data_5O2V # _entry.id 5O2V # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5O2V pdb_00005o2v 10.2210/pdb5o2v/pdb WWPDB D_1200005072 ? ? BMRB 34144 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'NMR structure of TIA-1 RRM1 domain' _pdbx_database_related.db_id 34144 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5O2V _pdbx_database_status.recvd_initial_deposition_date 2017-05-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _audit_author.name 'Jagtap, P.K.A.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0002-9457-4130 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country GE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Angew. Chem. Int. Ed. Engl.' _citation.journal_id_ASTM ACIEAY _citation.journal_id_CSD 0179 _citation.journal_id_ISSN 1521-3773 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 56 _citation.language ? _citation.page_first 9322 _citation.page_last 9325 _citation.title 'Segmental, Domain-Selective Perdeuteration and Small-Angle Neutron Scattering for Structural Analysis of Multi-Domain Proteins.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/anie.201702904 _citation.pdbx_database_id_PubMed 28636238 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sonntag, M.' 1 ? primary 'Jagtap, P.K.A.' 2 ? primary 'Simon, B.' 3 ? primary 'Appavou, M.S.' 4 ? primary 'Geerlof, A.' 5 ? primary 'Stehle, R.' 6 ? primary 'Gabel, F.' 7 ? primary 'Hennig, J.' 8 ? primary 'Sattler, M.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Nucleolysin TIA-1 isoform p40' _entity.formula_weight 10275.843 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'RRM1 domain, UNP residues 1-92' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RNA-binding protein TIA-1,T-cell-restricted intracellular antigen-1,TIA-1,p40-TIA-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNW ATTPSSQKKDTS ; _entity_poly.pdbx_seq_one_letter_code_can ;MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNW ATTPSSQKKDTS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 ASP n 1 4 GLU n 1 5 MET n 1 6 PRO n 1 7 LYS n 1 8 THR n 1 9 LEU n 1 10 TYR n 1 11 VAL n 1 12 GLY n 1 13 ASN n 1 14 LEU n 1 15 SER n 1 16 ARG n 1 17 ASP n 1 18 VAL n 1 19 THR n 1 20 GLU n 1 21 ALA n 1 22 LEU n 1 23 ILE n 1 24 LEU n 1 25 GLN n 1 26 LEU n 1 27 PHE n 1 28 SER n 1 29 GLN n 1 30 ILE n 1 31 GLY n 1 32 PRO n 1 33 CYS n 1 34 LYS n 1 35 ASN n 1 36 CYS n 1 37 LYS n 1 38 MET n 1 39 ILE n 1 40 MET n 1 41 ASP n 1 42 THR n 1 43 ALA n 1 44 GLY n 1 45 ASN n 1 46 ASP n 1 47 PRO n 1 48 TYR n 1 49 CYS n 1 50 PHE n 1 51 VAL n 1 52 GLU n 1 53 PHE n 1 54 HIS n 1 55 GLU n 1 56 HIS n 1 57 ARG n 1 58 HIS n 1 59 ALA n 1 60 ALA n 1 61 ALA n 1 62 ALA n 1 63 LEU n 1 64 ALA n 1 65 ALA n 1 66 MET n 1 67 ASN n 1 68 GLY n 1 69 ARG n 1 70 LYS n 1 71 ILE n 1 72 MET n 1 73 GLY n 1 74 LYS n 1 75 GLU n 1 76 VAL n 1 77 LYS n 1 78 VAL n 1 79 ASN n 1 80 TRP n 1 81 ALA n 1 82 THR n 1 83 THR n 1 84 PRO n 1 85 SER n 1 86 SER n 1 87 GLN n 1 88 LYS n 1 89 LYS n 1 90 ASP n 1 91 THR n 1 92 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 92 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene TIA1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TIA1_HUMAN _struct_ref.pdbx_db_accession P31483 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNW ATTPSSQKKDTS ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5O2V _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 92 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P31483 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 92 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 92 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 2 '2D 1H-15N HSQC' 2 isotropic 3 1 1 '3D 1H-15N NOESY' 2 isotropic 4 1 1 '2D 1H-13C HSQC aliphatic' 2 isotropic 5 1 1 '2D 1H-13C HSQC aromatic' 2 isotropic 6 1 1 '3D 1H-13C NOESY aliphatic' 2 isotropic 7 1 1 '3D 1H-13C NOESY aromatic' 2 isotropic 8 1 1 '3D HCCH-TOCSY' 1 isotropic 9 1 1 '3D HNCACB' 2 isotropic 10 1 1 '3D HNCO' 2 isotropic 11 1 1 '3D CBCA(CO)NH' 2 isotropic 12 1 1 '3D HNCA' 2 isotropic 13 1 1 '3D HBHA(CO)NH' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.details '50mM phosphate buffer, 100mM NaCl, 1mM DTT' _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label Condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.5 mM Uniform 15N, 13C labelling Protein, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N_13C_RRM1 solution ? 2 '0.5 mM Uniform 15N labelling Protein, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N_RRM1 solution ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 800 ? 2 'AVANCE III' ? Bruker 600 ? # _pdbx_nmr_refine.entry_id 5O2V _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 5 # _pdbx_nmr_ensemble.entry_id 5O2V _pdbx_nmr_ensemble.conformers_calculated_total_number 40 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5O2V _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 5 refinement ARIA ? ;Linge, O'Donoghue and Nilges ; 4 collection TopSpin ? 'Bruker Biospin' 6 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 7 'peak picking' 'CcpNmr Analysis' ? CCPN 8 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5O2V _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5O2V _struct.title 'NMR structure of TIA-1 RRM1 domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5O2V _struct_keywords.text 'RRM, TIA-1, RNA binding protein' _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 MET A 1 ? MET A 5 ? MET A 1 MET A 5 5 ? 5 HELX_P HELX_P2 AA2 THR A 19 ? GLN A 29 ? THR A 19 GLN A 29 1 ? 11 HELX_P HELX_P3 AA3 GLU A 55 ? ASN A 67 ? GLU A 55 ASN A 67 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 CYS A 33 ? ILE A 39 ? CYS A 33 ILE A 39 AA1 2 TYR A 48 ? PHE A 53 ? TYR A 48 PHE A 53 AA1 3 THR A 8 ? GLY A 12 ? THR A 8 GLY A 12 AA1 4 LYS A 77 ? ALA A 81 ? LYS A 77 ALA A 81 AA2 1 LYS A 70 ? ILE A 71 ? LYS A 70 ILE A 71 AA2 2 LYS A 74 ? GLU A 75 ? LYS A 74 GLU A 75 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LYS A 34 ? N LYS A 34 O GLU A 52 ? O GLU A 52 AA1 2 3 O VAL A 51 ? O VAL A 51 N LEU A 9 ? N LEU A 9 AA1 3 4 N TYR A 10 ? N TYR A 10 O ASN A 79 ? O ASN A 79 AA2 1 2 N ILE A 71 ? N ILE A 71 O LYS A 74 ? O LYS A 74 # _atom_sites.entry_id 5O2V _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 MET 5 5 5 MET MET A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 MET 38 38 38 MET MET A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 MET 40 40 40 MET MET A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 HIS 54 54 54 HIS HIS A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 HIS 58 58 58 HIS HIS A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 MET 66 66 66 MET MET A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 MET 72 72 72 MET MET A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 TRP 80 80 80 TRP TRP A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 SER 92 92 92 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 6300 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-06-28 2 'Structure model' 1 1 2017-07-05 3 'Structure model' 1 2 2017-08-09 4 'Structure model' 1 3 2019-05-08 5 'Structure model' 1 4 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 5 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' pdbx_nmr_software 6 5 'Structure model' database_2 7 5 'Structure model' pdbx_database_status 8 5 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.pdbx_database_id_PubMed' 6 2 'Structure model' '_citation.title' 7 2 'Structure model' '_citation_author.name' 8 3 'Structure model' '_citation.journal_volume' 9 3 'Structure model' '_citation.page_first' 10 3 'Structure model' '_citation.page_last' 11 3 'Structure model' '_citation.title' 12 3 'Structure model' '_citation_author.name' 13 4 'Structure model' '_pdbx_nmr_software.name' 14 5 'Structure model' '_database_2.pdbx_DOI' 15 5 'Structure model' '_database_2.pdbx_database_accession' 16 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' 17 5 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 Protein 0.5 ? mM 'Uniform 15N, 13C labelling' 2 Protein 0.5 ? mM 'Uniform 15N labelling' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HB2 A SER 15 ? ? HD2 A LYS 74 ? ? 1.35 2 1 HG A SER 15 ? ? OD2 A ASP 17 ? ? 1.55 3 6 OD1 A ASP 46 ? ? HZ2 A LYS 74 ? ? 1.60 4 10 HG1 A THR 8 ? ? HG3 A GLU 52 ? ? 1.27 5 17 OD2 A ASP 46 ? ? HZ3 A LYS 77 ? ? 1.59 6 18 OD2 A ASP 46 ? ? HZ3 A LYS 74 ? ? 1.59 7 19 H1 A MET 1 ? ? OD1 A ASP 3 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 5 ? ? -119.19 75.69 2 1 ASN A 13 ? ? 72.80 30.80 3 1 MET A 72 ? ? 66.71 -77.21 4 1 GLN A 87 ? ? 61.79 90.35 5 2 LYS A 7 ? ? 79.72 -26.12 6 2 ASN A 35 ? ? -171.86 147.75 7 2 ALA A 43 ? ? 78.24 145.60 8 2 MET A 72 ? ? 72.99 -50.45 9 2 SER A 86 ? ? -107.33 -67.96 10 3 LYS A 7 ? ? 73.66 -45.91 11 3 ASN A 13 ? ? 175.71 5.82 12 3 ASP A 90 ? ? 64.64 89.05 13 4 LYS A 7 ? ? 74.68 -46.58 14 4 ASN A 13 ? ? 71.53 59.77 15 4 THR A 82 ? ? -77.61 -162.47 16 4 PRO A 84 ? ? -66.89 69.92 17 4 LYS A 88 ? ? 60.47 76.93 18 5 LYS A 7 ? ? 75.54 -47.25 19 5 ALA A 43 ? ? -131.17 -51.70 20 5 MET A 72 ? ? 69.46 -64.35 21 5 LYS A 88 ? ? -151.12 -1.58 22 6 PRO A 6 ? ? -58.39 103.11 23 6 ASN A 13 ? ? 72.73 59.23 24 6 SER A 85 ? ? 68.12 -78.08 25 6 SER A 86 ? ? -146.47 10.11 26 6 GLN A 87 ? ? 65.98 178.72 27 7 LYS A 7 ? ? 73.17 -44.29 28 7 ASN A 13 ? ? 70.92 30.15 29 7 ASN A 45 ? ? -107.48 -88.79 30 7 MET A 72 ? ? 68.41 -80.04 31 7 LYS A 88 ? ? -166.80 89.47 32 8 ASN A 13 ? ? 73.03 40.53 33 8 ALA A 43 ? ? 179.65 174.41 34 8 PRO A 47 ? ? -47.05 155.05 35 8 PRO A 84 ? ? -62.06 95.13 36 8 LYS A 89 ? ? -137.06 -51.09 37 8 ASP A 90 ? ? -110.48 -161.29 38 8 THR A 91 ? ? 64.70 92.58 39 9 LYS A 7 ? ? 71.25 -14.94 40 9 ASP A 41 ? ? -102.12 -163.72 41 9 THR A 42 ? ? -67.36 1.90 42 9 ALA A 43 ? ? 75.71 -13.56 43 9 ASN A 45 ? ? -111.27 -140.42 44 9 MET A 72 ? ? 68.25 -71.42 45 9 SER A 85 ? ? -77.97 43.94 46 9 LYS A 88 ? ? 70.43 -48.36 47 10 LYS A 7 ? ? 73.82 -9.18 48 10 ASN A 13 ? ? 75.87 49.86 49 10 ALA A 43 ? ? -133.28 -33.51 50 10 PRO A 47 ? ? -38.17 132.31 51 10 PRO A 84 ? ? -79.14 33.23 52 10 LYS A 88 ? ? -91.54 54.67 53 11 LYS A 7 ? ? 70.61 -54.89 54 11 ALA A 43 ? ? -155.28 42.66 55 11 ASN A 45 ? ? 174.69 -56.54 56 11 MET A 72 ? ? 69.68 -72.37 57 11 PRO A 84 ? ? -64.03 88.14 58 11 THR A 91 ? ? -175.44 49.99 59 12 PRO A 6 ? ? -56.89 106.38 60 12 MET A 72 ? ? 66.00 -78.51 61 12 PRO A 84 ? ? -67.16 90.76 62 12 LYS A 89 ? ? 74.07 -48.99 63 13 ASN A 45 ? ? -127.24 -167.98 64 13 MET A 72 ? ? 66.51 -82.47 65 13 GLN A 87 ? ? -108.24 -81.81 66 14 ALA A 43 ? ? -90.53 -72.72 67 14 THR A 82 ? ? -83.58 -155.88 68 15 PRO A 6 ? ? -49.76 98.75 69 15 ALA A 43 ? ? -175.45 25.88 70 15 ASN A 45 ? ? 76.25 169.67 71 16 GLU A 4 ? ? -79.68 27.16 72 16 ALA A 43 ? ? -128.07 -75.72 73 16 MET A 72 ? ? 69.04 -5.03 74 17 PRO A 6 ? ? -56.35 109.80 75 17 ASN A 13 ? ? 177.87 -7.11 76 17 ASN A 45 ? ? 47.14 -168.05 77 17 GLN A 87 ? ? -170.10 -73.38 78 17 LYS A 88 ? ? -122.66 -69.68 79 18 ASN A 13 ? ? 74.35 54.49 80 18 ALA A 43 ? ? 177.98 54.53 81 18 ASN A 45 ? ? -160.21 -85.53 82 18 SER A 85 ? ? -107.58 50.26 83 18 SER A 86 ? ? 52.11 -94.73 84 18 GLN A 87 ? ? -68.27 93.59 85 19 ALA A 43 ? ? -173.45 -41.75 86 19 MET A 72 ? ? 69.07 -74.59 87 19 ALA A 81 ? ? -68.46 97.64 88 19 PRO A 84 ? ? -68.42 92.64 89 20 PRO A 6 ? ? -58.95 98.26 90 20 ASN A 13 ? ? 66.44 64.13 91 20 ALA A 43 ? ? -151.56 -26.05 92 20 PRO A 47 ? ? -39.64 135.10 93 20 MET A 72 ? ? 67.88 -74.73 94 20 THR A 82 ? ? -119.59 -149.72 95 20 PRO A 84 ? ? -53.16 95.41 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #