data_5NYN # _entry.id 5NYN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.292 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5NYN WWPDB D_1200004790 # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 5NYK PDB 'Crystal structure of the atypical poplar thioredoxin-like2.1 in oxidized state' unspecified 5NYL PDB 'Crystal structure of an atypical poplar thioredoxin-like2.1 active site mutant' unspecified 5NYM PDB 'Crystal structure of the atypical poplar thioredoxin-like2.1 in reduced state' unspecified 5NYO PDB 'Crystal structure of an atypical poplar thioredoxin-like2.1 variant in dimeric form' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5NYN _pdbx_database_status.recvd_initial_deposition_date 2017-05-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Chibani, K.' 1 ? 'Saul, F.A.' 2 ? 'Haouz, A.' 3 ? 'Rouhier, N.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country NE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'FEBS Lett.' _citation.journal_id_ASTM FEBLAL _citation.journal_id_CSD 0165 _citation.journal_id_ISSN 1873-3468 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 592 _citation.language ? _citation.page_first 1030 _citation.page_last 1041 _citation.title 'Structural snapshots along the reaction mechanism of the atypical poplar thioredoxin-like2.1.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/1873-3468.13009 _citation.pdbx_database_id_PubMed 29453875 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Chibani, K.' 1 primary 'Saul, F.' 2 primary 'Didierjean, C.' 3 primary 'Rouhier, N.' 4 primary 'Haouz, A.' 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5NYN _cell.details ? _cell.formula_units_Z ? _cell.length_a 46.708 _cell.length_a_esd ? _cell.length_b 52.146 _cell.length_b_esd ? _cell.length_c 59.776 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5NYN _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Thioredoxin-like protein 2.1' 14190.775 1 ? ? ? ? 2 non-polymer syn GLUTATHIONE 307.323 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 4 water nat water 18.015 165 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MATRPTSVEMEPIDDSHHLDKILLQARELSQPIIIDWMASWCRKCIYLKPKLEKLAAEYDTKIKFYCADVNKVPQALVKR GNISKMPTIQLWKDGEMKAEVIGGHKAWLVIEEVREMIQKFV ; _entity_poly.pdbx_seq_one_letter_code_can ;MATRPTSVEMEPIDDSHHLDKILLQARELSQPIIIDWMASWCRKCIYLKPKLEKLAAEYDTKIKFYCADVNKVPQALVKR GNISKMPTIQLWKDGEMKAEVIGGHKAWLVIEEVREMIQKFV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 THR n 1 4 ARG n 1 5 PRO n 1 6 THR n 1 7 SER n 1 8 VAL n 1 9 GLU n 1 10 MET n 1 11 GLU n 1 12 PRO n 1 13 ILE n 1 14 ASP n 1 15 ASP n 1 16 SER n 1 17 HIS n 1 18 HIS n 1 19 LEU n 1 20 ASP n 1 21 LYS n 1 22 ILE n 1 23 LEU n 1 24 LEU n 1 25 GLN n 1 26 ALA n 1 27 ARG n 1 28 GLU n 1 29 LEU n 1 30 SER n 1 31 GLN n 1 32 PRO n 1 33 ILE n 1 34 ILE n 1 35 ILE n 1 36 ASP n 1 37 TRP n 1 38 MET n 1 39 ALA n 1 40 SER n 1 41 TRP n 1 42 CYS n 1 43 ARG n 1 44 LYS n 1 45 CYS n 1 46 ILE n 1 47 TYR n 1 48 LEU n 1 49 LYS n 1 50 PRO n 1 51 LYS n 1 52 LEU n 1 53 GLU n 1 54 LYS n 1 55 LEU n 1 56 ALA n 1 57 ALA n 1 58 GLU n 1 59 TYR n 1 60 ASP n 1 61 THR n 1 62 LYS n 1 63 ILE n 1 64 LYS n 1 65 PHE n 1 66 TYR n 1 67 CYS n 1 68 ALA n 1 69 ASP n 1 70 VAL n 1 71 ASN n 1 72 LYS n 1 73 VAL n 1 74 PRO n 1 75 GLN n 1 76 ALA n 1 77 LEU n 1 78 VAL n 1 79 LYS n 1 80 ARG n 1 81 GLY n 1 82 ASN n 1 83 ILE n 1 84 SER n 1 85 LYS n 1 86 MET n 1 87 PRO n 1 88 THR n 1 89 ILE n 1 90 GLN n 1 91 LEU n 1 92 TRP n 1 93 LYS n 1 94 ASP n 1 95 GLY n 1 96 GLU n 1 97 MET n 1 98 LYS n 1 99 ALA n 1 100 GLU n 1 101 VAL n 1 102 ILE n 1 103 GLY n 1 104 GLY n 1 105 HIS n 1 106 LYS n 1 107 ALA n 1 108 TRP n 1 109 LEU n 1 110 VAL n 1 111 ILE n 1 112 GLU n 1 113 GLU n 1 114 VAL n 1 115 ARG n 1 116 GLU n 1 117 MET n 1 118 ILE n 1 119 GLN n 1 120 LYS n 1 121 PHE n 1 122 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 122 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Populus tremula x Populus tremuloides' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 47664 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type 'pET system' _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details 'T7 expression system' _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET3d _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code I0BZV0_9ROSI _struct_ref.pdbx_db_accession I0BZV0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TRPTSVEMEPIDDSHHLDKILLQARELSQPIIIDWMASWCRKCIYLKPKLEKLAAEYDTKIKFYCADVNKVPQALVKRGN ISKMPTIQLWKDGEMKAEVIGGHKAWLVIEEVREMIQKFV ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5NYN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 122 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession I0BZV0 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 121 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 122 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5NYN MET A 1 ? UNP I0BZV0 ? ? 'initiating methionine' 1 1 1 5NYN ALA A 2 ? UNP I0BZV0 ? ? 'expression tag' 2 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GSH non-polymer . GLUTATHIONE ? 'C10 H17 N3 O6 S' 307.323 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5NYN _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.58 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 52.34 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M Na acetate, 0.2M lithium sulfate, 0.1M hepes7.5, 25% (w/v) PEG3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 110 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2011-11-25 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.95373 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SOLEIL BEAMLINE PROXIMA 1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.95373 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'PROXIMA 1' _diffrn_source.pdbx_synchrotron_site SOLEIL # _reflns.B_iso_Wilson_estimate 21.02 _reflns.entry_id 5NYN _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.60 _reflns.d_resolution_low 46.7 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 19810 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.6 _reflns.pdbx_Rmerge_I_obs 0.057 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.039 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.60 _reflns_shell.d_res_low 1.63 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.0 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 984 _reflns_shell.percent_possible_all 100.0 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.763 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.3 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.548 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.694 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 1.6047 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] -4.5940 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 2.9893 _refine.B_iso_max ? _refine.B_iso_mean 23.83 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.9572 _refine.correlation_coeff_Fo_to_Fc_free 0.9372 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5NYN _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.60 _refine.ls_d_res_low 16.40 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 19506 _refine.ls_number_reflns_R_free 1017 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.26 _refine.ls_percent_reflns_R_free 5.21 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1659 _refine.ls_R_factor_R_free 0.1902 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1646 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.075 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.081 _refine.pdbx_overall_SU_R_Blow_DPI 0.083 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.088 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 5NYN _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.182 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 1004 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 19 _refine_hist.number_atoms_solvent 165 _refine_hist.number_atoms_total 1188 _refine_hist.d_res_high 1.60 _refine_hist.d_res_low 16.40 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 ? 2090 ? t_bond_d 2.00 HARMONIC 'X-RAY DIFFRACTION' ? 1.06 ? 3811 ? t_angle_deg 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 475 ? t_dihedral_angle_d 2.00 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? ? ? t_incorr_chiral_ct ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? 25 ? t_trig_c_planes 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 294 ? t_gen_planes 5.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 2090 ? t_it 20.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ? 'X-RAY DIFFRACTION' ? 4.23 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 13.08 ? ? ? t_other_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 134 ? t_chiral_improper_torsion 5.00 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 2281 ? t_ideal_dist_contact 4.00 SEMIHARMONIC # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.60 _refine_ls_shell.d_res_low 1.69 _refine_ls_shell.number_reflns_all 2614 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 155 _refine_ls_shell.number_reflns_R_work 2459 _refine_ls_shell.percent_reflns_obs 91.62 _refine_ls_shell.percent_reflns_R_free 5.93 _refine_ls_shell.R_factor_all 0.1934 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2183 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.1917 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 10 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5NYN _struct.title 'Crystal structure of the atypical poplar thioredoxin-like2.1 in complex with gluathione' _struct.pdbx_descriptor 'Thioredoxin-like protein 2.1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5NYN _struct_keywords.text 'atypical thioredoxin, disulfide exchange, oxidoreductase' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 15 ? SER A 30 ? ASP A 15 SER A 30 1 ? 16 HELX_P HELX_P2 AA2 CYS A 42 ? TYR A 59 ? CYS A 42 TYR A 59 1 ? 18 HELX_P HELX_P3 AA3 PRO A 74 ? ASN A 82 ? PRO A 74 ASN A 82 1 ? 9 HELX_P HELX_P4 AA4 LYS A 106 ? VAL A 122 ? LYS A 106 VAL A 122 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag one _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 67 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id GSH _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id SG2 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 67 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id GSH _struct_conn.ptnr2_auth_seq_id 201 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.115 _struct_conn.pdbx_value_order ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id MET _struct_mon_prot_cis.label_seq_id 86 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id MET _struct_mon_prot_cis.auth_seq_id 86 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 87 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 87 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -10.63 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 11 ? PRO A 12 ? GLU A 11 PRO A 12 AA1 2 LYS A 64 ? ASP A 69 ? LYS A 64 ASP A 69 AA1 3 ILE A 33 ? MET A 38 ? ILE A 33 MET A 38 AA1 4 THR A 88 ? LYS A 93 ? THR A 88 LYS A 93 AA1 5 GLU A 96 ? ILE A 102 ? GLU A 96 ILE A 102 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 11 ? N GLU A 11 O PHE A 65 ? O PHE A 65 AA1 2 3 O TYR A 66 ? O TYR A 66 N ILE A 34 ? N ILE A 34 AA1 3 4 N TRP A 37 ? N TRP A 37 O THR A 88 ? O THR A 88 AA1 4 5 N ILE A 89 ? N ILE A 89 O VAL A 101 ? O VAL A 101 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A GSH 201 ? 8 'binding site for residue GSH A 201' AC2 Software A SO4 202 ? 3 'binding site for residue SO4 A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 PRO A 12 ? PRO A 12 . ? 1_555 ? 2 AC1 8 LYS A 49 ? LYS A 49 . ? 1_555 ? 3 AC1 8 CYS A 67 ? CYS A 67 . ? 1_555 ? 4 AC1 8 ALA A 68 ? ALA A 68 . ? 1_555 ? 5 AC1 8 LYS A 72 ? LYS A 72 . ? 1_555 ? 6 AC1 8 HOH D . ? HOH A 319 . ? 1_555 ? 7 AC1 8 HOH D . ? HOH A 380 . ? 1_555 ? 8 AC1 8 HOH D . ? HOH A 397 . ? 1_555 ? 9 AC2 3 PRO A 74 ? PRO A 74 . ? 1_555 ? 10 AC2 3 GLN A 75 ? GLN A 75 . ? 1_555 ? 11 AC2 3 HOH D . ? HOH A 305 . ? 1_555 ? # _atom_sites.entry_id 5NYN _atom_sites.fract_transf_matrix[1][1] 0.021410 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019177 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016729 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 THR 3 3 ? ? ? A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 MET 10 10 10 MET MET A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 HIS 18 18 18 HIS HIS A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 TRP 37 37 37 TRP TRP A . n A 1 38 MET 38 38 38 MET MET A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 TRP 41 41 41 TRP TRP A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 TYR 66 66 66 TYR TYR A . n A 1 67 CYS 67 67 67 CYS CYS A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 MET 86 86 86 MET MET A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 TRP 92 92 92 TRP TRP A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 MET 97 97 97 MET MET A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 HIS 105 105 105 HIS HIS A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 TRP 108 108 108 TRP TRP A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 ILE 111 111 111 ILE ILE A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 ARG 115 115 115 ARG ARG A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 MET 117 117 117 MET MET A . n A 1 118 ILE 118 118 118 ILE ILE A . n A 1 119 GLN 119 119 119 GLN GLN A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 PHE 121 121 121 PHE PHE A . n A 1 122 VAL 122 122 122 VAL VAL A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GSH 1 201 201 GSH GSH A . C 3 SO4 1 202 202 SO4 SO4 A . D 4 HOH 1 301 152 HOH HOH A . D 4 HOH 2 302 82 HOH HOH A . D 4 HOH 3 303 65 HOH HOH A . D 4 HOH 4 304 95 HOH HOH A . D 4 HOH 5 305 62 HOH HOH A . D 4 HOH 6 306 49 HOH HOH A . D 4 HOH 7 307 36 HOH HOH A . D 4 HOH 8 308 148 HOH HOH A . D 4 HOH 9 309 141 HOH HOH A . D 4 HOH 10 310 25 HOH HOH A . D 4 HOH 11 311 76 HOH HOH A . D 4 HOH 12 312 35 HOH HOH A . D 4 HOH 13 313 7 HOH HOH A . D 4 HOH 14 314 88 HOH HOH A . D 4 HOH 15 315 91 HOH HOH A . D 4 HOH 16 316 106 HOH HOH A . D 4 HOH 17 317 116 HOH HOH A . D 4 HOH 18 318 28 HOH HOH A . D 4 HOH 19 319 94 HOH HOH A . D 4 HOH 20 320 160 HOH HOH A . D 4 HOH 21 321 70 HOH HOH A . D 4 HOH 22 322 115 HOH HOH A . D 4 HOH 23 323 77 HOH HOH A . D 4 HOH 24 324 79 HOH HOH A . D 4 HOH 25 325 92 HOH HOH A . D 4 HOH 26 326 72 HOH HOH A . D 4 HOH 27 327 81 HOH HOH A . D 4 HOH 28 328 27 HOH HOH A . D 4 HOH 29 329 21 HOH HOH A . D 4 HOH 30 330 58 HOH HOH A . D 4 HOH 31 331 63 HOH HOH A . D 4 HOH 32 332 23 HOH HOH A . D 4 HOH 33 333 12 HOH HOH A . D 4 HOH 34 334 9 HOH HOH A . D 4 HOH 35 335 20 HOH HOH A . D 4 HOH 36 336 15 HOH HOH A . D 4 HOH 37 337 5 HOH HOH A . D 4 HOH 38 338 150 HOH HOH A . D 4 HOH 39 339 61 HOH HOH A . D 4 HOH 40 340 80 HOH HOH A . D 4 HOH 41 341 111 HOH HOH A . D 4 HOH 42 342 29 HOH HOH A . D 4 HOH 43 343 69 HOH HOH A . D 4 HOH 44 344 39 HOH HOH A . D 4 HOH 45 345 30 HOH HOH A . D 4 HOH 46 346 13 HOH HOH A . D 4 HOH 47 347 66 HOH HOH A . D 4 HOH 48 348 37 HOH HOH A . D 4 HOH 49 349 93 HOH HOH A . D 4 HOH 50 350 143 HOH HOH A . D 4 HOH 51 351 98 HOH HOH A . D 4 HOH 52 352 54 HOH HOH A . D 4 HOH 53 353 22 HOH HOH A . D 4 HOH 54 354 40 HOH HOH A . D 4 HOH 55 355 59 HOH HOH A . D 4 HOH 56 356 132 HOH HOH A . D 4 HOH 57 357 18 HOH HOH A . D 4 HOH 58 358 46 HOH HOH A . D 4 HOH 59 359 2 HOH HOH A . D 4 HOH 60 360 3 HOH HOH A . D 4 HOH 61 361 53 HOH HOH A . D 4 HOH 62 362 33 HOH HOH A . D 4 HOH 63 363 168 HOH HOH A . D 4 HOH 64 364 102 HOH HOH A . D 4 HOH 65 365 52 HOH HOH A . D 4 HOH 66 366 43 HOH HOH A . D 4 HOH 67 367 73 HOH HOH A . D 4 HOH 68 368 10 HOH HOH A . D 4 HOH 69 369 167 HOH HOH A . D 4 HOH 70 370 129 HOH HOH A . D 4 HOH 71 371 71 HOH HOH A . D 4 HOH 72 372 50 HOH HOH A . D 4 HOH 73 373 174 HOH HOH A . D 4 HOH 74 374 11 HOH HOH A . D 4 HOH 75 375 139 HOH HOH A . D 4 HOH 76 376 87 HOH HOH A . D 4 HOH 77 377 19 HOH HOH A . D 4 HOH 78 378 26 HOH HOH A . D 4 HOH 79 379 8 HOH HOH A . D 4 HOH 80 380 107 HOH HOH A . D 4 HOH 81 381 165 HOH HOH A . D 4 HOH 82 382 14 HOH HOH A . D 4 HOH 83 383 140 HOH HOH A . D 4 HOH 84 384 67 HOH HOH A . D 4 HOH 85 385 97 HOH HOH A . D 4 HOH 86 386 42 HOH HOH A . D 4 HOH 87 387 31 HOH HOH A . D 4 HOH 88 388 161 HOH HOH A . D 4 HOH 89 389 16 HOH HOH A . D 4 HOH 90 390 85 HOH HOH A . D 4 HOH 91 391 45 HOH HOH A . D 4 HOH 92 392 128 HOH HOH A . D 4 HOH 93 393 38 HOH HOH A . D 4 HOH 94 394 90 HOH HOH A . D 4 HOH 95 395 125 HOH HOH A . D 4 HOH 96 396 6 HOH HOH A . D 4 HOH 97 397 144 HOH HOH A . D 4 HOH 98 398 57 HOH HOH A . D 4 HOH 99 399 103 HOH HOH A . D 4 HOH 100 400 17 HOH HOH A . D 4 HOH 101 401 169 HOH HOH A . D 4 HOH 102 402 34 HOH HOH A . D 4 HOH 103 403 145 HOH HOH A . D 4 HOH 104 404 44 HOH HOH A . D 4 HOH 105 405 104 HOH HOH A . D 4 HOH 106 406 51 HOH HOH A . D 4 HOH 107 407 74 HOH HOH A . D 4 HOH 108 408 1 HOH HOH A . D 4 HOH 109 409 110 HOH HOH A . D 4 HOH 110 410 151 HOH HOH A . D 4 HOH 111 411 171 HOH HOH A . D 4 HOH 112 412 86 HOH HOH A . D 4 HOH 113 413 131 HOH HOH A . D 4 HOH 114 414 123 HOH HOH A . D 4 HOH 115 415 4 HOH HOH A . D 4 HOH 116 416 24 HOH HOH A . D 4 HOH 117 417 47 HOH HOH A . D 4 HOH 118 418 55 HOH HOH A . D 4 HOH 119 419 156 HOH HOH A . D 4 HOH 120 420 153 HOH HOH A . D 4 HOH 121 421 113 HOH HOH A . D 4 HOH 122 422 83 HOH HOH A . D 4 HOH 123 423 162 HOH HOH A . D 4 HOH 124 424 149 HOH HOH A . D 4 HOH 125 425 78 HOH HOH A . D 4 HOH 126 426 121 HOH HOH A . D 4 HOH 127 427 130 HOH HOH A . D 4 HOH 128 428 109 HOH HOH A . D 4 HOH 129 429 84 HOH HOH A . D 4 HOH 130 430 172 HOH HOH A . D 4 HOH 131 431 127 HOH HOH A . D 4 HOH 132 432 175 HOH HOH A . D 4 HOH 133 433 147 HOH HOH A . D 4 HOH 134 434 164 HOH HOH A . D 4 HOH 135 435 154 HOH HOH A . D 4 HOH 136 436 41 HOH HOH A . D 4 HOH 137 437 135 HOH HOH A . D 4 HOH 138 438 101 HOH HOH A . D 4 HOH 139 439 96 HOH HOH A . D 4 HOH 140 440 68 HOH HOH A . D 4 HOH 141 441 122 HOH HOH A . D 4 HOH 142 442 158 HOH HOH A . D 4 HOH 143 443 64 HOH HOH A . D 4 HOH 144 444 142 HOH HOH A . D 4 HOH 145 445 56 HOH HOH A . D 4 HOH 146 446 89 HOH HOH A . D 4 HOH 147 447 146 HOH HOH A . D 4 HOH 148 448 126 HOH HOH A . D 4 HOH 149 449 48 HOH HOH A . D 4 HOH 150 450 117 HOH HOH A . D 4 HOH 151 451 32 HOH HOH A . D 4 HOH 152 452 170 HOH HOH A . D 4 HOH 153 453 100 HOH HOH A . D 4 HOH 154 454 75 HOH HOH A . D 4 HOH 155 455 136 HOH HOH A . D 4 HOH 156 456 60 HOH HOH A . D 4 HOH 157 457 105 HOH HOH A . D 4 HOH 158 458 134 HOH HOH A . D 4 HOH 159 459 112 HOH HOH A . D 4 HOH 160 460 99 HOH HOH A . D 4 HOH 161 461 138 HOH HOH A . D 4 HOH 162 462 166 HOH HOH A . D 4 HOH 163 463 114 HOH HOH A . D 4 HOH 164 464 120 HOH HOH A . D 4 HOH 165 465 159 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 510 ? 1 MORE -12 ? 1 'SSA (A^2)' 7000 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-02-28 2 'Structure model' 1 1 2018-04-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.10.2 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id THR _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 61 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 75.07 _pdbx_validate_torsion.psi -5.96 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 N 1 A GSH 201 ? N1 ? B GSH 1 N1 2 1 N 1 A GSH 201 ? CA1 ? B GSH 1 CA1 3 1 N 1 A GSH 201 ? C1 ? B GSH 1 C1 4 1 N 1 A GSH 201 ? O11 ? B GSH 1 O11 5 1 N 1 A GSH 201 ? O12 ? B GSH 1 O12 6 1 N 1 A GSH 201 ? CB1 ? B GSH 1 CB1 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A THR 3 ? A THR 3 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'INRA-FORMAS program' France ? 1 'Institut Pasteur' France ? 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 GLUTATHIONE GSH 3 'SULFATE ION' SO4 4 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #