data_5NW8 # _entry.id 5NW8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.329 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5NW8 WWPDB D_1200004825 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5NW8 _pdbx_database_status.recvd_initial_deposition_date 2017-05-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Mueller, J.M.' 1 0000-0002-4133-7238 'Heine, A.' 2 ? 'Klebe, G.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Omega' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2470-1343 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Conceptional Design of Self-Assembling Bisubstrate-like Inhibitors of Protein Kinase A Resulting in a Boronic Acid Glutamate Linkage ; _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acsomega.8b02364 _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mueller, J.M.' 1 ? primary 'Kirschner, R.' 2 ? primary 'Geyer, A.' 3 ? primary 'Klebe, G.' 4 ? # _cell.entry_id 5NW8 _cell.length_a 69.515 _cell.length_b 73.112 _cell.length_c 77.317 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5NW8 _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'cAMP-dependent protein kinase catalytic subunit alpha' 40998.551 1 2.7.11.11 ? ? ? 2 polymer syn 'UPF0418 protein FAM164A' 1903.061 1 ? ? ? 'PKI 5-22 with S14RBS mutation' 3 non-polymer syn '(4S)-2-METHYL-2,4-PENTANEDIOL' 118.174 1 ? ? ? ? 4 non-polymer syn '5-(1,4-DIAZEPAN-1-SULFONYL)ISOQUINOLINE' 291.369 1 ? ? ? ? 5 non-polymer man beta-D-ribopyranose 150.130 1 ? ? ? ? 6 water nat water 18.015 180 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PKA C-alpha' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no yes ;MGNAAAAKKG(SEP)EQESVKEFLAKAKEEFLKKWESPSQNTAQLDHFDRIKTLGTGSFGRVMLVKHKETGNHYAMKILD KQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRF(SEP)EPHARFYAAQIV LTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTW(TPO)LCGTPEYLAPEIILSKGYNKAVDWWALGVL IYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQ RKVEAPFIPKFKGPGDTSNFDDYEEEEIRV(SEP)INEKCGKEFTEF ; ;MGNAAAAKKGSEQESVKEFLAKAKEEFLKKWESPSQNTAQLDHFDRIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKV VKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHS LDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFK GPGDTSNFDDYEEEEIRVSINEKCGKEFTEF ; A ? 2 'polypeptide(L)' no no TTYADFIASGRTGSRNAI TTYADFIASGRTGSRNAI D ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 ASN n 1 4 ALA n 1 5 ALA n 1 6 ALA n 1 7 ALA n 1 8 LYS n 1 9 LYS n 1 10 GLY n 1 11 SEP n 1 12 GLU n 1 13 GLN n 1 14 GLU n 1 15 SER n 1 16 VAL n 1 17 LYS n 1 18 GLU n 1 19 PHE n 1 20 LEU n 1 21 ALA n 1 22 LYS n 1 23 ALA n 1 24 LYS n 1 25 GLU n 1 26 GLU n 1 27 PHE n 1 28 LEU n 1 29 LYS n 1 30 LYS n 1 31 TRP n 1 32 GLU n 1 33 SER n 1 34 PRO n 1 35 SER n 1 36 GLN n 1 37 ASN n 1 38 THR n 1 39 ALA n 1 40 GLN n 1 41 LEU n 1 42 ASP n 1 43 HIS n 1 44 PHE n 1 45 ASP n 1 46 ARG n 1 47 ILE n 1 48 LYS n 1 49 THR n 1 50 LEU n 1 51 GLY n 1 52 THR n 1 53 GLY n 1 54 SER n 1 55 PHE n 1 56 GLY n 1 57 ARG n 1 58 VAL n 1 59 MET n 1 60 LEU n 1 61 VAL n 1 62 LYS n 1 63 HIS n 1 64 LYS n 1 65 GLU n 1 66 THR n 1 67 GLY n 1 68 ASN n 1 69 HIS n 1 70 TYR n 1 71 ALA n 1 72 MET n 1 73 LYS n 1 74 ILE n 1 75 LEU n 1 76 ASP n 1 77 LYS n 1 78 GLN n 1 79 LYS n 1 80 VAL n 1 81 VAL n 1 82 LYS n 1 83 LEU n 1 84 LYS n 1 85 GLN n 1 86 ILE n 1 87 GLU n 1 88 HIS n 1 89 THR n 1 90 LEU n 1 91 ASN n 1 92 GLU n 1 93 LYS n 1 94 ARG n 1 95 ILE n 1 96 LEU n 1 97 GLN n 1 98 ALA n 1 99 VAL n 1 100 ASN n 1 101 PHE n 1 102 PRO n 1 103 PHE n 1 104 LEU n 1 105 VAL n 1 106 LYS n 1 107 LEU n 1 108 GLU n 1 109 PHE n 1 110 SER n 1 111 PHE n 1 112 LYS n 1 113 ASP n 1 114 ASN n 1 115 SER n 1 116 ASN n 1 117 LEU n 1 118 TYR n 1 119 MET n 1 120 VAL n 1 121 MET n 1 122 GLU n 1 123 TYR n 1 124 VAL n 1 125 PRO n 1 126 GLY n 1 127 GLY n 1 128 GLU n 1 129 MET n 1 130 PHE n 1 131 SER n 1 132 HIS n 1 133 LEU n 1 134 ARG n 1 135 ARG n 1 136 ILE n 1 137 GLY n 1 138 ARG n 1 139 PHE n 1 140 SEP n 1 141 GLU n 1 142 PRO n 1 143 HIS n 1 144 ALA n 1 145 ARG n 1 146 PHE n 1 147 TYR n 1 148 ALA n 1 149 ALA n 1 150 GLN n 1 151 ILE n 1 152 VAL n 1 153 LEU n 1 154 THR n 1 155 PHE n 1 156 GLU n 1 157 TYR n 1 158 LEU n 1 159 HIS n 1 160 SER n 1 161 LEU n 1 162 ASP n 1 163 LEU n 1 164 ILE n 1 165 TYR n 1 166 ARG n 1 167 ASP n 1 168 LEU n 1 169 LYS n 1 170 PRO n 1 171 GLU n 1 172 ASN n 1 173 LEU n 1 174 LEU n 1 175 ILE n 1 176 ASP n 1 177 GLN n 1 178 GLN n 1 179 GLY n 1 180 TYR n 1 181 ILE n 1 182 GLN n 1 183 VAL n 1 184 THR n 1 185 ASP n 1 186 PHE n 1 187 GLY n 1 188 PHE n 1 189 ALA n 1 190 LYS n 1 191 ARG n 1 192 VAL n 1 193 LYS n 1 194 GLY n 1 195 ARG n 1 196 THR n 1 197 TRP n 1 198 TPO n 1 199 LEU n 1 200 CYS n 1 201 GLY n 1 202 THR n 1 203 PRO n 1 204 GLU n 1 205 TYR n 1 206 LEU n 1 207 ALA n 1 208 PRO n 1 209 GLU n 1 210 ILE n 1 211 ILE n 1 212 LEU n 1 213 SER n 1 214 LYS n 1 215 GLY n 1 216 TYR n 1 217 ASN n 1 218 LYS n 1 219 ALA n 1 220 VAL n 1 221 ASP n 1 222 TRP n 1 223 TRP n 1 224 ALA n 1 225 LEU n 1 226 GLY n 1 227 VAL n 1 228 LEU n 1 229 ILE n 1 230 TYR n 1 231 GLU n 1 232 MET n 1 233 ALA n 1 234 ALA n 1 235 GLY n 1 236 TYR n 1 237 PRO n 1 238 PRO n 1 239 PHE n 1 240 PHE n 1 241 ALA n 1 242 ASP n 1 243 GLN n 1 244 PRO n 1 245 ILE n 1 246 GLN n 1 247 ILE n 1 248 TYR n 1 249 GLU n 1 250 LYS n 1 251 ILE n 1 252 VAL n 1 253 SER n 1 254 GLY n 1 255 LYS n 1 256 VAL n 1 257 ARG n 1 258 PHE n 1 259 PRO n 1 260 SER n 1 261 HIS n 1 262 PHE n 1 263 SER n 1 264 SER n 1 265 ASP n 1 266 LEU n 1 267 LYS n 1 268 ASP n 1 269 LEU n 1 270 LEU n 1 271 ARG n 1 272 ASN n 1 273 LEU n 1 274 LEU n 1 275 GLN n 1 276 VAL n 1 277 ASP n 1 278 LEU n 1 279 THR n 1 280 LYS n 1 281 ARG n 1 282 PHE n 1 283 GLY n 1 284 ASN n 1 285 LEU n 1 286 LYS n 1 287 ASN n 1 288 GLY n 1 289 VAL n 1 290 ASN n 1 291 ASP n 1 292 ILE n 1 293 LYS n 1 294 ASN n 1 295 HIS n 1 296 LYS n 1 297 TRP n 1 298 PHE n 1 299 ALA n 1 300 THR n 1 301 THR n 1 302 ASP n 1 303 TRP n 1 304 ILE n 1 305 ALA n 1 306 ILE n 1 307 TYR n 1 308 GLN n 1 309 ARG n 1 310 LYS n 1 311 VAL n 1 312 GLU n 1 313 ALA n 1 314 PRO n 1 315 PHE n 1 316 ILE n 1 317 PRO n 1 318 LYS n 1 319 PHE n 1 320 LYS n 1 321 GLY n 1 322 PRO n 1 323 GLY n 1 324 ASP n 1 325 THR n 1 326 SER n 1 327 ASN n 1 328 PHE n 1 329 ASP n 1 330 ASP n 1 331 TYR n 1 332 GLU n 1 333 GLU n 1 334 GLU n 1 335 GLU n 1 336 ILE n 1 337 ARG n 1 338 VAL n 1 339 SEP n 1 340 ILE n 1 341 ASN n 1 342 GLU n 1 343 LYS n 1 344 CYS n 1 345 GLY n 1 346 LYS n 1 347 GLU n 1 348 PHE n 1 349 THR n 1 350 GLU n 1 351 PHE n 2 1 THR n 2 2 THR n 2 3 TYR n 2 4 ALA n 2 5 ASP n 2 6 PHE n 2 7 ILE n 2 8 ALA n 2 9 SER n 2 10 GLY n 2 11 ARG n 2 12 THR n 2 13 GLY n 2 14 SER n 2 15 ARG n 2 16 ASN n 2 17 ALA n 2 18 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 351 _entity_src_gen.gene_src_common_name 'Chinese hamster' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PRKACA _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue Ovary _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Cricetulus griseus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10029 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ Ovary _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 18 _pdbx_entity_src_syn.organism_scientific 'Cricetulus griseus' _pdbx_entity_src_syn.organism_common_name 'Chinese hamster' _pdbx_entity_src_syn.ncbi_taxonomy_id 10029 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP KAPCA_CRIGR P25321 ? 1 ;MGNAAAAKKGSEQESVKEFLAKAKEEFLKKWESPSQNTAQLDHFDRIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKV VKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHS LDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFK GPGDTSNFDDYEEEEIRVSINEKCGKEFTEF ; 1 2 UNP G3HK48_CRIGR G3HK48 ? 2 TTYADFIASGRTGRRNAI 6 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5NW8 A 1 ? 351 ? P25321 1 ? 351 ? 0 350 2 2 5NW8 D 1 ? 18 ? G3HK48 6 ? 23 ? 11 28 # _struct_ref_seq_dif.align_id 2 _struct_ref_seq_dif.pdbx_pdb_id_code 5NW8 _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id D _struct_ref_seq_dif.seq_num 14 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code G3HK48 _struct_ref_seq_dif.db_mon_id ARG _struct_ref_seq_dif.pdbx_seq_db_seq_num 19 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 24 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 M77 non-polymer . '5-(1,4-DIAZEPAN-1-SULFONYL)ISOQUINOLINE' 'Fasudil; (5-ISOQUINOLINESULFONYL)HOMOPIPERAZINE' 'C14 H17 N3 O2 S' 291.369 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MPD non-polymer . '(4S)-2-METHYL-2,4-PENTANEDIOL' ? 'C6 H14 O2' 118.174 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 RIP 'D-saccharide, beta linking' . beta-D-ribopyranose ? 'C5 H10 O5' 150.130 SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P' 185.072 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TPO 'L-peptide linking' n PHOSPHOTHREONINE PHOSPHONOTHREONINE 'C4 H10 N O6 P' 199.099 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5NW8 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.56 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.96 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.9 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;5 mM Mes-Bis-Tris, 75 mM lithium chloride, 1 mM DTT, 0.1 mM sodium EDTA, 0.25 mM Mega 8, 0.7 mM peptidic ligand, 5 mM Fasudil x HCl, 16 % v/v methanol/water in reservoir ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-12-10 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9184 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'BESSY BEAMLINE 14.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9184 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 14.1 _diffrn_source.pdbx_synchrotron_site BESSY # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5NW8 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.086 _reflns.d_resolution_low 42.209 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 23612 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.2 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.075 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 16.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.09 _reflns_shell.d_res_low 2.21 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 4.95 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 3709 _reflns_shell.percent_possible_all 97.3 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.1 _reflns_shell.pdbx_Rsym_value 0.375 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.910 _reflns_shell.pdbx_R_split ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5NW8 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 23610 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.37 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 42.209 _refine.ls_d_res_high 2.086 _refine.ls_percent_reflns_obs 98.05 _refine.ls_R_factor_obs 0.1784 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1767 _refine.ls_R_factor_R_free 0.2118 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.00 _refine.ls_number_reflns_R_free 1181 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.21 _refine.pdbx_overall_phase_error 20.38 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2845 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 31 _refine_hist.number_atoms_solvent 180 _refine_hist.number_atoms_total 3056 _refine_hist.d_res_high 2.086 _refine_hist.d_res_low 42.209 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.007 ? ? 2974 'X-RAY DIFFRACTION' ? f_angle_d 0.795 ? ? 4045 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 16.137 ? ? 1744 'X-RAY DIFFRACTION' ? f_chiral_restr 0.051 ? ? 434 'X-RAY DIFFRACTION' ? f_plane_restr 0.005 ? ? 533 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all 'X-RAY DIFFRACTION' . 2.0859 2.1808 2702 0.2340 97.00 0.2771 . . 142 . . 'X-RAY DIFFRACTION' . 2.1808 2.2958 2787 0.1906 99.00 0.2421 . . 147 . . 'X-RAY DIFFRACTION' . 2.2958 2.4396 2685 0.1835 95.00 0.2178 . . 141 . . 'X-RAY DIFFRACTION' . 2.4396 2.6280 2809 0.1898 100.00 0.2463 . . 148 . . 'X-RAY DIFFRACTION' . 2.6280 2.8924 2867 0.1915 100.00 0.2489 . . 151 . . 'X-RAY DIFFRACTION' . 2.8924 3.3108 2825 0.1868 99.00 0.2204 . . 149 . . 'X-RAY DIFFRACTION' . 3.3108 4.1706 2800 0.1596 97.00 0.1715 . . 147 . . 'X-RAY DIFFRACTION' . 4.1706 42.2174 2954 0.1539 98.00 0.1847 . . 156 . . # _struct.entry_id 5NW8 _struct.title 'Crystal Structure of the Protein-Kinase A catalytic subunit from Criteculus Griseus in complex with compounds RKp032 and Fasudil' _struct.pdbx_descriptor 'cAMP-dependent protein kinase catalytic subunit alpha (E.C.2.7.11.11), cAMP-dependent protein kinase inhibitor' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5NW8 _struct_keywords.text 'Complex, peptidic ligand, ribose, transferase' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? G N N 6 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 12 ? SER A 33 ? GLU A 11 SER A 32 1 ? 22 HELX_P HELX_P2 AA2 GLN A 40 ? ASP A 42 ? GLN A 39 ASP A 41 5 ? 3 HELX_P HELX_P3 AA3 LYS A 77 ? LEU A 83 ? LYS A 76 LEU A 82 1 ? 7 HELX_P HELX_P4 AA4 GLN A 85 ? VAL A 99 ? GLN A 84 VAL A 98 1 ? 15 HELX_P HELX_P5 AA5 GLU A 128 ? GLY A 137 ? GLU A 127 GLY A 136 1 ? 10 HELX_P HELX_P6 AA6 SEP A 140 ? LEU A 161 ? SEP A 139 LEU A 160 1 ? 22 HELX_P HELX_P7 AA7 LYS A 169 ? GLU A 171 ? LYS A 168 GLU A 170 5 ? 3 HELX_P HELX_P8 AA8 THR A 202 ? LEU A 206 ? THR A 201 LEU A 205 5 ? 5 HELX_P HELX_P9 AA9 ALA A 207 ? LEU A 212 ? ALA A 206 LEU A 211 1 ? 6 HELX_P HELX_P10 AB1 LYS A 218 ? GLY A 235 ? LYS A 217 GLY A 234 1 ? 18 HELX_P HELX_P11 AB2 GLN A 243 ? GLY A 254 ? GLN A 242 GLY A 253 1 ? 12 HELX_P HELX_P12 AB3 SER A 263 ? LEU A 274 ? SER A 262 LEU A 273 1 ? 12 HELX_P HELX_P13 AB4 VAL A 289 ? ASN A 294 ? VAL A 288 ASN A 293 1 ? 6 HELX_P HELX_P14 AB5 HIS A 295 ? ALA A 299 ? HIS A 294 ALA A 298 5 ? 5 HELX_P HELX_P15 AB6 ASP A 302 ? GLN A 308 ? ASP A 301 GLN A 307 1 ? 7 HELX_P HELX_P16 AB7 GLY A 345 ? THR A 349 ? GLY A 344 THR A 348 5 ? 5 HELX_P HELX_P17 AB8 THR B 2 ? SER B 9 ? THR D 12 SER D 19 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A PHE 139 C ? ? ? 1_555 A SEP 140 N ? ? A PHE 138 A SEP 139 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale2 covale both ? A SEP 140 C ? ? ? 1_555 A GLU 141 N ? ? A SEP 139 A GLU 140 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale3 covale both ? A TRP 197 C ? ? ? 1_555 A TPO 198 N ? ? A TRP 196 A TPO 197 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale4 covale both ? A TPO 198 C ? ? ? 1_555 A LEU 199 N ? ? A TPO 197 A LEU 198 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale5 covale both ? A VAL 338 C ? ? ? 1_555 A SEP 339 N ? ? A VAL 337 A SEP 338 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale6 covale both ? A SEP 339 C ? ? ? 1_555 A ILE 340 N ? ? A SEP 338 A ILE 339 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale7 covale one ? B SER 14 OG ? ? ? 1_555 E RIP . C1 ? ? D SER 24 D RIP 101 1_555 ? ? ? ? ? ? ? 1.377 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 44 ? GLY A 53 ? PHE A 43 GLY A 52 AA1 2 GLY A 56 ? HIS A 63 ? GLY A 55 HIS A 62 AA1 3 HIS A 69 ? ASP A 76 ? HIS A 68 ASP A 75 AA1 4 ASN A 116 ? GLU A 122 ? ASN A 115 GLU A 121 AA1 5 LEU A 107 ? LYS A 112 ? LEU A 106 LYS A 111 AA2 1 LEU A 163 ? ILE A 164 ? LEU A 162 ILE A 163 AA2 2 LYS A 190 ? ARG A 191 ? LYS A 189 ARG A 190 AA3 1 LEU A 173 ? ILE A 175 ? LEU A 172 ILE A 174 AA3 2 ILE A 181 ? VAL A 183 ? ILE A 180 VAL A 182 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LYS A 48 ? N LYS A 47 O LEU A 60 ? O LEU A 59 AA1 2 3 N ARG A 57 ? N ARG A 56 O ILE A 74 ? O ILE A 73 AA1 3 4 N ALA A 71 ? N ALA A 70 O MET A 121 ? O MET A 120 AA1 4 5 O VAL A 120 ? O VAL A 119 N PHE A 109 ? N PHE A 108 AA2 1 2 N ILE A 164 ? N ILE A 163 O LYS A 190 ? O LYS A 189 AA3 1 2 N LEU A 174 ? N LEU A 173 O GLN A 182 ? O GLN A 181 # _atom_sites.entry_id 5NW8 _atom_sites.fract_transf_matrix[1][1] 0.014385 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013678 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012934 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 ? ? ? A . n A 1 2 GLY 2 1 ? ? ? A . n A 1 3 ASN 3 2 ? ? ? A . n A 1 4 ALA 4 3 ? ? ? A . n A 1 5 ALA 5 4 ? ? ? A . n A 1 6 ALA 6 5 ? ? ? A . n A 1 7 ALA 7 6 ? ? ? A . n A 1 8 LYS 8 7 ? ? ? A . n A 1 9 LYS 9 8 ? ? ? A . n A 1 10 GLY 10 9 ? ? ? A . n A 1 11 SEP 11 10 ? ? ? A . n A 1 12 GLU 12 11 11 GLU GLU A . n A 1 13 GLN 13 12 12 GLN GLN A . n A 1 14 GLU 14 13 13 GLU GLU A . n A 1 15 SER 15 14 14 SER SER A . n A 1 16 VAL 16 15 15 VAL VAL A . n A 1 17 LYS 17 16 16 LYS LYS A . n A 1 18 GLU 18 17 17 GLU GLU A . n A 1 19 PHE 19 18 18 PHE PHE A . n A 1 20 LEU 20 19 19 LEU LEU A . n A 1 21 ALA 21 20 20 ALA ALA A . n A 1 22 LYS 22 21 21 LYS LYS A . n A 1 23 ALA 23 22 22 ALA ALA A . n A 1 24 LYS 24 23 23 LYS LYS A . n A 1 25 GLU 25 24 24 GLU GLU A . n A 1 26 GLU 26 25 25 GLU GLU A . n A 1 27 PHE 27 26 26 PHE PHE A . n A 1 28 LEU 28 27 27 LEU LEU A . n A 1 29 LYS 29 28 28 LYS LYS A . n A 1 30 LYS 30 29 29 LYS LYS A . n A 1 31 TRP 31 30 30 TRP TRP A . n A 1 32 GLU 32 31 31 GLU GLU A . n A 1 33 SER 33 32 32 SER SER A . n A 1 34 PRO 34 33 33 PRO PRO A . n A 1 35 SER 35 34 34 SER SER A . n A 1 36 GLN 36 35 35 GLN GLN A . n A 1 37 ASN 37 36 36 ASN ASN A . n A 1 38 THR 38 37 37 THR THR A . n A 1 39 ALA 39 38 38 ALA ALA A . n A 1 40 GLN 40 39 39 GLN GLN A . n A 1 41 LEU 41 40 40 LEU LEU A . n A 1 42 ASP 42 41 41 ASP ASP A . n A 1 43 HIS 43 42 42 HIS HIS A . n A 1 44 PHE 44 43 43 PHE PHE A . n A 1 45 ASP 45 44 44 ASP ASP A . n A 1 46 ARG 46 45 45 ARG ARG A . n A 1 47 ILE 47 46 46 ILE ILE A . n A 1 48 LYS 48 47 47 LYS LYS A . n A 1 49 THR 49 48 48 THR THR A . n A 1 50 LEU 50 49 49 LEU LEU A . n A 1 51 GLY 51 50 50 GLY GLY A . n A 1 52 THR 52 51 51 THR THR A . n A 1 53 GLY 53 52 52 GLY GLY A . n A 1 54 SER 54 53 53 SER SER A . n A 1 55 PHE 55 54 54 PHE PHE A . n A 1 56 GLY 56 55 55 GLY GLY A . n A 1 57 ARG 57 56 56 ARG ARG A . n A 1 58 VAL 58 57 57 VAL VAL A . n A 1 59 MET 59 58 58 MET MET A . n A 1 60 LEU 60 59 59 LEU LEU A . n A 1 61 VAL 61 60 60 VAL VAL A . n A 1 62 LYS 62 61 61 LYS LYS A . n A 1 63 HIS 63 62 62 HIS HIS A . n A 1 64 LYS 64 63 63 LYS LYS A . n A 1 65 GLU 65 64 64 GLU GLU A . n A 1 66 THR 66 65 65 THR THR A . n A 1 67 GLY 67 66 66 GLY GLY A . n A 1 68 ASN 68 67 67 ASN ASN A . n A 1 69 HIS 69 68 68 HIS HIS A . n A 1 70 TYR 70 69 69 TYR TYR A . n A 1 71 ALA 71 70 70 ALA ALA A . n A 1 72 MET 72 71 71 MET MET A . n A 1 73 LYS 73 72 72 LYS LYS A . n A 1 74 ILE 74 73 73 ILE ILE A . n A 1 75 LEU 75 74 74 LEU LEU A . n A 1 76 ASP 76 75 75 ASP ASP A . n A 1 77 LYS 77 76 76 LYS LYS A . n A 1 78 GLN 78 77 77 GLN GLN A . n A 1 79 LYS 79 78 78 LYS LYS A . n A 1 80 VAL 80 79 79 VAL VAL A . n A 1 81 VAL 81 80 80 VAL VAL A . n A 1 82 LYS 82 81 81 LYS LYS A . n A 1 83 LEU 83 82 82 LEU LEU A . n A 1 84 LYS 84 83 83 LYS LYS A . n A 1 85 GLN 85 84 84 GLN GLN A . n A 1 86 ILE 86 85 85 ILE ILE A . n A 1 87 GLU 87 86 86 GLU GLU A . n A 1 88 HIS 88 87 87 HIS HIS A . n A 1 89 THR 89 88 88 THR THR A . n A 1 90 LEU 90 89 89 LEU LEU A . n A 1 91 ASN 91 90 90 ASN ASN A . n A 1 92 GLU 92 91 91 GLU GLU A . n A 1 93 LYS 93 92 92 LYS LYS A . n A 1 94 ARG 94 93 93 ARG ARG A . n A 1 95 ILE 95 94 94 ILE ILE A . n A 1 96 LEU 96 95 95 LEU LEU A . n A 1 97 GLN 97 96 96 GLN GLN A . n A 1 98 ALA 98 97 97 ALA ALA A . n A 1 99 VAL 99 98 98 VAL VAL A . n A 1 100 ASN 100 99 99 ASN ASN A . n A 1 101 PHE 101 100 100 PHE PHE A . n A 1 102 PRO 102 101 101 PRO PRO A . n A 1 103 PHE 103 102 102 PHE PHE A . n A 1 104 LEU 104 103 103 LEU LEU A . n A 1 105 VAL 105 104 104 VAL VAL A . n A 1 106 LYS 106 105 105 LYS LYS A . n A 1 107 LEU 107 106 106 LEU LEU A . n A 1 108 GLU 108 107 107 GLU GLU A . n A 1 109 PHE 109 108 108 PHE PHE A . n A 1 110 SER 110 109 109 SER SER A . n A 1 111 PHE 111 110 110 PHE PHE A . n A 1 112 LYS 112 111 111 LYS LYS A . n A 1 113 ASP 113 112 112 ASP ASP A . n A 1 114 ASN 114 113 113 ASN ASN A . n A 1 115 SER 115 114 114 SER SER A . n A 1 116 ASN 116 115 115 ASN ASN A . n A 1 117 LEU 117 116 116 LEU LEU A . n A 1 118 TYR 118 117 117 TYR TYR A . n A 1 119 MET 119 118 118 MET MET A . n A 1 120 VAL 120 119 119 VAL VAL A . n A 1 121 MET 121 120 120 MET MET A . n A 1 122 GLU 122 121 121 GLU GLU A . n A 1 123 TYR 123 122 122 TYR TYR A . n A 1 124 VAL 124 123 123 VAL VAL A . n A 1 125 PRO 125 124 124 PRO PRO A . n A 1 126 GLY 126 125 125 GLY GLY A . n A 1 127 GLY 127 126 126 GLY GLY A . n A 1 128 GLU 128 127 127 GLU GLU A . n A 1 129 MET 129 128 128 MET MET A . n A 1 130 PHE 130 129 129 PHE PHE A . n A 1 131 SER 131 130 130 SER SER A . n A 1 132 HIS 132 131 131 HIS HIS A . n A 1 133 LEU 133 132 132 LEU LEU A . n A 1 134 ARG 134 133 133 ARG ARG A . n A 1 135 ARG 135 134 134 ARG ARG A . n A 1 136 ILE 136 135 135 ILE ILE A . n A 1 137 GLY 137 136 136 GLY GLY A . n A 1 138 ARG 138 137 137 ARG ARG A . n A 1 139 PHE 139 138 138 PHE PHE A . n A 1 140 SEP 140 139 139 SEP SEP A . n A 1 141 GLU 141 140 140 GLU GLU A . n A 1 142 PRO 142 141 141 PRO PRO A . n A 1 143 HIS 143 142 142 HIS HIS A . n A 1 144 ALA 144 143 143 ALA ALA A . n A 1 145 ARG 145 144 144 ARG ARG A . n A 1 146 PHE 146 145 145 PHE PHE A . n A 1 147 TYR 147 146 146 TYR TYR A . n A 1 148 ALA 148 147 147 ALA ALA A . n A 1 149 ALA 149 148 148 ALA ALA A . n A 1 150 GLN 150 149 149 GLN GLN A . n A 1 151 ILE 151 150 150 ILE ILE A . n A 1 152 VAL 152 151 151 VAL VAL A . n A 1 153 LEU 153 152 152 LEU LEU A . n A 1 154 THR 154 153 153 THR THR A . n A 1 155 PHE 155 154 154 PHE PHE A . n A 1 156 GLU 156 155 155 GLU GLU A . n A 1 157 TYR 157 156 156 TYR TYR A . n A 1 158 LEU 158 157 157 LEU LEU A . n A 1 159 HIS 159 158 158 HIS HIS A . n A 1 160 SER 160 159 159 SER SER A . n A 1 161 LEU 161 160 160 LEU LEU A . n A 1 162 ASP 162 161 161 ASP ASP A . n A 1 163 LEU 163 162 162 LEU LEU A . n A 1 164 ILE 164 163 163 ILE ILE A . n A 1 165 TYR 165 164 164 TYR TYR A . n A 1 166 ARG 166 165 165 ARG ARG A . n A 1 167 ASP 167 166 166 ASP ASP A . n A 1 168 LEU 168 167 167 LEU LEU A . n A 1 169 LYS 169 168 168 LYS LYS A . n A 1 170 PRO 170 169 169 PRO PRO A . n A 1 171 GLU 171 170 170 GLU GLU A . n A 1 172 ASN 172 171 171 ASN ASN A . n A 1 173 LEU 173 172 172 LEU LEU A . n A 1 174 LEU 174 173 173 LEU LEU A . n A 1 175 ILE 175 174 174 ILE ILE A . n A 1 176 ASP 176 175 175 ASP ASP A . n A 1 177 GLN 177 176 176 GLN GLN A . n A 1 178 GLN 178 177 177 GLN GLN A . n A 1 179 GLY 179 178 178 GLY GLY A . n A 1 180 TYR 180 179 179 TYR TYR A . n A 1 181 ILE 181 180 180 ILE ILE A . n A 1 182 GLN 182 181 181 GLN GLN A . n A 1 183 VAL 183 182 182 VAL VAL A . n A 1 184 THR 184 183 183 THR THR A . n A 1 185 ASP 185 184 184 ASP ASP A . n A 1 186 PHE 186 185 185 PHE PHE A . n A 1 187 GLY 187 186 186 GLY GLY A . n A 1 188 PHE 188 187 187 PHE PHE A . n A 1 189 ALA 189 188 188 ALA ALA A . n A 1 190 LYS 190 189 189 LYS LYS A . n A 1 191 ARG 191 190 190 ARG ARG A . n A 1 192 VAL 192 191 191 VAL VAL A . n A 1 193 LYS 193 192 192 LYS LYS A . n A 1 194 GLY 194 193 193 GLY GLY A . n A 1 195 ARG 195 194 194 ARG ARG A . n A 1 196 THR 196 195 195 THR THR A . n A 1 197 TRP 197 196 196 TRP TRP A . n A 1 198 TPO 198 197 197 TPO TPO A . n A 1 199 LEU 199 198 198 LEU LEU A . n A 1 200 CYS 200 199 199 CYS CYS A . n A 1 201 GLY 201 200 200 GLY GLY A . n A 1 202 THR 202 201 201 THR THR A . n A 1 203 PRO 203 202 202 PRO PRO A . n A 1 204 GLU 204 203 203 GLU GLU A . n A 1 205 TYR 205 204 204 TYR TYR A . n A 1 206 LEU 206 205 205 LEU LEU A . n A 1 207 ALA 207 206 206 ALA ALA A . n A 1 208 PRO 208 207 207 PRO PRO A . n A 1 209 GLU 209 208 208 GLU GLU A . n A 1 210 ILE 210 209 209 ILE ILE A . n A 1 211 ILE 211 210 210 ILE ILE A . n A 1 212 LEU 212 211 211 LEU LEU A . n A 1 213 SER 213 212 212 SER SER A . n A 1 214 LYS 214 213 213 LYS LYS A . n A 1 215 GLY 215 214 214 GLY GLY A . n A 1 216 TYR 216 215 215 TYR TYR A . n A 1 217 ASN 217 216 216 ASN ASN A . n A 1 218 LYS 218 217 217 LYS LYS A . n A 1 219 ALA 219 218 218 ALA ALA A . n A 1 220 VAL 220 219 219 VAL VAL A . n A 1 221 ASP 221 220 220 ASP ASP A . n A 1 222 TRP 222 221 221 TRP TRP A . n A 1 223 TRP 223 222 222 TRP TRP A . n A 1 224 ALA 224 223 223 ALA ALA A . n A 1 225 LEU 225 224 224 LEU LEU A . n A 1 226 GLY 226 225 225 GLY GLY A . n A 1 227 VAL 227 226 226 VAL VAL A . n A 1 228 LEU 228 227 227 LEU LEU A . n A 1 229 ILE 229 228 228 ILE ILE A . n A 1 230 TYR 230 229 229 TYR TYR A . n A 1 231 GLU 231 230 230 GLU GLU A . n A 1 232 MET 232 231 231 MET MET A . n A 1 233 ALA 233 232 232 ALA ALA A . n A 1 234 ALA 234 233 233 ALA ALA A . n A 1 235 GLY 235 234 234 GLY GLY A . n A 1 236 TYR 236 235 235 TYR TYR A . n A 1 237 PRO 237 236 236 PRO PRO A . n A 1 238 PRO 238 237 237 PRO PRO A . n A 1 239 PHE 239 238 238 PHE PHE A . n A 1 240 PHE 240 239 239 PHE PHE A . n A 1 241 ALA 241 240 240 ALA ALA A . n A 1 242 ASP 242 241 241 ASP ASP A . n A 1 243 GLN 243 242 242 GLN GLN A . n A 1 244 PRO 244 243 243 PRO PRO A . n A 1 245 ILE 245 244 244 ILE ILE A . n A 1 246 GLN 246 245 245 GLN GLN A . n A 1 247 ILE 247 246 246 ILE ILE A . n A 1 248 TYR 248 247 247 TYR TYR A . n A 1 249 GLU 249 248 248 GLU GLU A . n A 1 250 LYS 250 249 249 LYS LYS A . n A 1 251 ILE 251 250 250 ILE ILE A . n A 1 252 VAL 252 251 251 VAL VAL A . n A 1 253 SER 253 252 252 SER SER A . n A 1 254 GLY 254 253 253 GLY GLY A . n A 1 255 LYS 255 254 254 LYS LYS A . n A 1 256 VAL 256 255 255 VAL VAL A . n A 1 257 ARG 257 256 256 ARG ARG A . n A 1 258 PHE 258 257 257 PHE PHE A . n A 1 259 PRO 259 258 258 PRO PRO A . n A 1 260 SER 260 259 259 SER SER A . n A 1 261 HIS 261 260 260 HIS HIS A . n A 1 262 PHE 262 261 261 PHE PHE A . n A 1 263 SER 263 262 262 SER SER A . n A 1 264 SER 264 263 263 SER SER A . n A 1 265 ASP 265 264 264 ASP ASP A . n A 1 266 LEU 266 265 265 LEU LEU A . n A 1 267 LYS 267 266 266 LYS LYS A . n A 1 268 ASP 268 267 267 ASP ASP A . n A 1 269 LEU 269 268 268 LEU LEU A . n A 1 270 LEU 270 269 269 LEU LEU A . n A 1 271 ARG 271 270 270 ARG ARG A . n A 1 272 ASN 272 271 271 ASN ASN A . n A 1 273 LEU 273 272 272 LEU LEU A . n A 1 274 LEU 274 273 273 LEU LEU A . n A 1 275 GLN 275 274 274 GLN GLN A . n A 1 276 VAL 276 275 275 VAL VAL A . n A 1 277 ASP 277 276 276 ASP ASP A . n A 1 278 LEU 278 277 277 LEU LEU A . n A 1 279 THR 279 278 278 THR THR A . n A 1 280 LYS 280 279 279 LYS LYS A . n A 1 281 ARG 281 280 280 ARG ARG A . n A 1 282 PHE 282 281 281 PHE PHE A . n A 1 283 GLY 283 282 282 GLY GLY A . n A 1 284 ASN 284 283 283 ASN ASN A . n A 1 285 LEU 285 284 284 LEU LEU A . n A 1 286 LYS 286 285 285 LYS LYS A . n A 1 287 ASN 287 286 286 ASN ASN A . n A 1 288 GLY 288 287 287 GLY GLY A . n A 1 289 VAL 289 288 288 VAL VAL A . n A 1 290 ASN 290 289 289 ASN ASN A . n A 1 291 ASP 291 290 290 ASP ASP A . n A 1 292 ILE 292 291 291 ILE ILE A . n A 1 293 LYS 293 292 292 LYS LYS A . n A 1 294 ASN 294 293 293 ASN ASN A . n A 1 295 HIS 295 294 294 HIS HIS A . n A 1 296 LYS 296 295 295 LYS LYS A . n A 1 297 TRP 297 296 296 TRP TRP A . n A 1 298 PHE 298 297 297 PHE PHE A . n A 1 299 ALA 299 298 298 ALA ALA A . n A 1 300 THR 300 299 299 THR THR A . n A 1 301 THR 301 300 300 THR THR A . n A 1 302 ASP 302 301 301 ASP ASP A . n A 1 303 TRP 303 302 302 TRP TRP A . n A 1 304 ILE 304 303 303 ILE ILE A . n A 1 305 ALA 305 304 304 ALA ALA A . n A 1 306 ILE 306 305 305 ILE ILE A . n A 1 307 TYR 307 306 306 TYR TYR A . n A 1 308 GLN 308 307 307 GLN GLN A . n A 1 309 ARG 309 308 308 ARG ARG A . n A 1 310 LYS 310 309 309 LYS LYS A . n A 1 311 VAL 311 310 310 VAL VAL A . n A 1 312 GLU 312 311 311 GLU GLU A . n A 1 313 ALA 313 312 312 ALA ALA A . n A 1 314 PRO 314 313 313 PRO PRO A . n A 1 315 PHE 315 314 314 PHE PHE A . n A 1 316 ILE 316 315 315 ILE ILE A . n A 1 317 PRO 317 316 316 PRO PRO A . n A 1 318 LYS 318 317 317 LYS LYS A . n A 1 319 PHE 319 318 318 PHE PHE A . n A 1 320 LYS 320 319 319 LYS LYS A . n A 1 321 GLY 321 320 320 GLY GLY A . n A 1 322 PRO 322 321 321 PRO PRO A . n A 1 323 GLY 323 322 322 GLY GLY A . n A 1 324 ASP 324 323 323 ASP ASP A . n A 1 325 THR 325 324 324 THR THR A . n A 1 326 SER 326 325 325 SER SER A . n A 1 327 ASN 327 326 326 ASN ASN A . n A 1 328 PHE 328 327 327 PHE PHE A . n A 1 329 ASP 329 328 328 ASP ASP A . n A 1 330 ASP 330 329 329 ASP ASP A . n A 1 331 TYR 331 330 330 TYR TYR A . n A 1 332 GLU 332 331 331 GLU GLU A . n A 1 333 GLU 333 332 332 GLU GLU A . n A 1 334 GLU 334 333 333 GLU GLU A . n A 1 335 GLU 335 334 334 GLU GLU A . n A 1 336 ILE 336 335 335 ILE ILE A . n A 1 337 ARG 337 336 336 ARG ARG A . n A 1 338 VAL 338 337 337 VAL VAL A . n A 1 339 SEP 339 338 338 SEP SEP A . n A 1 340 ILE 340 339 339 ILE ILE A . n A 1 341 ASN 341 340 340 ASN ASN A . n A 1 342 GLU 342 341 341 GLU GLU A . n A 1 343 LYS 343 342 342 LYS LYS A . n A 1 344 CYS 344 343 343 CYS CYS A . n A 1 345 GLY 345 344 344 GLY GLY A . n A 1 346 LYS 346 345 345 LYS LYS A . n A 1 347 GLU 347 346 346 GLU GLU A . n A 1 348 PHE 348 347 347 PHE PHE A . n A 1 349 THR 349 348 348 THR THR A . n A 1 350 GLU 350 349 349 GLU GLU A . n A 1 351 PHE 351 350 350 PHE PHE A . n B 2 1 THR 1 11 11 THR THR D . n B 2 2 THR 2 12 12 THR THR D . n B 2 3 TYR 3 13 13 TYR TYR D . n B 2 4 ALA 4 14 14 ALA ALA D . n B 2 5 ASP 5 15 15 ASP ASP D . n B 2 6 PHE 6 16 16 PHE PHE D . n B 2 7 ILE 7 17 17 ILE ILE D . n B 2 8 ALA 8 18 18 ALA ALA D . n B 2 9 SER 9 19 19 SER SER D . n B 2 10 GLY 10 20 20 GLY GLY D . n B 2 11 ARG 11 21 21 ARG ARG D . n B 2 12 THR 12 22 22 THR THR D . n B 2 13 GLY 13 23 23 GLY GLY D . n B 2 14 SER 14 24 24 SER SER D . n B 2 15 ARG 15 25 25 ARG ARG D . n B 2 16 ASN 16 26 26 ASN ASN D . n B 2 17 ALA 17 27 27 ALA ALA D . n B 2 18 ILE 18 28 28 ILE ILE D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 MPD 1 401 1 MPD MPD A . D 4 M77 1 402 1 M77 FAS A . E 5 RIP 1 101 1 RIP RIB D . F 6 HOH 1 501 114 HOH HOH A . F 6 HOH 2 502 99 HOH HOH A . F 6 HOH 3 503 147 HOH HOH A . F 6 HOH 4 504 140 HOH HOH A . F 6 HOH 5 505 145 HOH HOH A . F 6 HOH 6 506 57 HOH HOH A . F 6 HOH 7 507 117 HOH HOH A . F 6 HOH 8 508 193 HOH HOH A . F 6 HOH 9 509 203 HOH HOH A . F 6 HOH 10 510 181 HOH HOH A . F 6 HOH 11 511 123 HOH HOH A . F 6 HOH 12 512 205 HOH HOH A . F 6 HOH 13 513 166 HOH HOH A . F 6 HOH 14 514 125 HOH HOH A . F 6 HOH 15 515 154 HOH HOH A . F 6 HOH 16 516 130 HOH HOH A . F 6 HOH 17 517 204 HOH HOH A . F 6 HOH 18 518 65 HOH HOH A . F 6 HOH 19 519 202 HOH HOH A . F 6 HOH 20 520 98 HOH HOH A . F 6 HOH 21 521 20 HOH HOH A . F 6 HOH 22 522 197 HOH HOH A . F 6 HOH 23 523 10 HOH HOH A . F 6 HOH 24 524 124 HOH HOH A . F 6 HOH 25 525 50 HOH HOH A . F 6 HOH 26 526 17 HOH HOH A . F 6 HOH 27 527 56 HOH HOH A . F 6 HOH 28 528 120 HOH HOH A . F 6 HOH 29 529 175 HOH HOH A . F 6 HOH 30 530 168 HOH HOH A . F 6 HOH 31 531 100 HOH HOH A . F 6 HOH 32 532 144 HOH HOH A . F 6 HOH 33 533 110 HOH HOH A . F 6 HOH 34 534 119 HOH HOH A . F 6 HOH 35 535 75 HOH HOH A . F 6 HOH 36 536 3 HOH HOH A . F 6 HOH 37 537 45 HOH HOH A . F 6 HOH 38 538 118 HOH HOH A . F 6 HOH 39 539 91 HOH HOH A . F 6 HOH 40 540 112 HOH HOH A . F 6 HOH 41 541 54 HOH HOH A . F 6 HOH 42 542 47 HOH HOH A . F 6 HOH 43 543 76 HOH HOH A . F 6 HOH 44 544 63 HOH HOH A . F 6 HOH 45 545 41 HOH HOH A . F 6 HOH 46 546 139 HOH HOH A . F 6 HOH 47 547 69 HOH HOH A . F 6 HOH 48 548 104 HOH HOH A . F 6 HOH 49 549 37 HOH HOH A . F 6 HOH 50 550 172 HOH HOH A . F 6 HOH 51 551 201 HOH HOH A . F 6 HOH 52 552 142 HOH HOH A . F 6 HOH 53 553 66 HOH HOH A . F 6 HOH 54 554 2 HOH HOH A . F 6 HOH 55 555 196 HOH HOH A . F 6 HOH 56 556 111 HOH HOH A . F 6 HOH 57 557 84 HOH HOH A . F 6 HOH 58 558 73 HOH HOH A . F 6 HOH 59 559 103 HOH HOH A . F 6 HOH 60 560 101 HOH HOH A . F 6 HOH 61 561 46 HOH HOH A . F 6 HOH 62 562 176 HOH HOH A . F 6 HOH 63 563 38 HOH HOH A . F 6 HOH 64 564 42 HOH HOH A . F 6 HOH 65 565 5 HOH HOH A . F 6 HOH 66 566 92 HOH HOH A . F 6 HOH 67 567 28 HOH HOH A . F 6 HOH 68 568 195 HOH HOH A . F 6 HOH 69 569 52 HOH HOH A . F 6 HOH 70 570 200 HOH HOH A . F 6 HOH 71 571 39 HOH HOH A . F 6 HOH 72 572 27 HOH HOH A . F 6 HOH 73 573 36 HOH HOH A . F 6 HOH 74 574 4 HOH HOH A . F 6 HOH 75 575 126 HOH HOH A . F 6 HOH 76 576 22 HOH HOH A . F 6 HOH 77 577 158 HOH HOH A . F 6 HOH 78 578 132 HOH HOH A . F 6 HOH 79 579 43 HOH HOH A . F 6 HOH 80 580 8 HOH HOH A . F 6 HOH 81 581 26 HOH HOH A . F 6 HOH 82 582 15 HOH HOH A . F 6 HOH 83 583 97 HOH HOH A . F 6 HOH 84 584 143 HOH HOH A . F 6 HOH 85 585 71 HOH HOH A . F 6 HOH 86 586 85 HOH HOH A . F 6 HOH 87 587 94 HOH HOH A . F 6 HOH 88 588 9 HOH HOH A . F 6 HOH 89 589 93 HOH HOH A . F 6 HOH 90 590 180 HOH HOH A . F 6 HOH 91 591 80 HOH HOH A . F 6 HOH 92 592 106 HOH HOH A . F 6 HOH 93 593 122 HOH HOH A . F 6 HOH 94 594 90 HOH HOH A . F 6 HOH 95 595 177 HOH HOH A . F 6 HOH 96 596 165 HOH HOH A . F 6 HOH 97 597 162 HOH HOH A . F 6 HOH 98 598 79 HOH HOH A . F 6 HOH 99 599 199 HOH HOH A . F 6 HOH 100 600 40 HOH HOH A . F 6 HOH 101 601 137 HOH HOH A . F 6 HOH 102 602 34 HOH HOH A . F 6 HOH 103 603 116 HOH HOH A . F 6 HOH 104 604 35 HOH HOH A . F 6 HOH 105 605 170 HOH HOH A . F 6 HOH 106 606 135 HOH HOH A . F 6 HOH 107 607 185 HOH HOH A . F 6 HOH 108 608 148 HOH HOH A . F 6 HOH 109 609 53 HOH HOH A . F 6 HOH 110 610 6 HOH HOH A . F 6 HOH 111 611 21 HOH HOH A . F 6 HOH 112 612 30 HOH HOH A . F 6 HOH 113 613 55 HOH HOH A . F 6 HOH 114 614 160 HOH HOH A . F 6 HOH 115 615 198 HOH HOH A . F 6 HOH 116 616 96 HOH HOH A . F 6 HOH 117 617 115 HOH HOH A . F 6 HOH 118 618 81 HOH HOH A . F 6 HOH 119 619 12 HOH HOH A . F 6 HOH 120 620 44 HOH HOH A . F 6 HOH 121 621 77 HOH HOH A . F 6 HOH 122 622 13 HOH HOH A . F 6 HOH 123 623 179 HOH HOH A . F 6 HOH 124 624 23 HOH HOH A . F 6 HOH 125 625 11 HOH HOH A . F 6 HOH 126 626 194 HOH HOH A . F 6 HOH 127 627 24 HOH HOH A . F 6 HOH 128 628 72 HOH HOH A . F 6 HOH 129 629 32 HOH HOH A . F 6 HOH 130 630 33 HOH HOH A . F 6 HOH 131 631 189 HOH HOH A . F 6 HOH 132 632 127 HOH HOH A . F 6 HOH 133 633 186 HOH HOH A . F 6 HOH 134 634 187 HOH HOH A . F 6 HOH 135 635 49 HOH HOH A . F 6 HOH 136 636 128 HOH HOH A . F 6 HOH 137 637 18 HOH HOH A . F 6 HOH 138 638 59 HOH HOH A . F 6 HOH 139 639 141 HOH HOH A . F 6 HOH 140 640 152 HOH HOH A . F 6 HOH 141 641 146 HOH HOH A . F 6 HOH 142 642 25 HOH HOH A . F 6 HOH 143 643 157 HOH HOH A . F 6 HOH 144 644 19 HOH HOH A . F 6 HOH 145 645 102 HOH HOH A . F 6 HOH 146 646 173 HOH HOH A . F 6 HOH 147 647 68 HOH HOH A . F 6 HOH 148 648 78 HOH HOH A . F 6 HOH 149 649 161 HOH HOH A . F 6 HOH 150 650 14 HOH HOH A . F 6 HOH 151 651 83 HOH HOH A . F 6 HOH 152 652 105 HOH HOH A . F 6 HOH 153 653 184 HOH HOH A . F 6 HOH 154 654 206 HOH HOH A . F 6 HOH 155 655 155 HOH HOH A . F 6 HOH 156 656 169 HOH HOH A . F 6 HOH 157 657 149 HOH HOH A . F 6 HOH 158 658 108 HOH HOH A . F 6 HOH 159 659 153 HOH HOH A . F 6 HOH 160 660 121 HOH HOH A . F 6 HOH 161 661 67 HOH HOH A . F 6 HOH 162 662 183 HOH HOH A . F 6 HOH 163 663 82 HOH HOH A . F 6 HOH 164 664 138 HOH HOH A . F 6 HOH 165 665 174 HOH HOH A . F 6 HOH 166 666 164 HOH HOH A . F 6 HOH 167 667 163 HOH HOH A . G 6 HOH 1 201 86 HOH HOH D . G 6 HOH 2 202 190 HOH HOH D . G 6 HOH 3 203 16 HOH HOH D . G 6 HOH 4 204 209 HOH HOH D . G 6 HOH 5 205 136 HOH HOH D . G 6 HOH 6 206 212 HOH HOH D . G 6 HOH 7 207 211 HOH HOH D . G 6 HOH 8 208 208 HOH HOH D . G 6 HOH 9 209 210 HOH HOH D . G 6 HOH 10 210 156 HOH HOH D . G 6 HOH 11 211 207 HOH HOH D . G 6 HOH 12 212 151 HOH HOH D . G 6 HOH 13 213 171 HOH HOH D . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A SEP 140 A SEP 139 ? SER 'modified residue' 2 A TPO 198 A TPO 197 ? THR 'modified residue' 3 A SEP 339 A SEP 338 ? SER 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2600 ? 1 MORE -16 ? 1 'SSA (A^2)' 15660 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-05-30 2 'Structure model' 1 1 2019-05-15 3 'Structure model' 1 2 2020-07-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 3 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' pdbx_database_proc 4 3 'Structure model' chem_comp 5 3 'Structure model' entity 6 3 'Structure model' pdbx_chem_comp_identifier 7 3 'Structure model' pdbx_entity_nonpoly 8 3 'Structure model' struct_site 9 3 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.title' 7 2 'Structure model' '_citation.year' 8 3 'Structure model' '_chem_comp.name' 9 3 'Structure model' '_chem_comp.pdbx_synonyms' 10 3 'Structure model' '_chem_comp.type' 11 3 'Structure model' '_entity.pdbx_description' 12 3 'Structure model' '_pdbx_entity_nonpoly.name' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 25.0220 30.5847 16.7818 0.2051 0.3280 0.2050 -0.0989 -0.0609 0.0583 0.0496 0.3323 0.6006 -0.1284 -0.1721 0.4468 0.0332 -0.1689 0.1763 0.0115 0.1348 -0.0942 -0.1374 0.3141 0.2096 'X-RAY DIFFRACTION' 2 ? refined 11.7793 15.6455 -3.8041 0.2280 0.2149 0.1827 -0.0195 0.0545 0.0061 0.4379 0.6914 0.0403 -0.4475 0.1327 -0.1333 0.0052 0.2805 -0.0647 -0.2720 0.0464 0.1988 -0.1300 0.0360 0.0479 'X-RAY DIFFRACTION' 3 ? refined 9.4238 14.0181 -2.3783 0.1008 0.2179 0.2051 -0.0010 -0.0155 -0.0381 0.1489 0.4336 0.2916 0.1859 -0.0952 -0.2391 -0.1421 0.0593 -0.0615 -0.2595 0.0396 0.0522 -0.0304 0.0090 -0.0873 'X-RAY DIFFRACTION' 4 ? refined 12.1209 16.4146 12.7648 0.1085 0.1379 0.1103 0.0081 -0.0007 -0.0002 0.4867 0.3878 0.3790 -0.0252 -0.1007 0.0866 -0.0695 0.0450 -0.0783 -0.0100 -0.0006 -0.0101 -0.0109 0.1803 -0.0158 'X-RAY DIFFRACTION' 5 ? refined 5.6462 19.2415 27.2968 0.1494 0.0924 0.1179 0.0170 0.0255 -0.0272 0.7859 0.8027 0.5929 0.0789 -0.2576 -0.4354 0.0207 -0.2380 0.1062 0.1722 -0.0129 0.2047 -0.0864 0.1121 -0.0595 'X-RAY DIFFRACTION' 6 ? refined 12.2713 12.7980 7.1200 0.1015 0.1060 0.1687 -0.0305 -0.0183 0.0402 0.3647 0.4321 0.7146 0.0580 -0.4056 0.2829 -0.0475 0.0099 -0.1583 -0.1060 0.0418 0.1140 0.0405 0.0555 -0.0005 'X-RAY DIFFRACTION' 7 ? refined -6.4171 2.3993 29.6877 0.1575 0.1660 0.3052 -0.0170 0.0651 0.0319 0.0040 0.0976 0.0675 0.0196 0.0167 0.0813 -0.0670 -0.1293 -0.2102 -0.0445 -0.0116 0.1375 -0.1332 0.0123 -0.0028 'X-RAY DIFFRACTION' 8 ? refined -4.8331 11.3749 18.7124 0.1777 0.0747 0.2917 0.0008 -0.0629 -0.0003 0.0002 0.0034 0.0070 0.0012 0.0016 0.0050 -0.0787 0.0115 -0.2247 -0.1463 -0.1194 0.2173 -0.2458 -0.0724 -0.0137 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 11 through 31 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 32 through 54 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 55 through 81 ) ; 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 82 through 160 ) ; 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 161 through 297 ) ; 'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 298 through 350 ) ; 'X-RAY DIFFRACTION' 7 7 ? ? ? ? ? ? ? ? ? ;chain 'D' and (resid 11 through 18 ) ; 'X-RAY DIFFRACTION' 8 8 ? ? ? ? ? ? ? ? ? ;chain 'D' and (resid 19 through 28 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10.1_2155: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 3 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 4 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 54 ? ? 67.48 -9.60 2 1 LEU A 273 ? ? -82.42 48.39 3 1 ARG D 21 ? ? -108.86 46.70 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 11 ? CG ? A GLU 12 CG 2 1 Y 1 A GLU 11 ? CD ? A GLU 12 CD 3 1 Y 1 A GLU 11 ? OE1 ? A GLU 12 OE1 4 1 Y 1 A GLU 11 ? OE2 ? A GLU 12 OE2 5 1 Y 1 A GLN 12 ? CG ? A GLN 13 CG 6 1 Y 1 A GLN 12 ? CD ? A GLN 13 CD 7 1 Y 1 A GLN 12 ? OE1 ? A GLN 13 OE1 8 1 Y 1 A GLN 12 ? NE2 ? A GLN 13 NE2 9 1 Y 1 A SER 14 ? OG ? A SER 15 OG 10 1 Y 1 A LYS 16 ? CG ? A LYS 17 CG 11 1 Y 1 A LYS 16 ? CD ? A LYS 17 CD 12 1 Y 1 A LYS 16 ? CE ? A LYS 17 CE 13 1 Y 1 A LYS 16 ? NZ ? A LYS 17 NZ 14 1 Y 1 A LYS 21 ? CG ? A LYS 22 CG 15 1 Y 1 A LYS 21 ? CD ? A LYS 22 CD 16 1 Y 1 A LYS 21 ? CE ? A LYS 22 CE 17 1 Y 1 A LYS 21 ? NZ ? A LYS 22 NZ 18 1 Y 1 A LYS 28 ? CD ? A LYS 29 CD 19 1 Y 1 A LYS 28 ? CE ? A LYS 29 CE 20 1 Y 1 A LYS 28 ? NZ ? A LYS 29 NZ 21 1 Y 1 A ARG 45 ? CG ? A ARG 46 CG 22 1 Y 1 A ARG 45 ? CD ? A ARG 46 CD 23 1 Y 1 A ARG 45 ? NE ? A ARG 46 NE 24 1 Y 1 A ARG 45 ? CZ ? A ARG 46 CZ 25 1 Y 1 A ARG 45 ? NH1 ? A ARG 46 NH1 26 1 Y 1 A ARG 45 ? NH2 ? A ARG 46 NH2 27 1 Y 1 A SER 53 ? OG ? A SER 54 OG 28 1 Y 1 A PHE 54 ? CG ? A PHE 55 CG 29 1 Y 1 A PHE 54 ? CD1 ? A PHE 55 CD1 30 1 Y 1 A PHE 54 ? CD2 ? A PHE 55 CD2 31 1 Y 1 A PHE 54 ? CE1 ? A PHE 55 CE1 32 1 Y 1 A PHE 54 ? CE2 ? A PHE 55 CE2 33 1 Y 1 A PHE 54 ? CZ ? A PHE 55 CZ 34 1 Y 1 A GLU 64 ? CG ? A GLU 65 CG 35 1 Y 1 A GLU 64 ? CD ? A GLU 65 CD 36 1 Y 1 A GLU 64 ? OE1 ? A GLU 65 OE1 37 1 Y 1 A GLU 64 ? OE2 ? A GLU 65 OE2 38 1 Y 1 A LYS 78 ? CD ? A LYS 79 CD 39 1 Y 1 A LYS 78 ? CE ? A LYS 79 CE 40 1 Y 1 A LYS 78 ? NZ ? A LYS 79 NZ 41 1 Y 1 A LYS 81 ? CD ? A LYS 82 CD 42 1 Y 1 A LYS 81 ? CE ? A LYS 82 CE 43 1 Y 1 A LYS 81 ? NZ ? A LYS 82 NZ 44 1 Y 1 A LYS 105 ? CD ? A LYS 106 CD 45 1 Y 1 A LYS 105 ? CE ? A LYS 106 CE 46 1 Y 1 A LYS 105 ? NZ ? A LYS 106 NZ 47 1 Y 1 A LYS 192 ? CG ? A LYS 193 CG 48 1 Y 1 A LYS 192 ? CD ? A LYS 193 CD 49 1 Y 1 A LYS 192 ? CE ? A LYS 193 CE 50 1 Y 1 A LYS 192 ? NZ ? A LYS 193 NZ 51 1 Y 1 A LYS 213 ? CD ? A LYS 214 CD 52 1 Y 1 A LYS 213 ? CE ? A LYS 214 CE 53 1 Y 1 A LYS 213 ? NZ ? A LYS 214 NZ 54 1 Y 1 A LYS 217 ? CD ? A LYS 218 CD 55 1 Y 1 A LYS 217 ? CE ? A LYS 218 CE 56 1 Y 1 A LYS 217 ? NZ ? A LYS 218 NZ 57 1 Y 1 A ILE 244 ? CG1 ? A ILE 245 CG1 58 1 Y 1 A ILE 244 ? CG2 ? A ILE 245 CG2 59 1 Y 1 A ILE 244 ? CD1 ? A ILE 245 CD1 60 1 Y 1 A GLU 248 ? CD ? A GLU 249 CD 61 1 Y 1 A GLU 248 ? OE1 ? A GLU 249 OE1 62 1 Y 1 A GLU 248 ? OE2 ? A GLU 249 OE2 63 1 Y 1 A LYS 254 ? CD ? A LYS 255 CD 64 1 Y 1 A LYS 254 ? CE ? A LYS 255 CE 65 1 Y 1 A LYS 254 ? NZ ? A LYS 255 NZ 66 1 Y 1 A ARG 256 ? CG ? A ARG 257 CG 67 1 Y 1 A ARG 256 ? CD ? A ARG 257 CD 68 1 Y 1 A ARG 256 ? NE ? A ARG 257 NE 69 1 Y 1 A ARG 256 ? CZ ? A ARG 257 CZ 70 1 Y 1 A ARG 256 ? NH1 ? A ARG 257 NH1 71 1 Y 1 A ARG 256 ? NH2 ? A ARG 257 NH2 72 1 Y 1 A LYS 279 ? CG ? A LYS 280 CG 73 1 Y 1 A LYS 279 ? CD ? A LYS 280 CD 74 1 Y 1 A LYS 279 ? CE ? A LYS 280 CE 75 1 Y 1 A LYS 279 ? NZ ? A LYS 280 NZ 76 1 Y 1 A LYS 285 ? CG ? A LYS 286 CG 77 1 Y 1 A LYS 285 ? CD ? A LYS 286 CD 78 1 Y 1 A LYS 285 ? CE ? A LYS 286 CE 79 1 Y 1 A LYS 285 ? NZ ? A LYS 286 NZ 80 1 Y 1 A LYS 295 ? CD ? A LYS 296 CD 81 1 Y 1 A LYS 295 ? CE ? A LYS 296 CE 82 1 Y 1 A LYS 295 ? NZ ? A LYS 296 NZ 83 1 Y 1 A LYS 317 ? CG ? A LYS 318 CG 84 1 Y 1 A LYS 317 ? CD ? A LYS 318 CD 85 1 Y 1 A LYS 317 ? CE ? A LYS 318 CE 86 1 Y 1 A LYS 317 ? NZ ? A LYS 318 NZ 87 1 Y 1 A PHE 318 ? CG ? A PHE 319 CG 88 1 Y 1 A PHE 318 ? CD1 ? A PHE 319 CD1 89 1 Y 1 A PHE 318 ? CD2 ? A PHE 319 CD2 90 1 Y 1 A PHE 318 ? CE1 ? A PHE 319 CE1 91 1 Y 1 A PHE 318 ? CE2 ? A PHE 319 CE2 92 1 Y 1 A PHE 318 ? CZ ? A PHE 319 CZ 93 1 Y 1 A LYS 319 ? CG ? A LYS 320 CG 94 1 Y 1 A LYS 319 ? CD ? A LYS 320 CD 95 1 Y 1 A LYS 319 ? CE ? A LYS 320 CE 96 1 Y 1 A LYS 319 ? NZ ? A LYS 320 NZ 97 1 Y 1 A GLU 331 ? CG ? A GLU 332 CG 98 1 Y 1 A GLU 331 ? CD ? A GLU 332 CD 99 1 Y 1 A GLU 331 ? OE1 ? A GLU 332 OE1 100 1 Y 1 A GLU 331 ? OE2 ? A GLU 332 OE2 101 1 Y 1 A GLU 334 ? CG ? A GLU 335 CG 102 1 Y 1 A GLU 334 ? CD ? A GLU 335 CD 103 1 Y 1 A GLU 334 ? OE1 ? A GLU 335 OE1 104 1 Y 1 A GLU 334 ? OE2 ? A GLU 335 OE2 105 1 Y 1 A LYS 345 ? CD ? A LYS 346 CD 106 1 Y 1 A LYS 345 ? CE ? A LYS 346 CE 107 1 Y 1 A LYS 345 ? NZ ? A LYS 346 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 0 ? A MET 1 2 1 Y 1 A GLY 1 ? A GLY 2 3 1 Y 1 A ASN 2 ? A ASN 3 4 1 Y 1 A ALA 3 ? A ALA 4 5 1 Y 1 A ALA 4 ? A ALA 5 6 1 Y 1 A ALA 5 ? A ALA 6 7 1 Y 1 A ALA 6 ? A ALA 7 8 1 Y 1 A LYS 7 ? A LYS 8 9 1 Y 1 A LYS 8 ? A LYS 9 10 1 Y 1 A GLY 9 ? A GLY 10 11 1 Y 1 A SEP 10 ? A SEP 11 # _pdbx_audit_support.funding_organization 'Loewe Corporation' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier RIP 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DRibpb RIP 'COMMON NAME' GMML 1.0 b-D-ribopyranose RIP 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Ribp RIP 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Rib # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 '(4S)-2-METHYL-2,4-PENTANEDIOL' MPD 4 '5-(1,4-DIAZEPAN-1-SULFONYL)ISOQUINOLINE' M77 5 beta-D-ribopyranose RIP 6 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #