ? OE2 ? A GLU 269 OE2 24 1 Y 1 A ARG 277 ? CG ? A ARG 296 CG 25 1 Y 1 A ARG 277 ? CD ? A ARG 296 CD 26 1 Y 1 A ARG 277 ? NE ? A ARG 296 NE 27 1 Y 1 A ARG 277 ? CZ ? A ARG 296 CZ 28 1 Y 1 A ARG 277 ? NH1 ? A ARG 296 NH1 29 1 Y 1 A ARG 277 ? NH2 ? A ARG 296 NH2 30 1 Y 1 A LYS 330 ? CG ? A LYS 349 CG 31 1 Y 1 A LYS 330 ? CD ? A LYS 349 CD 32 1 Y 1 A LYS 330 ? CE ? A LYS 349 CE 33 1 Y 1 A LYS 330 ? NZ ? A LYS 349 NZ 34 1 Y 1 A PHE 331 ? CG ? A PHE 350 CG 35 1 Y 1 A PHE 331 ? CD1 ? A PHE 350 CD1 36 1 Y 1 A PHE 331 ? CD2 ? A PHE 350 CD2 37 1 Y 1 A PHE 331 ? CE1 ? A PHE 350 CE1 38 1 Y 1 A PHE 331 ? CE2 ? A PHE 350 CE2 39 1 Y 1 A PHE 331 ? CZ ? A PHE 350 CZ 40 1 Y 1 A MET 333 ? CG ? A MET 352 CG 41 1 Y 1 A MET 333 ? SD ? A MET 352 SD 42 1 Y 1 A MET 333 ? CE ? A MET 352 CE 43 1 Y 1 A ASP 336 ? CG ? A ASP 355 CG 44 1 Y 1 A ASP 336 ? OD1 ? A ASP 355 OD1 45 1 Y 1 A ASP 336 ? OD2 ? A ASP 355 OD2 46 1 Y 1 A LYS 340 ? CG ? A LYS 359 CG 47 1 Y 1 A LYS 340 ? CD ? A LYS 359 CD 48 1 Y 1 A LYS 340 ? CE ? A LYS 359 CE 49 1 Y 1 A LYS 340 ? NZ ? A LYS 359 NZ 50 1 Y 1 A GLU 349 ? CG ? A GLU 368 CG 51 1 Y 1 A GLU 349 ? CD ? A GLU 368 CD 52 1 Y 1 A GLU 349 ? OE1 ? A GLU 368 OE1 53 1 Y 1 A GLU 349 ? OE2 ? A GLU 368 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -18 ? A MET 1 2 1 Y 1 A HIS -17 ? A HIS 2 3 1 Y 1 A HIS -16 ? A HIS 3 4 1 Y 1 A HIS -15 ? A HIS 4 5 1 Y 1 A HIS -14 ? A HIS 5 6 1 Y 1 A HIS -13 ? A HIS 6 7 1 Y 1 A HIS -12 ? A HIS 7 8 1 Y 1 A GLY -11 ? A GLY 8 9 1 Y 1 A GLY -10 ? A GLY 9 10 1 Y 1 A GLY -9 ? A GLY 10 11 1 Y 1 A GLU -8 ? A GLU 11 12 1 Y 1 A ASN -7 ? A ASN 12 13 1 Y 1 A LEU -6 ? A LEU 13 14 1 Y 1 A TYR -5 ? A TYR 14 15 1 Y 1 A PHE -4 ? A PHE 15 16 1 Y 1 A GLN -3 ? A GLN 16 17 1 Y 1 A GLY -2 ? A GLY 17 18 1 Y 1 A SER -1 ? A SER 18 19 1 Y 1 A HIS 0 ? A HIS 19 20 1 Y 1 A MET 1 ? A MET 20 21 1 Y 1 A ALA 2 ? A ALA 21 22 1 Y 1 A ALA 3 ? A ALA 22 23 1 Y 1 A ALA 4 ? A ALA 23 24 1 Y 1 A ALA 5 ? A ALA 24 25 1 Y 1 A ALA 6 ? A ALA 25 26 1 Y 1 A ALA 7 ? A ALA 26 27 1 Y 1 A GLY 8 ? A GLY 27 28 1 Y 1 A ALA 9 ? A ALA 28 29 1 Y 1 A GLY 10 ? A GLY 29 30 1 Y 1 A PRO 356 ? A PRO 375 31 1 Y 1 A GLY 357 ? A GLY 376 32 1 Y 1 A TYR 358 ? A TYR 377 33 1 Y 1 A ARG 359 ? A ARG 378 34 1 Y 1 A SER 360 ? A SER 379 35 1 Y 1 A LEU 361 ? A LEU 380 36 1 Y 1 A GLU 362 ? A GLU 381 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 '7-[2-(oxan-4-ylamino)pyrimidin-4-yl]-3,4-dihydro-2~{H}-pyrrolo[1,2-a]pyrazin-1-one' 8QB 4 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #