data_5O2Y
# 
_entry.id   5O2Y 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.392 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   5O2Y         pdb_00005o2y 10.2210/pdb5o2y/pdb 
WWPDB D_1200004535 ?            ?                   
BMRB  26919        ?            10.13018/BMR26919   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-10-18 
2 'Structure model' 1 1 2017-12-06 
3 'Structure model' 1 2 2019-05-08 
4 'Structure model' 1 3 2024-05-15 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Data collection'     
3 4 'Structure model' 'Data collection'     
4 4 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation              
2 2 'Structure model' citation_author       
3 3 'Structure model' pdbx_nmr_software     
4 4 'Structure model' chem_comp_atom        
5 4 'Structure model' chem_comp_bond        
6 4 'Structure model' database_2            
7 4 'Structure model' pdbx_nmr_spectrometer 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                   
2  2 'Structure model' '_citation.journal_abbrev'            
3  2 'Structure model' '_citation.journal_id_CSD'            
4  2 'Structure model' '_citation.journal_id_ISSN'           
5  2 'Structure model' '_citation.journal_volume'            
6  2 'Structure model' '_citation.page_first'                
7  2 'Structure model' '_citation.page_last'                 
8  2 'Structure model' '_citation.pdbx_database_id_DOI'      
9  2 'Structure model' '_citation.pdbx_database_id_PubMed'   
10 2 'Structure model' '_citation.title'                     
11 2 'Structure model' '_citation.year'                      
12 2 'Structure model' '_citation_author.name'               
13 3 'Structure model' '_pdbx_nmr_software.name'             
14 4 'Structure model' '_database_2.pdbx_DOI'                
15 4 'Structure model' '_database_2.pdbx_database_accession' 
16 4 'Structure model' '_pdbx_nmr_spectrometer.model'        
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.entry_id                        5O2Y 
_pdbx_database_status.recvd_initial_deposition_date   2017-05-23 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.details        . 
_pdbx_database_related.db_id          26919 
_pdbx_database_related.content_type   unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Lopez-Castilla, A.' 1  ? 
'Bardiaux, B.'       2  ? 
'Vitorge, B.'        3  ? 
'Thomassin, J.-L.'   4  ? 
'Zheng, W.'          5  ? 
'Yu, X.'             6  ? 
'Egelman, E.H.'      7  ? 
'Nilges, M.'         8  ? 
'Francetic, O.'      9  ? 
'Izadi-Pruneyre, N.' 10 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Microbiol' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2058-5276 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            2 
_citation.language                  ? 
_citation.page_first                1686 
_citation.page_last                 1695 
_citation.title                     'Structure of the calcium-dependent type 2 secretion pseudopilus.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41564-017-0041-2 
_citation.pdbx_database_id_PubMed   28993624 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Lopez-Castilla, A.' 1  ? 
primary 'Thomassin, J.L.'    2  ? 
primary 'Bardiaux, B.'       3  ? 
primary 'Zheng, W.'          4  ? 
primary 'Nivaskumar, M.'     5  ? 
primary 'Yu, X.'             6  ? 
primary 'Nilges, M.'         7  ? 
primary 'Egelman, E.H.'      8  ? 
primary 'Izadi-Pruneyre, N.' 9  ? 
primary 'Francetic, O.'      10 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'General secretion pathway protein G' 12928.186 1 ? ? ? ? 
2 non-polymer syn 'CALCIUM ION'                         40.078    1 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'General secretion pathway protein GspG' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGNKEKADRQKVVSDLVALEGALDMYKLDNSRYPTTEQGLQALVSAPSAEPHARNYPEGGYIRRLPQDPWGSDYQLLSPG
QHGQVDIFSLGPDGVPESNDDIGNWTIGFHHHHHHK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGNKEKADRQKVVSDLVALEGALDMYKLDNSRYPTTEQGLQALVSAPSAEPHARNYPEGGYIRRLPQDPWGSDYQLLSPG
QHGQVDIFSLGPDGVPESNDDIGNWTIGFHHHHHHK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        'CALCIUM ION' 
_pdbx_entity_nonpoly.comp_id     CA 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   ASN n 
1 4   LYS n 
1 5   GLU n 
1 6   LYS n 
1 7   ALA n 
1 8   ASP n 
1 9   ARG n 
1 10  GLN n 
1 11  LYS n 
1 12  VAL n 
1 13  VAL n 
1 14  SER n 
1 15  ASP n 
1 16  LEU n 
1 17  VAL n 
1 18  ALA n 
1 19  LEU n 
1 20  GLU n 
1 21  GLY n 
1 22  ALA n 
1 23  LEU n 
1 24  ASP n 
1 25  MET n 
1 26  TYR n 
1 27  LYS n 
1 28  LEU n 
1 29  ASP n 
1 30  ASN n 
1 31  SER n 
1 32  ARG n 
1 33  TYR n 
1 34  PRO n 
1 35  THR n 
1 36  THR n 
1 37  GLU n 
1 38  GLN n 
1 39  GLY n 
1 40  LEU n 
1 41  GLN n 
1 42  ALA n 
1 43  LEU n 
1 44  VAL n 
1 45  SER n 
1 46  ALA n 
1 47  PRO n 
1 48  SER n 
1 49  ALA n 
1 50  GLU n 
1 51  PRO n 
1 52  HIS n 
1 53  ALA n 
1 54  ARG n 
1 55  ASN n 
1 56  TYR n 
1 57  PRO n 
1 58  GLU n 
1 59  GLY n 
1 60  GLY n 
1 61  TYR n 
1 62  ILE n 
1 63  ARG n 
1 64  ARG n 
1 65  LEU n 
1 66  PRO n 
1 67  GLN n 
1 68  ASP n 
1 69  PRO n 
1 70  TRP n 
1 71  GLY n 
1 72  SER n 
1 73  ASP n 
1 74  TYR n 
1 75  GLN n 
1 76  LEU n 
1 77  LEU n 
1 78  SER n 
1 79  PRO n 
1 80  GLY n 
1 81  GLN n 
1 82  HIS n 
1 83  GLY n 
1 84  GLN n 
1 85  VAL n 
1 86  ASP n 
1 87  ILE n 
1 88  PHE n 
1 89  SER n 
1 90  LEU n 
1 91  GLY n 
1 92  PRO n 
1 93  ASP n 
1 94  GLY n 
1 95  VAL n 
1 96  PRO n 
1 97  GLU n 
1 98  SER n 
1 99  ASN n 
1 100 ASP n 
1 101 ASP n 
1 102 ILE n 
1 103 GLY n 
1 104 ASN n 
1 105 TRP n 
1 106 THR n 
1 107 ILE n 
1 108 GLY n 
1 109 PHE n 
1 110 HIS n 
1 111 HIS n 
1 112 HIS n 
1 113 HIS n 
1 114 HIS n 
1 115 HIS n 
1 116 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   116 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'pulG, AB185_31145, SAMEA2273639_02747' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Klebsiella oxytoca' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     571 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   25  25  MET MET A . n 
A 1 2   GLY 2   26  26  GLY GLY A . n 
A 1 3   ASN 3   27  27  ASN ASN A . n 
A 1 4   LYS 4   28  28  LYS LYS A . n 
A 1 5   GLU 5   29  29  GLU GLU A . n 
A 1 6   LYS 6   30  30  LYS LYS A . n 
A 1 7   ALA 7   31  31  ALA ALA A . n 
A 1 8   ASP 8   32  32  ASP ASP A . n 
A 1 9   ARG 9   33  33  ARG ARG A . n 
A 1 10  GLN 10  34  34  GLN GLN A . n 
A 1 11  LYS 11  35  35  LYS LYS A . n 
A 1 12  VAL 12  36  36  VAL VAL A . n 
A 1 13  VAL 13  37  37  VAL VAL A . n 
A 1 14  SER 14  38  38  SER SER A . n 
A 1 15  ASP 15  39  39  ASP ASP A . n 
A 1 16  LEU 16  40  40  LEU LEU A . n 
A 1 17  VAL 17  41  41  VAL VAL A . n 
A 1 18  ALA 18  42  42  ALA ALA A . n 
A 1 19  LEU 19  43  43  LEU LEU A . n 
A 1 20  GLU 20  44  44  GLU GLU A . n 
A 1 21  GLY 21  45  45  GLY GLY A . n 
A 1 22  ALA 22  46  46  ALA ALA A . n 
A 1 23  LEU 23  47  47  LEU LEU A . n 
A 1 24  ASP 24  48  48  ASP ASP A . n 
A 1 25  MET 25  49  49  MET MET A . n 
A 1 26  TYR 26  50  50  TYR TYR A . n 
A 1 27  LYS 27  51  51  LYS LYS A . n 
A 1 28  LEU 28  52  52  LEU LEU A . n 
A 1 29  ASP 29  53  53  ASP ASP A . n 
A 1 30  ASN 30  54  54  ASN ASN A . n 
A 1 31  SER 31  55  55  SER SER A . n 
A 1 32  ARG 32  56  56  ARG ARG A . n 
A 1 33  TYR 33  57  57  TYR TYR A . n 
A 1 34  PRO 34  58  58  PRO PRO A . n 
A 1 35  THR 35  59  59  THR THR A . n 
A 1 36  THR 36  60  60  THR THR A . n 
A 1 37  GLU 37  61  61  GLU GLU A . n 
A 1 38  GLN 38  62  62  GLN GLN A . n 
A 1 39  GLY 39  63  63  GLY GLY A . n 
A 1 40  LEU 40  64  64  LEU LEU A . n 
A 1 41  GLN 41  65  65  GLN GLN A . n 
A 1 42  ALA 42  66  66  ALA ALA A . n 
A 1 43  LEU 43  67  67  LEU LEU A . n 
A 1 44  VAL 44  68  68  VAL VAL A . n 
A 1 45  SER 45  69  69  SER SER A . n 
A 1 46  ALA 46  70  70  ALA ALA A . n 
A 1 47  PRO 47  71  71  PRO PRO A . n 
A 1 48  SER 48  72  72  SER SER A . n 
A 1 49  ALA 49  73  73  ALA ALA A . n 
A 1 50  GLU 50  74  74  GLU GLU A . n 
A 1 51  PRO 51  75  75  PRO PRO A . n 
A 1 52  HIS 52  76  76  HIS HIS A . n 
A 1 53  ALA 53  77  77  ALA ALA A . n 
A 1 54  ARG 54  78  78  ARG ARG A . n 
A 1 55  ASN 55  79  79  ASN ASN A . n 
A 1 56  TYR 56  80  80  TYR TYR A . n 
A 1 57  PRO 57  81  81  PRO PRO A . n 
A 1 58  GLU 58  82  82  GLU GLU A . n 
A 1 59  GLY 59  83  83  GLY GLY A . n 
A 1 60  GLY 60  84  84  GLY GLY A . n 
A 1 61  TYR 61  85  85  TYR TYR A . n 
A 1 62  ILE 62  86  86  ILE ILE A . n 
A 1 63  ARG 63  87  87  ARG ARG A . n 
A 1 64  ARG 64  88  88  ARG ARG A . n 
A 1 65  LEU 65  89  89  LEU LEU A . n 
A 1 66  PRO 66  90  90  PRO PRO A . n 
A 1 67  GLN 67  91  91  GLN GLN A . n 
A 1 68  ASP 68  92  92  ASP ASP A . n 
A 1 69  PRO 69  93  93  PRO PRO A . n 
A 1 70  TRP 70  94  94  TRP TRP A . n 
A 1 71  GLY 71  95  95  GLY GLY A . n 
A 1 72  SER 72  96  96  SER SER A . n 
A 1 73  ASP 73  97  97  ASP ASP A . n 
A 1 74  TYR 74  98  98  TYR TYR A . n 
A 1 75  GLN 75  99  99  GLN GLN A . n 
A 1 76  LEU 76  100 100 LEU LEU A . n 
A 1 77  LEU 77  101 101 LEU LEU A . n 
A 1 78  SER 78  102 102 SER SER A . n 
A 1 79  PRO 79  103 103 PRO PRO A . n 
A 1 80  GLY 80  104 104 GLY GLY A . n 
A 1 81  GLN 81  105 105 GLN GLN A . n 
A 1 82  HIS 82  106 106 HIS HIS A . n 
A 1 83  GLY 83  107 107 GLY GLY A . n 
A 1 84  GLN 84  108 108 GLN GLN A . n 
A 1 85  VAL 85  109 109 VAL VAL A . n 
A 1 86  ASP 86  110 110 ASP ASP A . n 
A 1 87  ILE 87  111 111 ILE ILE A . n 
A 1 88  PHE 88  112 112 PHE PHE A . n 
A 1 89  SER 89  113 113 SER SER A . n 
A 1 90  LEU 90  114 114 LEU LEU A . n 
A 1 91  GLY 91  115 115 GLY GLY A . n 
A 1 92  PRO 92  116 116 PRO PRO A . n 
A 1 93  ASP 93  117 117 ASP ASP A . n 
A 1 94  GLY 94  118 118 GLY GLY A . n 
A 1 95  VAL 95  119 119 VAL VAL A . n 
A 1 96  PRO 96  120 120 PRO PRO A . n 
A 1 97  GLU 97  121 121 GLU GLU A . n 
A 1 98  SER 98  122 122 SER SER A . n 
A 1 99  ASN 99  123 123 ASN ASN A . n 
A 1 100 ASP 100 124 124 ASP ASP A . n 
A 1 101 ASP 101 125 125 ASP ASP A . n 
A 1 102 ILE 102 126 126 ILE ILE A . n 
A 1 103 GLY 103 127 127 GLY GLY A . n 
A 1 104 ASN 104 128 128 ASN ASN A . n 
A 1 105 TRP 105 129 129 TRP TRP A . n 
A 1 106 THR 106 130 130 THR THR A . n 
A 1 107 ILE 107 131 131 ILE ILE A . n 
A 1 108 GLY 108 132 132 GLY GLY A . n 
A 1 109 PHE 109 133 133 PHE PHE A . n 
A 1 110 HIS 110 134 134 HIS HIS A . n 
A 1 111 HIS 111 135 135 HIS HIS A . n 
A 1 112 HIS 112 136 136 HIS HIS A . n 
A 1 113 HIS 113 137 137 HIS HIS A . n 
A 1 114 HIS 114 138 138 HIS HIS A . n 
A 1 115 HIS 115 139 139 HIS HIS A . n 
A 1 116 LYS 116 140 140 LYS LYS A . n 
# 
_pdbx_nonpoly_scheme.asym_id         B 
_pdbx_nonpoly_scheme.entity_id       2 
_pdbx_nonpoly_scheme.mon_id          CA 
_pdbx_nonpoly_scheme.ndb_seq_num     1 
_pdbx_nonpoly_scheme.pdb_seq_num     201 
_pdbx_nonpoly_scheme.auth_seq_num    999 
_pdbx_nonpoly_scheme.pdb_mon_id      CA 
_pdbx_nonpoly_scheme.auth_mon_id     CA 
_pdbx_nonpoly_scheme.pdb_strand_id   A 
_pdbx_nonpoly_scheme.pdb_ins_code    . 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5O2Y 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                     5O2Y 
_struct.title                        
'NMR structure of the calcium bound form of PulG, major pseudopilin from Klebsiella oxytoca T2SS' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5O2Y 
_struct_keywords.text            'Klebsiella oxytoca T2SS, major pseudopilin, calcium, protein transport' 
_struct_keywords.pdbx_keywords   'PROTEIN TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    A0A0G3SCW3_KLEOX 
_struct_ref.pdbx_db_accession          A0A0G3SCW3 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MGNKEKADRQKVVSDLVALEGALDMYKLDNSRYPTTEQGLQALVSAPSAEPHARNYPEGGYIRRLPQDPWGSDYQLLSPG
QHGQVDIFSLGPDGVPESNDDIGNWTIG
;
_struct_ref.pdbx_align_begin           31 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5O2Y 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 108 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             A0A0G3SCW3 
_struct_ref_seq.db_align_beg                  31 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  138 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       25 
_struct_ref_seq.pdbx_auth_seq_align_end       132 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5O2Y PHE A 109 ? UNP A0A0G3SCW3 ? ? 'expression tag' 133 1 
1 5O2Y HIS A 110 ? UNP A0A0G3SCW3 ? ? 'expression tag' 134 2 
1 5O2Y HIS A 111 ? UNP A0A0G3SCW3 ? ? 'expression tag' 135 3 
1 5O2Y HIS A 112 ? UNP A0A0G3SCW3 ? ? 'expression tag' 136 4 
1 5O2Y HIS A 113 ? UNP A0A0G3SCW3 ? ? 'expression tag' 137 5 
1 5O2Y HIS A 114 ? UNP A0A0G3SCW3 ? ? 'expression tag' 138 6 
1 5O2Y HIS A 115 ? UNP A0A0G3SCW3 ? ? 'expression tag' 139 7 
1 5O2Y LYS A 116 ? UNP A0A0G3SCW3 ? ? 'expression tag' 140 8 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 0    ? 
1 MORE         0    ? 
1 'SSA (A^2)'  7530 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   ? 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 GLY A 2   ? SER A 31  ? GLY A 26  SER A 55  1 ? 30 
HELX_P HELX_P2 AA2 THR A 35  ? ALA A 42  ? THR A 59  ALA A 66  1 ? 8  
HELX_P HELX_P3 AA3 ASN A 104 ? GLY A 108 ? ASN A 128 GLY A 132 1 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1 metalc ? ? A LEU 90  O   ? ? ? 1_555 B CA . CA ? ? A LEU 114 A CA 201 1_555 ? ? ? ? ? ? ? 2.511 ? ? 
metalc2 metalc ? ? A ASP 93  OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 117 A CA 201 1_555 ? ? ? ? ? ? ? 2.520 ? ? 
metalc3 metalc ? ? A VAL 95  O   ? ? ? 1_555 B CA . CA ? ? A VAL 119 A CA 201 1_555 ? ? ? ? ? ? ? 2.513 ? ? 
metalc4 metalc ? ? A SER 98  OG  ? ? ? 1_555 B CA . CA ? ? A SER 122 A CA 201 1_555 ? ? ? ? ? ? ? 2.502 ? ? 
metalc5 metalc ? ? A ASP 101 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 125 A CA 201 1_555 ? ? ? ? ? ? ? 2.516 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A LEU 90 ? A LEU 114 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD2 ? A ASP 93  ? A ASP 117 ? 1_555 58.5  ? 
2  O   ? A LEU 90 ? A LEU 114 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O   ? A VAL 95  ? A VAL 119 ? 1_555 100.6 ? 
3  OD2 ? A ASP 93 ? A ASP 117 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O   ? A VAL 95  ? A VAL 119 ? 1_555 100.0 ? 
4  O   ? A LEU 90 ? A LEU 114 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OG  ? A SER 98  ? A SER 122 ? 1_555 149.8 ? 
5  OD2 ? A ASP 93 ? A ASP 117 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OG  ? A SER 98  ? A SER 122 ? 1_555 117.8 ? 
6  O   ? A VAL 95 ? A VAL 119 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OG  ? A SER 98  ? A SER 122 ? 1_555 49.3  ? 
7  O   ? A LEU 90 ? A LEU 114 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD2 ? A ASP 101 ? A ASP 125 ? 1_555 125.3 ? 
8  OD2 ? A ASP 93 ? A ASP 117 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD2 ? A ASP 101 ? A ASP 125 ? 1_555 153.8 ? 
9  O   ? A VAL 95 ? A VAL 119 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD2 ? A ASP 101 ? A ASP 125 ? 1_555 54.3  ? 
10 OG  ? A SER 98 ? A SER 122 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD2 ? A ASP 101 ? A ASP 125 ? 1_555 43.7  ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  GLU 50 A . ? GLU 74  A PRO 51 A ? PRO 75  A 1  -4.04 
2  SER 78 A . ? SER 102 A PRO 79 A ? PRO 103 A 1  -2.73 
3  GLU 50 A . ? GLU 74  A PRO 51 A ? PRO 75  A 2  1.78  
4  SER 78 A . ? SER 102 A PRO 79 A ? PRO 103 A 2  -3.15 
5  GLU 50 A . ? GLU 74  A PRO 51 A ? PRO 75  A 3  -0.44 
6  SER 78 A . ? SER 102 A PRO 79 A ? PRO 103 A 3  -4.17 
7  GLU 50 A . ? GLU 74  A PRO 51 A ? PRO 75  A 4  -3.53 
8  SER 78 A . ? SER 102 A PRO 79 A ? PRO 103 A 4  -5.50 
9  GLU 50 A . ? GLU 74  A PRO 51 A ? PRO 75  A 5  -0.61 
10 SER 78 A . ? SER 102 A PRO 79 A ? PRO 103 A 5  -4.93 
11 GLU 50 A . ? GLU 74  A PRO 51 A ? PRO 75  A 6  -0.63 
12 SER 78 A . ? SER 102 A PRO 79 A ? PRO 103 A 6  -1.23 
13 GLU 50 A . ? GLU 74  A PRO 51 A ? PRO 75  A 7  -4.66 
14 SER 78 A . ? SER 102 A PRO 79 A ? PRO 103 A 7  -4.34 
15 GLU 50 A . ? GLU 74  A PRO 51 A ? PRO 75  A 8  -2.14 
16 SER 78 A . ? SER 102 A PRO 79 A ? PRO 103 A 8  -1.34 
17 GLU 50 A . ? GLU 74  A PRO 51 A ? PRO 75  A 9  0.28  
18 SER 78 A . ? SER 102 A PRO 79 A ? PRO 103 A 9  -3.85 
19 GLU 50 A . ? GLU 74  A PRO 51 A ? PRO 75  A 10 -1.68 
20 SER 78 A . ? SER 102 A PRO 79 A ? PRO 103 A 10 -3.69 
21 GLU 50 A . ? GLU 74  A PRO 51 A ? PRO 75  A 11 -2.82 
22 SER 78 A . ? SER 102 A PRO 79 A ? PRO 103 A 11 -5.91 
23 GLU 50 A . ? GLU 74  A PRO 51 A ? PRO 75  A 12 0.05  
24 SER 78 A . ? SER 102 A PRO 79 A ? PRO 103 A 12 -1.93 
25 GLU 50 A . ? GLU 74  A PRO 51 A ? PRO 75  A 13 -1.52 
26 SER 78 A . ? SER 102 A PRO 79 A ? PRO 103 A 13 -3.20 
27 GLU 50 A . ? GLU 74  A PRO 51 A ? PRO 75  A 14 -0.38 
28 SER 78 A . ? SER 102 A PRO 79 A ? PRO 103 A 14 -5.20 
29 GLU 50 A . ? GLU 74  A PRO 51 A ? PRO 75  A 15 1.72  
30 SER 78 A . ? SER 102 A PRO 79 A ? PRO 103 A 15 -3.10 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLN A 67  ? ASP A 68  ? GLN A 91  ASP A 92  
AA1 2 SER A 72  ? ASP A 73  ? SER A 96  ASP A 97  
AA2 1 GLN A 75  ? LEU A 77  ? GLN A 99  LEU A 101 
AA2 2 ASP A 86  ? SER A 89  ? ASP A 110 SER A 113 
AA2 3 ILE A 102 ? GLY A 103 ? ILE A 126 GLY A 127 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ASP A 68 ? N ASP A 92  O SER A 72  ? O SER A 96  
AA2 1 2 N GLN A 75 ? N GLN A 99  O PHE A 88  ? O PHE A 112 
AA2 2 3 N SER A 89 ? N SER A 113 O ILE A 102 ? O ILE A 126 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    CA 
_struct_site.pdbx_auth_seq_id     201 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    6 
_struct_site.details              'binding site for residue CA A 201' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 LEU A 90  ? LEU A 114 . ? 1_555 ? 
2 AC1 6 ASP A 93  ? ASP A 117 . ? 1_555 ? 
3 AC1 6 VAL A 95  ? VAL A 119 . ? 1_555 ? 
4 AC1 6 SER A 98  ? SER A 122 . ? 1_555 ? 
5 AC1 6 ASP A 100 ? ASP A 124 . ? 1_555 ? 
6 AC1 6 ASP A 101 ? ASP A 125 . ? 1_555 ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1  OG  A SER 122 ? ? OD2 A ASP 125 ? ? 1.87 
2  1  O   A VAL 119 ? ? OG  A SER 122 ? ? 2.09 
3  2  OG  A SER 122 ? ? OD2 A ASP 125 ? ? 2.00 
4  2  O   A VAL 119 ? ? OG  A SER 122 ? ? 2.07 
5  2  O   A VAL 119 ? ? OD2 A ASP 125 ? ? 2.19 
6  3  OG  A SER 122 ? ? OD2 A ASP 125 ? ? 2.12 
7  4  HD1 A HIS 106 ? ? OD2 A ASP 110 ? ? 1.57 
8  4  HG  A SER 122 ? ? CA  A CA  201 ? ? 1.60 
9  4  OG  A SER 122 ? ? OD2 A ASP 125 ? ? 1.70 
10 4  O   A VAL 119 ? ? OD2 A ASP 125 ? ? 2.07 
11 4  O   A VAL 119 ? ? OG  A SER 122 ? ? 2.09 
12 5  HG  A SER 122 ? ? CA  A CA  201 ? ? 1.60 
13 5  O   A VAL 119 ? ? OG  A SER 122 ? ? 1.98 
14 5  OG  A SER 122 ? ? OD2 A ASP 125 ? ? 2.14 
15 6  HG  A SER 122 ? ? OD2 A ASP 125 ? ? 1.43 
16 6  HG  A SER 122 ? ? CA  A CA  201 ? ? 1.59 
17 6  OG  A SER 122 ? ? OD2 A ASP 125 ? ? 1.63 
18 6  O   A VAL 119 ? ? OG  A SER 122 ? ? 1.95 
19 6  O   A VAL 119 ? ? OD2 A ASP 125 ? ? 2.18 
20 7  O   A VAL 119 ? ? OG  A SER 122 ? ? 1.86 
21 7  OG  A SER 122 ? ? OD2 A ASP 125 ? ? 1.99 
22 8  O   A VAL 119 ? ? HG  A SER 122 ? ? 1.39 
23 8  OD2 A ASP 117 ? ? HG  A SER 122 ? ? 1.40 
24 8  HD1 A HIS 106 ? ? OD1 A ASP 110 ? ? 1.55 
25 8  O   A VAL 119 ? ? OG  A SER 122 ? ? 1.87 
26 8  OD2 A ASP 117 ? ? OG  A SER 122 ? ? 2.02 
27 9  HG  A SER 122 ? ? CA  A CA  201 ? ? 1.55 
28 9  O   A VAL 119 ? ? OG  A SER 122 ? ? 1.70 
29 9  OG  A SER 122 ? ? OD2 A ASP 125 ? ? 2.11 
30 11 HG  A SER 122 ? ? CA  A CA  201 ? ? 1.58 
31 11 OG  A SER 122 ? ? OD2 A ASP 125 ? ? 1.73 
32 11 O   A VAL 119 ? ? OD2 A ASP 125 ? ? 1.98 
33 11 O   A VAL 119 ? ? OG  A SER 122 ? ? 2.05 
34 12 OG  A SER 122 ? ? OD2 A ASP 125 ? ? 1.79 
35 12 O   A VAL 119 ? ? OG  A SER 122 ? ? 2.08 
36 13 HG  A SER 122 ? ? CA  A CA  201 ? ? 1.60 
37 13 OD1 A ASP 125 ? ? CA  A CA  201 ? ? 1.65 
38 13 O   A VAL 119 ? ? OG  A SER 122 ? ? 1.75 
39 13 OG  A SER 122 ? ? OD2 A ASP 125 ? ? 1.83 
40 14 HG  A SER 122 ? ? CA  A CA  201 ? ? 1.59 
41 14 OG  A SER 122 ? ? OD2 A ASP 125 ? ? 1.92 
42 14 O   A VAL 119 ? ? OG  A SER 122 ? ? 2.01 
43 15 OG  A SER 122 ? ? OD2 A ASP 125 ? ? 1.57 
44 15 O   A VAL 119 ? ? OG  A SER 122 ? ? 2.00 
45 15 O   A VAL 119 ? ? OD2 A ASP 125 ? ? 2.12 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1  ASP A 125 ? ? -56.94  104.82 
2  2  LYS A 28  ? ? -148.84 20.25  
3  2  VAL A 68  ? ? -103.20 -62.83 
4  2  HIS A 134 ? ? -163.16 119.65 
5  3  PHE A 133 ? ? -69.98  99.78  
6  4  PHE A 133 ? ? -69.53  -70.52 
7  4  HIS A 138 ? ? -149.43 -10.01 
8  6  LYS A 28  ? ? -116.87 75.24  
9  6  HIS A 135 ? ? -104.10 77.87  
10 7  SER A 55  ? ? 71.97   -13.99 
11 7  VAL A 68  ? ? -108.28 -63.04 
12 7  HIS A 139 ? ? 179.80  22.82  
13 9  SER A 55  ? ? 72.17   -42.21 
14 9  SER A 72  ? ? -92.22  41.33  
15 9  HIS A 138 ? ? 63.06   80.20  
16 10 HIS A 135 ? ? -93.40  54.19  
17 10 HIS A 137 ? ? -175.37 114.86 
18 11 HIS A 137 ? ? -90.63  31.50  
19 12 SER A 55  ? ? 73.17   -43.19 
20 13 ASN A 27  ? ? 66.52   98.44  
21 13 LYS A 28  ? ? -98.25  47.93  
22 13 HIS A 135 ? ? -91.06  56.36  
23 13 HIS A 136 ? ? 62.09   71.53  
24 14 SER A 55  ? ? 70.99   -7.20  
25 14 VAL A 68  ? ? -128.33 -53.38 
26 14 HIS A 139 ? ? -94.56  46.03  
27 15 LYS A 28  ? ? -113.25 75.09  
28 15 HIS A 134 ? ? -171.75 135.83 
29 15 HIS A 136 ? ? -102.15 70.70  
30 15 HIS A 139 ? ? -143.48 33.17  
# 
_pdbx_nmr_ensemble.entry_id                                      5O2Y 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             15 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the least restraint violations' 
_pdbx_nmr_ensemble.representative_conformer                      ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             5O2Y 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
;0.5 mM [U-99% 13C; U-99% 15N] PulG, 50 mM non-labeled HEPES, 50 mM non-labeled sodium chloride, 1 mM non-labeled CaCl2, 90% H2O/10% D2O
;
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
_pdbx_nmr_sample_details.label            15N_13C 
_pdbx_nmr_sample_details.type             solution 
_pdbx_nmr_sample_details.details          ? 
# 
loop_
_pdbx_nmr_exptl_sample.solution_id 
_pdbx_nmr_exptl_sample.component 
_pdbx_nmr_exptl_sample.concentration 
_pdbx_nmr_exptl_sample.concentration_range 
_pdbx_nmr_exptl_sample.concentration_units 
_pdbx_nmr_exptl_sample.isotopic_labeling 
1 PulG              0.5 ? mM '[U-99% 13C; U-99% 15N]' 
1 HEPES             50  ? mM non-labeled              
1 'sodium chloride' 50  ? mM non-labeled              
1 CaCl2             1   ? mM non-labeled              
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            298 
_pdbx_nmr_exptl_sample_conditions.pressure_units         atm 
_pdbx_nmr_exptl_sample_conditions.pressure               1 
_pdbx_nmr_exptl_sample_conditions.pH                     7 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         50 
_pdbx_nmr_exptl_sample_conditions.details                ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_err     ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   mM 
_pdbx_nmr_exptl_sample_conditions.label                  conditions_1 
_pdbx_nmr_exptl_sample_conditions.pH_err                 ? 
_pdbx_nmr_exptl_sample_conditions.pH_units               pH 
_pdbx_nmr_exptl_sample_conditions.pressure_err           ? 
_pdbx_nmr_exptl_sample_conditions.temperature_err        ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.spectrometer_id 
_pdbx_nmr_exptl.sample_state 
1  1 1 '2D 1H-15N HSQC'  1 isotropic 
2  1 1 '3D HNCO'         1 isotropic 
3  1 1 HNCACO            1 isotropic 
4  1 1 '3D HNCACB'       1 isotropic 
5  1 1 '3D CBCA(CO)NH'   1 isotropic 
6  1 1 '3D HCCH-TOCSY'   1 isotropic 
7  1 1 '3D H(CCO)NH'     1 isotropic 
8  1 1 '3D 1H-15N NOESY' 2 isotropic 
9  1 1 '3D 1H-13C NOESY' 2 isotropic 
10 1 1 '2D 1H-13C HSQC'  1 isotropic 
11 1 1 '3D CC(CO)NH'     1 isotropic 
12 1 1 '2D HBCBCGCDHD'   1 isotropic 
13 1 1 '2D HBCBCGCDCEHE' 1 isotropic 
# 
_pdbx_nmr_refine.entry_id           5O2Y 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   7 
# 
loop_
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
1 collection                  VNMR              ? Varian                                              
2 processing                  NMRPipe           ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 
3 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN                                                
4 'peak picking'              'CcpNmr Analysis' ? CCPN                                                
5 collection                  TopSpin           ? 'Bruker Biospin'                                    
6 processing                  TopSpin           ? 'Bruker Biospin'                                    
7 'structure calculation'     ARIA              ? 
;Linge, O'Donoghue and Nilges
;
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ARG N    N  N N 14  
ARG CA   C  N S 15  
ARG C    C  N N 16  
ARG O    O  N N 17  
ARG CB   C  N N 18  
ARG CG   C  N N 19  
ARG CD   C  N N 20  
ARG NE   N  N N 21  
ARG CZ   C  N N 22  
ARG NH1  N  N N 23  
ARG NH2  N  N N 24  
ARG OXT  O  N N 25  
ARG H    H  N N 26  
ARG H2   H  N N 27  
ARG HA   H  N N 28  
ARG HB2  H  N N 29  
ARG HB3  H  N N 30  
ARG HG2  H  N N 31  
ARG HG3  H  N N 32  
ARG HD2  H  N N 33  
ARG HD3  H  N N 34  
ARG HE   H  N N 35  
ARG HH11 H  N N 36  
ARG HH12 H  N N 37  
ARG HH21 H  N N 38  
ARG HH22 H  N N 39  
ARG HXT  H  N N 40  
ASN N    N  N N 41  
ASN CA   C  N S 42  
ASN C    C  N N 43  
ASN O    O  N N 44  
ASN CB   C  N N 45  
ASN CG   C  N N 46  
ASN OD1  O  N N 47  
ASN ND2  N  N N 48  
ASN OXT  O  N N 49  
ASN H    H  N N 50  
ASN H2   H  N N 51  
ASN HA   H  N N 52  
ASN HB2  H  N N 53  
ASN HB3  H  N N 54  
ASN HD21 H  N N 55  
ASN HD22 H  N N 56  
ASN HXT  H  N N 57  
ASP N    N  N N 58  
ASP CA   C  N S 59  
ASP C    C  N N 60  
ASP O    O  N N 61  
ASP CB   C  N N 62  
ASP CG   C  N N 63  
ASP OD1  O  N N 64  
ASP OD2  O  N N 65  
ASP OXT  O  N N 66  
ASP H    H  N N 67  
ASP H2   H  N N 68  
ASP HA   H  N N 69  
ASP HB2  H  N N 70  
ASP HB3  H  N N 71  
ASP HD2  H  N N 72  
ASP HXT  H  N N 73  
CA  CA   CA N N 74  
GLN N    N  N N 75  
GLN CA   C  N S 76  
GLN C    C  N N 77  
GLN O    O  N N 78  
GLN CB   C  N N 79  
GLN CG   C  N N 80  
GLN CD   C  N N 81  
GLN OE1  O  N N 82  
GLN NE2  N  N N 83  
GLN OXT  O  N N 84  
GLN H    H  N N 85  
GLN H2   H  N N 86  
GLN HA   H  N N 87  
GLN HB2  H  N N 88  
GLN HB3  H  N N 89  
GLN HG2  H  N N 90  
GLN HG3  H  N N 91  
GLN HE21 H  N N 92  
GLN HE22 H  N N 93  
GLN HXT  H  N N 94  
GLU N    N  N N 95  
GLU CA   C  N S 96  
GLU C    C  N N 97  
GLU O    O  N N 98  
GLU CB   C  N N 99  
GLU CG   C  N N 100 
GLU CD   C  N N 101 
GLU OE1  O  N N 102 
GLU OE2  O  N N 103 
GLU OXT  O  N N 104 
GLU H    H  N N 105 
GLU H2   H  N N 106 
GLU HA   H  N N 107 
GLU HB2  H  N N 108 
GLU HB3  H  N N 109 
GLU HG2  H  N N 110 
GLU HG3  H  N N 111 
GLU HE2  H  N N 112 
GLU HXT  H  N N 113 
GLY N    N  N N 114 
GLY CA   C  N N 115 
GLY C    C  N N 116 
GLY O    O  N N 117 
GLY OXT  O  N N 118 
GLY H    H  N N 119 
GLY H2   H  N N 120 
GLY HA2  H  N N 121 
GLY HA3  H  N N 122 
GLY HXT  H  N N 123 
HIS N    N  N N 124 
HIS CA   C  N S 125 
HIS C    C  N N 126 
HIS O    O  N N 127 
HIS CB   C  N N 128 
HIS CG   C  Y N 129 
HIS ND1  N  Y N 130 
HIS CD2  C  Y N 131 
HIS CE1  C  Y N 132 
HIS NE2  N  Y N 133 
HIS OXT  O  N N 134 
HIS H    H  N N 135 
HIS H2   H  N N 136 
HIS HA   H  N N 137 
HIS HB2  H  N N 138 
HIS HB3  H  N N 139 
HIS HD1  H  N N 140 
HIS HD2  H  N N 141 
HIS HE1  H  N N 142 
HIS HE2  H  N N 143 
HIS HXT  H  N N 144 
ILE N    N  N N 145 
ILE CA   C  N S 146 
ILE C    C  N N 147 
ILE O    O  N N 148 
ILE CB   C  N S 149 
ILE CG1  C  N N 150 
ILE CG2  C  N N 151 
ILE CD1  C  N N 152 
ILE OXT  O  N N 153 
ILE H    H  N N 154 
ILE H2   H  N N 155 
ILE HA   H  N N 156 
ILE HB   H  N N 157 
ILE HG12 H  N N 158 
ILE HG13 H  N N 159 
ILE HG21 H  N N 160 
ILE HG22 H  N N 161 
ILE HG23 H  N N 162 
ILE HD11 H  N N 163 
ILE HD12 H  N N 164 
ILE HD13 H  N N 165 
ILE HXT  H  N N 166 
LEU N    N  N N 167 
LEU CA   C  N S 168 
LEU C    C  N N 169 
LEU O    O  N N 170 
LEU CB   C  N N 171 
LEU CG   C  N N 172 
LEU CD1  C  N N 173 
LEU CD2  C  N N 174 
LEU OXT  O  N N 175 
LEU H    H  N N 176 
LEU H2   H  N N 177 
LEU HA   H  N N 178 
LEU HB2  H  N N 179 
LEU HB3  H  N N 180 
LEU HG   H  N N 181 
LEU HD11 H  N N 182 
LEU HD12 H  N N 183 
LEU HD13 H  N N 184 
LEU HD21 H  N N 185 
LEU HD22 H  N N 186 
LEU HD23 H  N N 187 
LEU HXT  H  N N 188 
LYS N    N  N N 189 
LYS CA   C  N S 190 
LYS C    C  N N 191 
LYS O    O  N N 192 
LYS CB   C  N N 193 
LYS CG   C  N N 194 
LYS CD   C  N N 195 
LYS CE   C  N N 196 
LYS NZ   N  N N 197 
LYS OXT  O  N N 198 
LYS H    H  N N 199 
LYS H2   H  N N 200 
LYS HA   H  N N 201 
LYS HB2  H  N N 202 
LYS HB3  H  N N 203 
LYS HG2  H  N N 204 
LYS HG3  H  N N 205 
LYS HD2  H  N N 206 
LYS HD3  H  N N 207 
LYS HE2  H  N N 208 
LYS HE3  H  N N 209 
LYS HZ1  H  N N 210 
LYS HZ2  H  N N 211 
LYS HZ3  H  N N 212 
LYS HXT  H  N N 213 
MET N    N  N N 214 
MET CA   C  N S 215 
MET C    C  N N 216 
MET O    O  N N 217 
MET CB   C  N N 218 
MET CG   C  N N 219 
MET SD   S  N N 220 
MET CE   C  N N 221 
MET OXT  O  N N 222 
MET H    H  N N 223 
MET H2   H  N N 224 
MET HA   H  N N 225 
MET HB2  H  N N 226 
MET HB3  H  N N 227 
MET HG2  H  N N 228 
MET HG3  H  N N 229 
MET HE1  H  N N 230 
MET HE2  H  N N 231 
MET HE3  H  N N 232 
MET HXT  H  N N 233 
PHE N    N  N N 234 
PHE CA   C  N S 235 
PHE C    C  N N 236 
PHE O    O  N N 237 
PHE CB   C  N N 238 
PHE CG   C  Y N 239 
PHE CD1  C  Y N 240 
PHE CD2  C  Y N 241 
PHE CE1  C  Y N 242 
PHE CE2  C  Y N 243 
PHE CZ   C  Y N 244 
PHE OXT  O  N N 245 
PHE H    H  N N 246 
PHE H2   H  N N 247 
PHE HA   H  N N 248 
PHE HB2  H  N N 249 
PHE HB3  H  N N 250 
PHE HD1  H  N N 251 
PHE HD2  H  N N 252 
PHE HE1  H  N N 253 
PHE HE2  H  N N 254 
PHE HZ   H  N N 255 
PHE HXT  H  N N 256 
PRO N    N  N N 257 
PRO CA   C  N S 258 
PRO C    C  N N 259 
PRO O    O  N N 260 
PRO CB   C  N N 261 
PRO CG   C  N N 262 
PRO CD   C  N N 263 
PRO OXT  O  N N 264 
PRO H    H  N N 265 
PRO HA   H  N N 266 
PRO HB2  H  N N 267 
PRO HB3  H  N N 268 
PRO HG2  H  N N 269 
PRO HG3  H  N N 270 
PRO HD2  H  N N 271 
PRO HD3  H  N N 272 
PRO HXT  H  N N 273 
SER N    N  N N 274 
SER CA   C  N S 275 
SER C    C  N N 276 
SER O    O  N N 277 
SER CB   C  N N 278 
SER OG   O  N N 279 
SER OXT  O  N N 280 
SER H    H  N N 281 
SER H2   H  N N 282 
SER HA   H  N N 283 
SER HB2  H  N N 284 
SER HB3  H  N N 285 
SER HG   H  N N 286 
SER HXT  H  N N 287 
THR N    N  N N 288 
THR CA   C  N S 289 
THR C    C  N N 290 
THR O    O  N N 291 
THR CB   C  N R 292 
THR OG1  O  N N 293 
THR CG2  C  N N 294 
THR OXT  O  N N 295 
THR H    H  N N 296 
THR H2   H  N N 297 
THR HA   H  N N 298 
THR HB   H  N N 299 
THR HG1  H  N N 300 
THR HG21 H  N N 301 
THR HG22 H  N N 302 
THR HG23 H  N N 303 
THR HXT  H  N N 304 
TRP N    N  N N 305 
TRP CA   C  N S 306 
TRP C    C  N N 307 
TRP O    O  N N 308 
TRP CB   C  N N 309 
TRP CG   C  Y N 310 
TRP CD1  C  Y N 311 
TRP CD2  C  Y N 312 
TRP NE1  N  Y N 313 
TRP CE2  C  Y N 314 
TRP CE3  C  Y N 315 
TRP CZ2  C  Y N 316 
TRP CZ3  C  Y N 317 
TRP CH2  C  Y N 318 
TRP OXT  O  N N 319 
TRP H    H  N N 320 
TRP H2   H  N N 321 
TRP HA   H  N N 322 
TRP HB2  H  N N 323 
TRP HB3  H  N N 324 
TRP HD1  H  N N 325 
TRP HE1  H  N N 326 
TRP HE3  H  N N 327 
TRP HZ2  H  N N 328 
TRP HZ3  H  N N 329 
TRP HH2  H  N N 330 
TRP HXT  H  N N 331 
TYR N    N  N N 332 
TYR CA   C  N S 333 
TYR C    C  N N 334 
TYR O    O  N N 335 
TYR CB   C  N N 336 
TYR CG   C  Y N 337 
TYR CD1  C  Y N 338 
TYR CD2  C  Y N 339 
TYR CE1  C  Y N 340 
TYR CE2  C  Y N 341 
TYR CZ   C  Y N 342 
TYR OH   O  N N 343 
TYR OXT  O  N N 344 
TYR H    H  N N 345 
TYR H2   H  N N 346 
TYR HA   H  N N 347 
TYR HB2  H  N N 348 
TYR HB3  H  N N 349 
TYR HD1  H  N N 350 
TYR HD2  H  N N 351 
TYR HE1  H  N N 352 
TYR HE2  H  N N 353 
TYR HH   H  N N 354 
TYR HXT  H  N N 355 
VAL N    N  N N 356 
VAL CA   C  N S 357 
VAL C    C  N N 358 
VAL O    O  N N 359 
VAL CB   C  N N 360 
VAL CG1  C  N N 361 
VAL CG2  C  N N 362 
VAL OXT  O  N N 363 
VAL H    H  N N 364 
VAL H2   H  N N 365 
VAL HA   H  N N 366 
VAL HB   H  N N 367 
VAL HG11 H  N N 368 
VAL HG12 H  N N 369 
VAL HG13 H  N N 370 
VAL HG21 H  N N 371 
VAL HG22 H  N N 372 
VAL HG23 H  N N 373 
VAL HXT  H  N N 374 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
GLN N   CA   sing N N 70  
GLN N   H    sing N N 71  
GLN N   H2   sing N N 72  
GLN CA  C    sing N N 73  
GLN CA  CB   sing N N 74  
GLN CA  HA   sing N N 75  
GLN C   O    doub N N 76  
GLN C   OXT  sing N N 77  
GLN CB  CG   sing N N 78  
GLN CB  HB2  sing N N 79  
GLN CB  HB3  sing N N 80  
GLN CG  CD   sing N N 81  
GLN CG  HG2  sing N N 82  
GLN CG  HG3  sing N N 83  
GLN CD  OE1  doub N N 84  
GLN CD  NE2  sing N N 85  
GLN NE2 HE21 sing N N 86  
GLN NE2 HE22 sing N N 87  
GLN OXT HXT  sing N N 88  
GLU N   CA   sing N N 89  
GLU N   H    sing N N 90  
GLU N   H2   sing N N 91  
GLU CA  C    sing N N 92  
GLU CA  CB   sing N N 93  
GLU CA  HA   sing N N 94  
GLU C   O    doub N N 95  
GLU C   OXT  sing N N 96  
GLU CB  CG   sing N N 97  
GLU CB  HB2  sing N N 98  
GLU CB  HB3  sing N N 99  
GLU CG  CD   sing N N 100 
GLU CG  HG2  sing N N 101 
GLU CG  HG3  sing N N 102 
GLU CD  OE1  doub N N 103 
GLU CD  OE2  sing N N 104 
GLU OE2 HE2  sing N N 105 
GLU OXT HXT  sing N N 106 
GLY N   CA   sing N N 107 
GLY N   H    sing N N 108 
GLY N   H2   sing N N 109 
GLY CA  C    sing N N 110 
GLY CA  HA2  sing N N 111 
GLY CA  HA3  sing N N 112 
GLY C   O    doub N N 113 
GLY C   OXT  sing N N 114 
GLY OXT HXT  sing N N 115 
HIS N   CA   sing N N 116 
HIS N   H    sing N N 117 
HIS N   H2   sing N N 118 
HIS CA  C    sing N N 119 
HIS CA  CB   sing N N 120 
HIS CA  HA   sing N N 121 
HIS C   O    doub N N 122 
HIS C   OXT  sing N N 123 
HIS CB  CG   sing N N 124 
HIS CB  HB2  sing N N 125 
HIS CB  HB3  sing N N 126 
HIS CG  ND1  sing Y N 127 
HIS CG  CD2  doub Y N 128 
HIS ND1 CE1  doub Y N 129 
HIS ND1 HD1  sing N N 130 
HIS CD2 NE2  sing Y N 131 
HIS CD2 HD2  sing N N 132 
HIS CE1 NE2  sing Y N 133 
HIS CE1 HE1  sing N N 134 
HIS NE2 HE2  sing N N 135 
HIS OXT HXT  sing N N 136 
ILE N   CA   sing N N 137 
ILE N   H    sing N N 138 
ILE N   H2   sing N N 139 
ILE CA  C    sing N N 140 
ILE CA  CB   sing N N 141 
ILE CA  HA   sing N N 142 
ILE C   O    doub N N 143 
ILE C   OXT  sing N N 144 
ILE CB  CG1  sing N N 145 
ILE CB  CG2  sing N N 146 
ILE CB  HB   sing N N 147 
ILE CG1 CD1  sing N N 148 
ILE CG1 HG12 sing N N 149 
ILE CG1 HG13 sing N N 150 
ILE CG2 HG21 sing N N 151 
ILE CG2 HG22 sing N N 152 
ILE CG2 HG23 sing N N 153 
ILE CD1 HD11 sing N N 154 
ILE CD1 HD12 sing N N 155 
ILE CD1 HD13 sing N N 156 
ILE OXT HXT  sing N N 157 
LEU N   CA   sing N N 158 
LEU N   H    sing N N 159 
LEU N   H2   sing N N 160 
LEU CA  C    sing N N 161 
LEU CA  CB   sing N N 162 
LEU CA  HA   sing N N 163 
LEU C   O    doub N N 164 
LEU C   OXT  sing N N 165 
LEU CB  CG   sing N N 166 
LEU CB  HB2  sing N N 167 
LEU CB  HB3  sing N N 168 
LEU CG  CD1  sing N N 169 
LEU CG  CD2  sing N N 170 
LEU CG  HG   sing N N 171 
LEU CD1 HD11 sing N N 172 
LEU CD1 HD12 sing N N 173 
LEU CD1 HD13 sing N N 174 
LEU CD2 HD21 sing N N 175 
LEU CD2 HD22 sing N N 176 
LEU CD2 HD23 sing N N 177 
LEU OXT HXT  sing N N 178 
LYS N   CA   sing N N 179 
LYS N   H    sing N N 180 
LYS N   H2   sing N N 181 
LYS CA  C    sing N N 182 
LYS CA  CB   sing N N 183 
LYS CA  HA   sing N N 184 
LYS C   O    doub N N 185 
LYS C   OXT  sing N N 186 
LYS CB  CG   sing N N 187 
LYS CB  HB2  sing N N 188 
LYS CB  HB3  sing N N 189 
LYS CG  CD   sing N N 190 
LYS CG  HG2  sing N N 191 
LYS CG  HG3  sing N N 192 
LYS CD  CE   sing N N 193 
LYS CD  HD2  sing N N 194 
LYS CD  HD3  sing N N 195 
LYS CE  NZ   sing N N 196 
LYS CE  HE2  sing N N 197 
LYS CE  HE3  sing N N 198 
LYS NZ  HZ1  sing N N 199 
LYS NZ  HZ2  sing N N 200 
LYS NZ  HZ3  sing N N 201 
LYS OXT HXT  sing N N 202 
MET N   CA   sing N N 203 
MET N   H    sing N N 204 
MET N   H2   sing N N 205 
MET CA  C    sing N N 206 
MET CA  CB   sing N N 207 
MET CA  HA   sing N N 208 
MET C   O    doub N N 209 
MET C   OXT  sing N N 210 
MET CB  CG   sing N N 211 
MET CB  HB2  sing N N 212 
MET CB  HB3  sing N N 213 
MET CG  SD   sing N N 214 
MET CG  HG2  sing N N 215 
MET CG  HG3  sing N N 216 
MET SD  CE   sing N N 217 
MET CE  HE1  sing N N 218 
MET CE  HE2  sing N N 219 
MET CE  HE3  sing N N 220 
MET OXT HXT  sing N N 221 
PHE N   CA   sing N N 222 
PHE N   H    sing N N 223 
PHE N   H2   sing N N 224 
PHE CA  C    sing N N 225 
PHE CA  CB   sing N N 226 
PHE CA  HA   sing N N 227 
PHE C   O    doub N N 228 
PHE C   OXT  sing N N 229 
PHE CB  CG   sing N N 230 
PHE CB  HB2  sing N N 231 
PHE CB  HB3  sing N N 232 
PHE CG  CD1  doub Y N 233 
PHE CG  CD2  sing Y N 234 
PHE CD1 CE1  sing Y N 235 
PHE CD1 HD1  sing N N 236 
PHE CD2 CE2  doub Y N 237 
PHE CD2 HD2  sing N N 238 
PHE CE1 CZ   doub Y N 239 
PHE CE1 HE1  sing N N 240 
PHE CE2 CZ   sing Y N 241 
PHE CE2 HE2  sing N N 242 
PHE CZ  HZ   sing N N 243 
PHE OXT HXT  sing N N 244 
PRO N   CA   sing N N 245 
PRO N   CD   sing N N 246 
PRO N   H    sing N N 247 
PRO CA  C    sing N N 248 
PRO CA  CB   sing N N 249 
PRO CA  HA   sing N N 250 
PRO C   O    doub N N 251 
PRO C   OXT  sing N N 252 
PRO CB  CG   sing N N 253 
PRO CB  HB2  sing N N 254 
PRO CB  HB3  sing N N 255 
PRO CG  CD   sing N N 256 
PRO CG  HG2  sing N N 257 
PRO CG  HG3  sing N N 258 
PRO CD  HD2  sing N N 259 
PRO CD  HD3  sing N N 260 
PRO OXT HXT  sing N N 261 
SER N   CA   sing N N 262 
SER N   H    sing N N 263 
SER N   H2   sing N N 264 
SER CA  C    sing N N 265 
SER CA  CB   sing N N 266 
SER CA  HA   sing N N 267 
SER C   O    doub N N 268 
SER C   OXT  sing N N 269 
SER CB  OG   sing N N 270 
SER CB  HB2  sing N N 271 
SER CB  HB3  sing N N 272 
SER OG  HG   sing N N 273 
SER OXT HXT  sing N N 274 
THR N   CA   sing N N 275 
THR N   H    sing N N 276 
THR N   H2   sing N N 277 
THR CA  C    sing N N 278 
THR CA  CB   sing N N 279 
THR CA  HA   sing N N 280 
THR C   O    doub N N 281 
THR C   OXT  sing N N 282 
THR CB  OG1  sing N N 283 
THR CB  CG2  sing N N 284 
THR CB  HB   sing N N 285 
THR OG1 HG1  sing N N 286 
THR CG2 HG21 sing N N 287 
THR CG2 HG22 sing N N 288 
THR CG2 HG23 sing N N 289 
THR OXT HXT  sing N N 290 
TRP N   CA   sing N N 291 
TRP N   H    sing N N 292 
TRP N   H2   sing N N 293 
TRP CA  C    sing N N 294 
TRP CA  CB   sing N N 295 
TRP CA  HA   sing N N 296 
TRP C   O    doub N N 297 
TRP C   OXT  sing N N 298 
TRP CB  CG   sing N N 299 
TRP CB  HB2  sing N N 300 
TRP CB  HB3  sing N N 301 
TRP CG  CD1  doub Y N 302 
TRP CG  CD2  sing Y N 303 
TRP CD1 NE1  sing Y N 304 
TRP CD1 HD1  sing N N 305 
TRP CD2 CE2  doub Y N 306 
TRP CD2 CE3  sing Y N 307 
TRP NE1 CE2  sing Y N 308 
TRP NE1 HE1  sing N N 309 
TRP CE2 CZ2  sing Y N 310 
TRP CE3 CZ3  doub Y N 311 
TRP CE3 HE3  sing N N 312 
TRP CZ2 CH2  doub Y N 313 
TRP CZ2 HZ2  sing N N 314 
TRP CZ3 CH2  sing Y N 315 
TRP CZ3 HZ3  sing N N 316 
TRP CH2 HH2  sing N N 317 
TRP OXT HXT  sing N N 318 
TYR N   CA   sing N N 319 
TYR N   H    sing N N 320 
TYR N   H2   sing N N 321 
TYR CA  C    sing N N 322 
TYR CA  CB   sing N N 323 
TYR CA  HA   sing N N 324 
TYR C   O    doub N N 325 
TYR C   OXT  sing N N 326 
TYR CB  CG   sing N N 327 
TYR CB  HB2  sing N N 328 
TYR CB  HB3  sing N N 329 
TYR CG  CD1  doub Y N 330 
TYR CG  CD2  sing Y N 331 
TYR CD1 CE1  sing Y N 332 
TYR CD1 HD1  sing N N 333 
TYR CD2 CE2  doub Y N 334 
TYR CD2 HD2  sing N N 335 
TYR CE1 CZ   doub Y N 336 
TYR CE1 HE1  sing N N 337 
TYR CE2 CZ   sing Y N 338 
TYR CE2 HE2  sing N N 339 
TYR CZ  OH   sing N N 340 
TYR OH  HH   sing N N 341 
TYR OXT HXT  sing N N 342 
VAL N   CA   sing N N 343 
VAL N   H    sing N N 344 
VAL N   H2   sing N N 345 
VAL CA  C    sing N N 346 
VAL CA  CB   sing N N 347 
VAL CA  HA   sing N N 348 
VAL C   O    doub N N 349 
VAL C   OXT  sing N N 350 
VAL CB  CG1  sing N N 351 
VAL CB  CG2  sing N N 352 
VAL CB  HB   sing N N 353 
VAL CG1 HG11 sing N N 354 
VAL CG1 HG12 sing N N 355 
VAL CG1 HG13 sing N N 356 
VAL CG2 HG21 sing N N 357 
VAL CG2 HG22 sing N N 358 
VAL CG2 HG23 sing N N 359 
VAL OXT HXT  sing N N 360 
# 
_pdbx_audit_support.funding_organization   'French National Research Agency' 
_pdbx_audit_support.country                France 
_pdbx_audit_support.grant_number           ANR-14-CE09-0004NR 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.details 
1 INOVA        ? Varian 600 ? 
2 'AVANCE III' ? Bruker 950 ? 
# 
_atom_sites.entry_id                    5O2Y 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
H  
N  
O  
S  
# 
loop_