data_5O6R # _entry.id 5O6R # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5O6R pdb_00005o6r 10.2210/pdb5o6r/pdb WWPDB D_1200005284 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-06-20 2 'Structure model' 1 1 2018-09-19 3 'Structure model' 2 0 2020-07-29 4 'Structure model' 2 1 2024-01-17 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 3 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Atomic model' 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Data collection' 7 4 'Structure model' 'Database references' 8 4 'Structure model' 'Refinement description' 9 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' atom_site 4 3 'Structure model' atom_site_anisotrop 5 3 'Structure model' chem_comp 6 3 'Structure model' pdbx_chem_comp_identifier 7 3 'Structure model' pdbx_struct_conn_angle 8 3 'Structure model' struct_conn 9 3 'Structure model' struct_site 10 3 'Structure model' struct_site_gen 11 4 'Structure model' chem_comp 12 4 'Structure model' chem_comp_atom 13 4 'Structure model' chem_comp_bond 14 4 'Structure model' database_2 15 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.title' 7 2 'Structure model' '_citation.year' 8 3 'Structure model' '_atom_site.auth_atom_id' 9 3 'Structure model' '_atom_site.label_atom_id' 10 3 'Structure model' '_atom_site_anisotrop.pdbx_auth_atom_id' 11 3 'Structure model' '_atom_site_anisotrop.pdbx_label_atom_id' 12 3 'Structure model' '_chem_comp.mon_nstd_flag' 13 3 'Structure model' '_chem_comp.type' 14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 15 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 16 3 'Structure model' '_pdbx_struct_conn_angle.value' 17 3 'Structure model' '_struct_conn.pdbx_dist_value' 18 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 19 4 'Structure model' '_chem_comp.pdbx_synonyms' 20 4 'Structure model' '_database_2.pdbx_DOI' 21 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5O6R _pdbx_database_status.recvd_initial_deposition_date 2017-06-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _audit_author.name 'Bowler, M.W.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0003-0465-3351 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Catalysis' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2155-5435 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;van der Waals Contact between Nucleophile and Transferring Phosphorus Is Insufficient To Achieve Enzyme Transition-State Architecture ; _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acscatal.8b01612 _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Johnson, L.A.' 1 ? primary 'Robertson, A.J.' 2 ? primary 'Baxter, N.J.' 3 ? primary 'Trevitt, C.R.' 4 ? primary 'Bisson, C.' 5 ? primary 'Jin, Y.' 6 ? primary 'Wood, H.P.' 7 ? primary 'Hounslow, A.M.' 8 ? primary 'Cliff, M.J.' 9 ? primary 'Blackburn, G.M.' 10 ? primary 'Bowler, M.W.' 11 ? primary 'Waltho, J.P.' 12 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Beta-phosphoglucomutase 24238.609 1 5.4.2.6 D10N ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 2 ? ? ? ? 3 non-polymer man 1-O-phosphono-beta-D-glucopyranose 260.136 1 ? ? ? ? 4 non-polymer syn 'TETRAFLUOROALUMINATE ION' 102.975 1 ? ? ? ? 5 water nat water 18.015 379 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Beta-PGM # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MFKAVLFDLNGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNY VKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGV APSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK ; _entity_poly.pdbx_seq_one_letter_code_can ;MFKAVLFDLNGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNY VKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGV APSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 1-O-phosphono-beta-D-glucopyranose XGP 4 'TETRAFLUOROALUMINATE ION' ALF 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PHE n 1 3 LYS n 1 4 ALA n 1 5 VAL n 1 6 LEU n 1 7 PHE n 1 8 ASP n 1 9 LEU n 1 10 ASN n 1 11 GLY n 1 12 VAL n 1 13 ILE n 1 14 THR n 1 15 ASP n 1 16 THR n 1 17 ALA n 1 18 GLU n 1 19 TYR n 1 20 HIS n 1 21 PHE n 1 22 ARG n 1 23 ALA n 1 24 TRP n 1 25 LYS n 1 26 ALA n 1 27 LEU n 1 28 ALA n 1 29 GLU n 1 30 GLU n 1 31 ILE n 1 32 GLY n 1 33 ILE n 1 34 ASN n 1 35 GLY n 1 36 VAL n 1 37 ASP n 1 38 ARG n 1 39 GLN n 1 40 PHE n 1 41 ASN n 1 42 GLU n 1 43 GLN n 1 44 LEU n 1 45 LYS n 1 46 GLY n 1 47 VAL n 1 48 SER n 1 49 ARG n 1 50 GLU n 1 51 ASP n 1 52 SER n 1 53 LEU n 1 54 GLN n 1 55 LYS n 1 56 ILE n 1 57 LEU n 1 58 ASP n 1 59 LEU n 1 60 ALA n 1 61 ASP n 1 62 LYS n 1 63 LYS n 1 64 VAL n 1 65 SER n 1 66 ALA n 1 67 GLU n 1 68 GLU n 1 69 PHE n 1 70 LYS n 1 71 GLU n 1 72 LEU n 1 73 ALA n 1 74 LYS n 1 75 ARG n 1 76 LYS n 1 77 ASN n 1 78 ASP n 1 79 ASN n 1 80 TYR n 1 81 VAL n 1 82 LYS n 1 83 MET n 1 84 ILE n 1 85 GLN n 1 86 ASP n 1 87 VAL n 1 88 SER n 1 89 PRO n 1 90 ALA n 1 91 ASP n 1 92 VAL n 1 93 TYR n 1 94 PRO n 1 95 GLY n 1 96 ILE n 1 97 LEU n 1 98 GLN n 1 99 LEU n 1 100 LEU n 1 101 LYS n 1 102 ASP n 1 103 LEU n 1 104 ARG n 1 105 SER n 1 106 ASN n 1 107 LYS n 1 108 ILE n 1 109 LYS n 1 110 ILE n 1 111 ALA n 1 112 LEU n 1 113 ALA n 1 114 SER n 1 115 ALA n 1 116 SER n 1 117 LYS n 1 118 ASN n 1 119 GLY n 1 120 PRO n 1 121 PHE n 1 122 LEU n 1 123 LEU n 1 124 GLU n 1 125 ARG n 1 126 MET n 1 127 ASN n 1 128 LEU n 1 129 THR n 1 130 GLY n 1 131 TYR n 1 132 PHE n 1 133 ASP n 1 134 ALA n 1 135 ILE n 1 136 ALA n 1 137 ASP n 1 138 PRO n 1 139 ALA n 1 140 GLU n 1 141 VAL n 1 142 ALA n 1 143 ALA n 1 144 SER n 1 145 LYS n 1 146 PRO n 1 147 ALA n 1 148 PRO n 1 149 ASP n 1 150 ILE n 1 151 PHE n 1 152 ILE n 1 153 ALA n 1 154 ALA n 1 155 ALA n 1 156 HIS n 1 157 ALA n 1 158 VAL n 1 159 GLY n 1 160 VAL n 1 161 ALA n 1 162 PRO n 1 163 SER n 1 164 GLU n 1 165 SER n 1 166 ILE n 1 167 GLY n 1 168 LEU n 1 169 GLU n 1 170 ASP n 1 171 SER n 1 172 GLN n 1 173 ALA n 1 174 GLY n 1 175 ILE n 1 176 GLN n 1 177 ALA n 1 178 ILE n 1 179 LYS n 1 180 ASP n 1 181 SER n 1 182 GLY n 1 183 ALA n 1 184 LEU n 1 185 PRO n 1 186 ILE n 1 187 GLY n 1 188 VAL n 1 189 GLY n 1 190 ARG n 1 191 PRO n 1 192 GLU n 1 193 ASP n 1 194 LEU n 1 195 GLY n 1 196 ASP n 1 197 ASP n 1 198 ILE n 1 199 VAL n 1 200 ILE n 1 201 VAL n 1 202 PRO n 1 203 ASP n 1 204 THR n 1 205 SER n 1 206 HIS n 1 207 TYR n 1 208 THR n 1 209 LEU n 1 210 GLU n 1 211 PHE n 1 212 LEU n 1 213 LYS n 1 214 GLU n 1 215 VAL n 1 216 TRP n 1 217 LEU n 1 218 GLN n 1 219 LYS n 1 220 GLN n 1 221 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 221 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'pgmB, LL0429, L0001' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Lactococcus lactis subsp. lactis Il1403' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 272623 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ALF non-polymer . 'TETRAFLUOROALUMINATE ION' ? 'Al F4 -1' 102.975 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 XGP D-saccharide n 1-O-phosphono-beta-D-glucopyranose '1-O-phosphono-beta-D-glucose; 1-O-phosphono-D-glucose; 1-O-phosphono-glucose' 'C6 H13 O9 P' 260.136 # _pdbx_chem_comp_identifier.comp_id XGP _pdbx_chem_comp_identifier.type 'IUPAC CARBOHYDRATE SYMBOL' _pdbx_chem_comp_identifier.program PDB-CARE _pdbx_chem_comp_identifier.program_version 1.0 _pdbx_chem_comp_identifier.identifier b-D-Glcp1PO3 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 PHE 2 2 2 PHE PHE A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 TRP 24 24 24 TRP TRP A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 MET 83 83 83 MET MET A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 GLN 98 98 98 GLN GLN A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 LYS 109 109 109 LYS LYS A . n A 1 110 ILE 110 110 110 ILE ILE A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 PRO 120 120 120 PRO PRO A . n A 1 121 PHE 121 121 121 PHE PHE A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 MET 126 126 126 MET MET A . n A 1 127 ASN 127 127 127 ASN ASN A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 TYR 131 131 131 TYR TYR A . n A 1 132 PHE 132 132 132 PHE PHE A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 ILE 135 135 135 ILE ILE A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 PRO 138 138 138 PRO PRO A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 VAL 141 141 141 VAL VAL A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 SER 144 144 144 SER SER A . n A 1 145 LYS 145 145 145 LYS LYS A . n A 1 146 PRO 146 146 146 PRO PRO A . n A 1 147 ALA 147 147 147 ALA ALA A . n A 1 148 PRO 148 148 148 PRO PRO A . n A 1 149 ASP 149 149 149 ASP ASP A . n A 1 150 ILE 150 150 150 ILE ILE A . n A 1 151 PHE 151 151 151 PHE PHE A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 ALA 155 155 155 ALA ALA A . n A 1 156 HIS 156 156 156 HIS HIS A . n A 1 157 ALA 157 157 157 ALA ALA A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 GLY 159 159 159 GLY GLY A . n A 1 160 VAL 160 160 160 VAL VAL A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 PRO 162 162 162 PRO PRO A . n A 1 163 SER 163 163 163 SER SER A . n A 1 164 GLU 164 164 164 GLU GLU A . n A 1 165 SER 165 165 165 SER SER A . n A 1 166 ILE 166 166 166 ILE ILE A . n A 1 167 GLY 167 167 167 GLY GLY A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 GLU 169 169 169 GLU GLU A . n A 1 170 ASP 170 170 170 ASP ASP A . n A 1 171 SER 171 171 171 SER SER A . n A 1 172 GLN 172 172 172 GLN GLN A . n A 1 173 ALA 173 173 173 ALA ALA A . n A 1 174 GLY 174 174 174 GLY GLY A . n A 1 175 ILE 175 175 175 ILE ILE A . n A 1 176 GLN 176 176 176 GLN GLN A . n A 1 177 ALA 177 177 177 ALA ALA A . n A 1 178 ILE 178 178 178 ILE ILE A . n A 1 179 LYS 179 179 179 LYS LYS A . n A 1 180 ASP 180 180 180 ASP ASP A . n A 1 181 SER 181 181 181 SER SER A . n A 1 182 GLY 182 182 182 GLY GLY A . n A 1 183 ALA 183 183 183 ALA ALA A . n A 1 184 LEU 184 184 184 LEU LEU A . n A 1 185 PRO 185 185 185 PRO PRO A . n A 1 186 ILE 186 186 186 ILE ILE A . n A 1 187 GLY 187 187 187 GLY GLY A . n A 1 188 VAL 188 188 188 VAL VAL A . n A 1 189 GLY 189 189 189 GLY GLY A . n A 1 190 ARG 190 190 190 ARG ARG A . n A 1 191 PRO 191 191 191 PRO PRO A . n A 1 192 GLU 192 192 192 GLU GLU A . n A 1 193 ASP 193 193 193 ASP ASP A . n A 1 194 LEU 194 194 194 LEU LEU A . n A 1 195 GLY 195 195 195 GLY GLY A . n A 1 196 ASP 196 196 196 ASP ASP A . n A 1 197 ASP 197 197 197 ASP ASP A . n A 1 198 ILE 198 198 198 ILE ILE A . n A 1 199 VAL 199 199 199 VAL VAL A . n A 1 200 ILE 200 200 200 ILE ILE A . n A 1 201 VAL 201 201 201 VAL VAL A . n A 1 202 PRO 202 202 202 PRO PRO A . n A 1 203 ASP 203 203 203 ASP ASP A . n A 1 204 THR 204 204 204 THR THR A . n A 1 205 SER 205 205 205 SER SER A . n A 1 206 HIS 206 206 206 HIS HIS A . n A 1 207 TYR 207 207 207 TYR TYR A . n A 1 208 THR 208 208 208 THR THR A . n A 1 209 LEU 209 209 209 LEU LEU A . n A 1 210 GLU 210 210 210 GLU GLU A . n A 1 211 PHE 211 211 211 PHE PHE A . n A 1 212 LEU 212 212 212 LEU LEU A . n A 1 213 LYS 213 213 213 LYS LYS A . n A 1 214 GLU 214 214 214 GLU GLU A . n A 1 215 VAL 215 215 215 VAL VAL A . n A 1 216 TRP 216 216 216 TRP TRP A . n A 1 217 LEU 217 217 217 LEU LEU A . n A 1 218 GLN 218 218 218 GLN GLN A . n A 1 219 LYS 219 219 ? ? ? A . n A 1 220 GLN 220 220 ? ? ? A . n A 1 221 LYS 221 221 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 301 1 MG MG A . C 3 XGP 1 302 3745 XGP G1P A . D 4 ALF 1 303 620 ALF ALF A . E 2 MG 1 304 1 MG MG A . F 5 HOH 1 401 191 HOH HOH A . F 5 HOH 2 402 304 HOH HOH A . F 5 HOH 3 403 393 HOH HOH A . F 5 HOH 4 404 270 HOH HOH A . F 5 HOH 5 405 330 HOH HOH A . F 5 HOH 6 406 343 HOH HOH A . F 5 HOH 7 407 430 HOH HOH A . F 5 HOH 8 408 314 HOH HOH A . F 5 HOH 9 409 253 HOH HOH A . F 5 HOH 10 410 306 HOH HOH A . F 5 HOH 11 411 149 HOH HOH A . F 5 HOH 12 412 183 HOH HOH A . F 5 HOH 13 413 271 HOH HOH A . F 5 HOH 14 414 141 HOH HOH A . F 5 HOH 15 415 260 HOH HOH A . F 5 HOH 16 416 70 HOH HOH A . F 5 HOH 17 417 156 HOH HOH A . F 5 HOH 18 418 414 HOH HOH A . F 5 HOH 19 419 137 HOH HOH A . F 5 HOH 20 420 292 HOH HOH A . F 5 HOH 21 421 284 HOH HOH A . F 5 HOH 22 422 400 HOH HOH A . F 5 HOH 23 423 125 HOH HOH A . F 5 HOH 24 424 113 HOH HOH A . F 5 HOH 25 425 256 HOH HOH A . F 5 HOH 26 426 138 HOH HOH A . F 5 HOH 27 427 302 HOH HOH A . F 5 HOH 28 428 68 HOH HOH A . F 5 HOH 29 429 241 HOH HOH A . F 5 HOH 30 430 144 HOH HOH A . F 5 HOH 31 431 42 HOH HOH A . F 5 HOH 32 432 435 HOH HOH A . F 5 HOH 33 433 107 HOH HOH A . F 5 HOH 34 434 179 HOH HOH A . F 5 HOH 35 435 177 HOH HOH A . F 5 HOH 36 436 170 HOH HOH A . F 5 HOH 37 437 175 HOH HOH A . F 5 HOH 38 438 320 HOH HOH A . F 5 HOH 39 439 186 HOH HOH A . F 5 HOH 40 440 18 HOH HOH A . F 5 HOH 41 441 102 HOH HOH A . F 5 HOH 42 442 19 HOH HOH A . F 5 HOH 43 443 55 HOH HOH A . F 5 HOH 44 444 57 HOH HOH A . F 5 HOH 45 445 307 HOH HOH A . F 5 HOH 46 446 98 HOH HOH A . F 5 HOH 47 447 58 HOH HOH A . F 5 HOH 48 448 48 HOH HOH A . F 5 HOH 49 449 282 HOH HOH A . F 5 HOH 50 450 14 HOH HOH A . F 5 HOH 51 451 246 HOH HOH A . F 5 HOH 52 452 75 HOH HOH A . F 5 HOH 53 453 406 HOH HOH A . F 5 HOH 54 454 114 HOH HOH A . F 5 HOH 55 455 124 HOH HOH A . F 5 HOH 56 456 71 HOH HOH A . F 5 HOH 57 457 164 HOH HOH A . F 5 HOH 58 458 132 HOH HOH A . F 5 HOH 59 459 7 HOH HOH A . F 5 HOH 60 460 61 HOH HOH A . F 5 HOH 61 461 327 HOH HOH A . F 5 HOH 62 462 32 HOH HOH A . F 5 HOH 63 463 368 HOH HOH A . F 5 HOH 64 464 133 HOH HOH A . F 5 HOH 65 465 21 HOH HOH A . F 5 HOH 66 466 383 HOH HOH A . F 5 HOH 67 467 178 HOH HOH A . F 5 HOH 68 468 44 HOH HOH A . F 5 HOH 69 469 169 HOH HOH A . F 5 HOH 70 470 298 HOH HOH A . F 5 HOH 71 471 82 HOH HOH A . F 5 HOH 72 472 413 HOH HOH A . F 5 HOH 73 473 172 HOH HOH A . F 5 HOH 74 474 173 HOH HOH A . F 5 HOH 75 475 35 HOH HOH A . F 5 HOH 76 476 352 HOH HOH A . F 5 HOH 77 477 38 HOH HOH A . F 5 HOH 78 478 182 HOH HOH A . F 5 HOH 79 479 106 HOH HOH A . F 5 HOH 80 480 174 HOH HOH A . F 5 HOH 81 481 310 HOH HOH A . F 5 HOH 82 482 311 HOH HOH A . F 5 HOH 83 483 40 HOH HOH A . F 5 HOH 84 484 420 HOH HOH A . F 5 HOH 85 485 46 HOH HOH A . F 5 HOH 86 486 91 HOH HOH A . F 5 HOH 87 487 31 HOH HOH A . F 5 HOH 88 488 139 HOH HOH A . F 5 HOH 89 489 166 HOH HOH A . F 5 HOH 90 490 409 HOH HOH A . F 5 HOH 91 491 165 HOH HOH A . F 5 HOH 92 492 105 HOH HOH A . F 5 HOH 93 493 316 HOH HOH A . F 5 HOH 94 494 64 HOH HOH A . F 5 HOH 95 495 437 HOH HOH A . F 5 HOH 96 496 331 HOH HOH A . F 5 HOH 97 497 54 HOH HOH A . F 5 HOH 98 498 163 HOH HOH A . F 5 HOH 99 499 162 HOH HOH A . F 5 HOH 100 500 8 HOH HOH A . F 5 HOH 101 501 334 HOH HOH A . F 5 HOH 102 502 76 HOH HOH A . F 5 HOH 103 503 131 HOH HOH A . F 5 HOH 104 504 41 HOH HOH A . F 5 HOH 105 505 119 HOH HOH A . F 5 HOH 106 506 198 HOH HOH A . F 5 HOH 107 507 118 HOH HOH A . F 5 HOH 108 508 59 HOH HOH A . F 5 HOH 109 509 62 HOH HOH A . F 5 HOH 110 510 78 HOH HOH A . F 5 HOH 111 511 398 HOH HOH A . F 5 HOH 112 512 85 HOH HOH A . F 5 HOH 113 513 365 HOH HOH A . F 5 HOH 114 514 4 HOH HOH A . F 5 HOH 115 515 103 HOH HOH A . F 5 HOH 116 516 15 HOH HOH A . F 5 HOH 117 517 116 HOH HOH A . F 5 HOH 118 518 84 HOH HOH A . F 5 HOH 119 519 53 HOH HOH A . F 5 HOH 120 520 150 HOH HOH A . F 5 HOH 121 521 36 HOH HOH A . F 5 HOH 122 522 147 HOH HOH A . F 5 HOH 123 523 210 HOH HOH A . F 5 HOH 124 524 77 HOH HOH A . F 5 HOH 125 525 143 HOH HOH A . F 5 HOH 126 526 65 HOH HOH A . F 5 HOH 127 527 12 HOH HOH A . F 5 HOH 128 528 28 HOH HOH A . F 5 HOH 129 529 157 HOH HOH A . F 5 HOH 130 530 380 HOH HOH A . F 5 HOH 131 531 17 HOH HOH A . F 5 HOH 132 532 135 HOH HOH A . F 5 HOH 133 533 51 HOH HOH A . F 5 HOH 134 534 438 HOH HOH A . F 5 HOH 135 535 60 HOH HOH A . F 5 HOH 136 536 433 HOH HOH A . F 5 HOH 137 537 140 HOH HOH A . F 5 HOH 138 538 109 HOH HOH A . F 5 HOH 139 539 184 HOH HOH A . F 5 HOH 140 540 27 HOH HOH A . F 5 HOH 141 541 154 HOH HOH A . F 5 HOH 142 542 99 HOH HOH A . F 5 HOH 143 543 104 HOH HOH A . F 5 HOH 144 544 117 HOH HOH A . F 5 HOH 145 545 52 HOH HOH A . F 5 HOH 146 546 303 HOH HOH A . F 5 HOH 147 547 47 HOH HOH A . F 5 HOH 148 548 158 HOH HOH A . F 5 HOH 149 549 56 HOH HOH A . F 5 HOH 150 550 313 HOH HOH A . F 5 HOH 151 551 34 HOH HOH A . F 5 HOH 152 552 10 HOH HOH A . F 5 HOH 153 553 217 HOH HOH A . F 5 HOH 154 554 196 HOH HOH A . F 5 HOH 155 555 146 HOH HOH A . F 5 HOH 156 556 49 HOH HOH A . F 5 HOH 157 557 328 HOH HOH A . F 5 HOH 158 558 96 HOH HOH A . F 5 HOH 159 559 425 HOH HOH A . F 5 HOH 160 560 230 HOH HOH A . F 5 HOH 161 561 160 HOH HOH A . F 5 HOH 162 562 121 HOH HOH A . F 5 HOH 163 563 404 HOH HOH A . F 5 HOH 164 564 86 HOH HOH A . F 5 HOH 165 565 129 HOH HOH A . F 5 HOH 166 566 189 HOH HOH A . F 5 HOH 167 567 63 HOH HOH A . F 5 HOH 168 568 83 HOH HOH A . F 5 HOH 169 569 97 HOH HOH A . F 5 HOH 170 570 348 HOH HOH A . F 5 HOH 171 571 225 HOH HOH A . F 5 HOH 172 572 424 HOH HOH A . F 5 HOH 173 573 268 HOH HOH A . F 5 HOH 174 574 110 HOH HOH A . F 5 HOH 175 575 200 HOH HOH A . F 5 HOH 176 576 5 HOH HOH A . F 5 HOH 177 577 66 HOH HOH A . F 5 HOH 178 578 79 HOH HOH A . F 5 HOH 179 579 350 HOH HOH A . F 5 HOH 180 580 192 HOH HOH A . F 5 HOH 181 581 39 HOH HOH A . F 5 HOH 182 582 395 HOH HOH A . F 5 HOH 183 583 120 HOH HOH A . F 5 HOH 184 584 167 HOH HOH A . F 5 HOH 185 585 338 HOH HOH A . F 5 HOH 186 586 88 HOH HOH A . F 5 HOH 187 587 297 HOH HOH A . F 5 HOH 188 588 354 HOH HOH A . F 5 HOH 189 589 134 HOH HOH A . F 5 HOH 190 590 26 HOH HOH A . F 5 HOH 191 591 421 HOH HOH A . F 5 HOH 192 592 315 HOH HOH A . F 5 HOH 193 593 43 HOH HOH A . F 5 HOH 194 594 145 HOH HOH A . F 5 HOH 195 595 370 HOH HOH A . F 5 HOH 196 596 93 HOH HOH A . F 5 HOH 197 597 324 HOH HOH A . F 5 HOH 198 598 300 HOH HOH A . F 5 HOH 199 599 24 HOH HOH A . F 5 HOH 200 600 142 HOH HOH A . F 5 HOH 201 601 100 HOH HOH A . F 5 HOH 202 602 171 HOH HOH A . F 5 HOH 203 603 153 HOH HOH A . F 5 HOH 204 604 345 HOH HOH A . F 5 HOH 205 605 112 HOH HOH A . F 5 HOH 206 606 428 HOH HOH A . F 5 HOH 207 607 122 HOH HOH A . F 5 HOH 208 608 89 HOH HOH A . F 5 HOH 209 609 250 HOH HOH A . F 5 HOH 210 610 243 HOH HOH A . F 5 HOH 211 611 90 HOH HOH A . F 5 HOH 212 612 20 HOH HOH A . F 5 HOH 213 613 168 HOH HOH A . F 5 HOH 214 614 94 HOH HOH A . F 5 HOH 215 615 439 HOH HOH A . F 5 HOH 216 616 108 HOH HOH A . F 5 HOH 217 617 201 HOH HOH A . F 5 HOH 218 618 22 HOH HOH A . F 5 HOH 219 619 351 HOH HOH A . F 5 HOH 220 620 209 HOH HOH A . F 5 HOH 221 621 111 HOH HOH A . F 5 HOH 222 622 74 HOH HOH A . F 5 HOH 223 623 296 HOH HOH A . F 5 HOH 224 624 126 HOH HOH A . F 5 HOH 225 625 261 HOH HOH A . F 5 HOH 226 626 432 HOH HOH A . F 5 HOH 227 627 399 HOH HOH A . F 5 HOH 228 628 80 HOH HOH A . F 5 HOH 229 629 181 HOH HOH A . F 5 HOH 230 630 364 HOH HOH A . F 5 HOH 231 631 236 HOH HOH A . F 5 HOH 232 632 203 HOH HOH A . F 5 HOH 233 633 247 HOH HOH A . F 5 HOH 234 634 130 HOH HOH A . F 5 HOH 235 635 194 HOH HOH A . F 5 HOH 236 636 161 HOH HOH A . F 5 HOH 237 637 127 HOH HOH A . F 5 HOH 238 638 95 HOH HOH A . F 5 HOH 239 639 190 HOH HOH A . F 5 HOH 240 640 148 HOH HOH A . F 5 HOH 241 641 341 HOH HOH A . F 5 HOH 242 642 152 HOH HOH A . F 5 HOH 243 643 440 HOH HOH A . F 5 HOH 244 644 205 HOH HOH A . F 5 HOH 245 645 123 HOH HOH A . F 5 HOH 246 646 254 HOH HOH A . F 5 HOH 247 647 128 HOH HOH A . F 5 HOH 248 648 277 HOH HOH A . F 5 HOH 249 649 374 HOH HOH A . F 5 HOH 250 650 195 HOH HOH A . F 5 HOH 251 651 197 HOH HOH A . F 5 HOH 252 652 257 HOH HOH A . F 5 HOH 253 653 151 HOH HOH A . F 5 HOH 254 654 359 HOH HOH A . F 5 HOH 255 655 434 HOH HOH A . F 5 HOH 256 656 431 HOH HOH A . F 5 HOH 257 657 415 HOH HOH A . F 5 HOH 258 658 207 HOH HOH A . F 5 HOH 259 659 202 HOH HOH A . F 5 HOH 260 660 266 HOH HOH A . F 5 HOH 261 661 347 HOH HOH A . F 5 HOH 262 662 273 HOH HOH A . F 5 HOH 263 663 279 HOH HOH A . F 5 HOH 264 664 267 HOH HOH A . F 5 HOH 265 665 185 HOH HOH A . F 5 HOH 266 666 187 HOH HOH A . F 5 HOH 267 667 291 HOH HOH A . F 5 HOH 268 668 427 HOH HOH A . F 5 HOH 269 669 199 HOH HOH A . F 5 HOH 270 670 272 HOH HOH A . F 5 HOH 271 671 101 HOH HOH A . F 5 HOH 272 672 249 HOH HOH A . F 5 HOH 273 673 269 HOH HOH A . F 5 HOH 274 674 73 HOH HOH A . F 5 HOH 275 675 436 HOH HOH A . F 5 HOH 276 676 159 HOH HOH A . F 5 HOH 277 677 67 HOH HOH A . F 5 HOH 278 678 136 HOH HOH A . F 5 HOH 279 679 224 HOH HOH A . F 5 HOH 280 680 344 HOH HOH A . F 5 HOH 281 681 228 HOH HOH A . F 5 HOH 282 682 220 HOH HOH A . F 5 HOH 283 683 309 HOH HOH A . F 5 HOH 284 684 340 HOH HOH A . F 5 HOH 285 685 419 HOH HOH A . F 5 HOH 286 686 92 HOH HOH A . F 5 HOH 287 687 263 HOH HOH A . F 5 HOH 288 688 252 HOH HOH A . F 5 HOH 289 689 329 HOH HOH A . F 5 HOH 290 690 394 HOH HOH A . F 5 HOH 291 691 293 HOH HOH A . F 5 HOH 292 692 325 HOH HOH A . F 5 HOH 293 693 321 HOH HOH A . F 5 HOH 294 694 262 HOH HOH A . F 5 HOH 295 695 231 HOH HOH A . F 5 HOH 296 696 286 HOH HOH A . F 5 HOH 297 697 222 HOH HOH A . F 5 HOH 298 698 377 HOH HOH A . F 5 HOH 299 699 362 HOH HOH A . F 5 HOH 300 700 392 HOH HOH A . F 5 HOH 301 701 281 HOH HOH A . F 5 HOH 302 702 188 HOH HOH A . F 5 HOH 303 703 72 HOH HOH A . F 5 HOH 304 704 369 HOH HOH A . F 5 HOH 305 705 403 HOH HOH A . F 5 HOH 306 706 226 HOH HOH A . F 5 HOH 307 707 349 HOH HOH A . F 5 HOH 308 708 396 HOH HOH A . F 5 HOH 309 709 379 HOH HOH A . F 5 HOH 310 710 407 HOH HOH A . F 5 HOH 311 711 242 HOH HOH A . F 5 HOH 312 712 390 HOH HOH A . F 5 HOH 313 713 240 HOH HOH A . F 5 HOH 314 714 372 HOH HOH A . F 5 HOH 315 715 208 HOH HOH A . F 5 HOH 316 716 221 HOH HOH A . F 5 HOH 317 717 214 HOH HOH A . F 5 HOH 318 718 339 HOH HOH A . F 5 HOH 319 719 429 HOH HOH A . F 5 HOH 320 720 312 HOH HOH A . F 5 HOH 321 721 218 HOH HOH A . F 5 HOH 322 722 289 HOH HOH A . F 5 HOH 323 723 397 HOH HOH A . F 5 HOH 324 724 411 HOH HOH A . F 5 HOH 325 725 317 HOH HOH A . F 5 HOH 326 726 248 HOH HOH A . F 5 HOH 327 727 212 HOH HOH A . F 5 HOH 328 728 353 HOH HOH A . F 5 HOH 329 729 416 HOH HOH A . F 5 HOH 330 730 294 HOH HOH A . F 5 HOH 331 731 234 HOH HOH A . F 5 HOH 332 732 386 HOH HOH A . F 5 HOH 333 733 244 HOH HOH A . F 5 HOH 334 734 219 HOH HOH A . F 5 HOH 335 735 280 HOH HOH A . F 5 HOH 336 736 283 HOH HOH A . F 5 HOH 337 737 278 HOH HOH A . F 5 HOH 338 738 251 HOH HOH A . F 5 HOH 339 739 237 HOH HOH A . F 5 HOH 340 740 401 HOH HOH A . F 5 HOH 341 741 215 HOH HOH A . F 5 HOH 342 742 265 HOH HOH A . F 5 HOH 343 743 332 HOH HOH A . F 5 HOH 344 744 360 HOH HOH A . F 5 HOH 345 745 318 HOH HOH A . F 5 HOH 346 746 405 HOH HOH A . F 5 HOH 347 747 299 HOH HOH A . F 5 HOH 348 748 213 HOH HOH A . F 5 HOH 349 749 275 HOH HOH A . F 5 HOH 350 750 337 HOH HOH A . F 5 HOH 351 751 288 HOH HOH A . F 5 HOH 352 752 385 HOH HOH A . F 5 HOH 353 753 323 HOH HOH A . F 5 HOH 354 754 391 HOH HOH A . F 5 HOH 355 755 259 HOH HOH A . F 5 HOH 356 756 229 HOH HOH A . F 5 HOH 357 757 290 HOH HOH A . F 5 HOH 358 758 233 HOH HOH A . F 5 HOH 359 759 308 HOH HOH A . F 5 HOH 360 760 232 HOH HOH A . F 5 HOH 361 761 227 HOH HOH A . F 5 HOH 362 762 285 HOH HOH A . F 5 HOH 363 763 238 HOH HOH A . F 5 HOH 364 764 235 HOH HOH A . F 5 HOH 365 765 361 HOH HOH A . F 5 HOH 366 766 239 HOH HOH A . F 5 HOH 367 767 423 HOH HOH A . F 5 HOH 368 768 274 HOH HOH A . F 5 HOH 369 769 382 HOH HOH A . F 5 HOH 370 770 417 HOH HOH A . F 5 HOH 371 771 373 HOH HOH A . F 5 HOH 372 772 245 HOH HOH A . F 5 HOH 373 773 223 HOH HOH A . F 5 HOH 374 774 301 HOH HOH A . F 5 HOH 375 775 384 HOH HOH A . F 5 HOH 376 776 381 HOH HOH A . F 5 HOH 377 777 378 HOH HOH A . F 5 HOH 378 778 402 HOH HOH A . F 5 HOH 379 779 319 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0158 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5O6R _cell.details ? _cell.formula_units_Z ? _cell.length_a 36.300 _cell.length_a_esd ? _cell.length_b 54.900 _cell.length_b_esd ? _cell.length_c 107.560 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5O6R _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5O6R _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.21 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.37 _exptl_crystal.description 'Large plate crystals with approximate dimensions 0.5 mm x 0.1 mm x 0.1 mm' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.4 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '19-21 % PEG 3350 and 50 mM Mg acetate' _exptl_crystal_grow.pdbx_pH_range 7.4 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 210r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2008-11-27 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator C001 _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.933 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID14-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.933 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID14-2 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 11.5 _reflns.entry_id 5O6R _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.36 _reflns.d_resolution_low 53.78 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 43148 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F 3 _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 93.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3 _reflns.pdbx_Rmerge_I_obs 0.027 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 24.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.36 _reflns_shell.d_res_low 1.44 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 7.4 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 16940 _reflns_shell.percent_possible_all 91.3 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.11 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.8 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.077 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.08 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] -0.03 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -0.05 _refine.B_iso_max ? _refine.B_iso_mean 13.314 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.978 _refine.correlation_coeff_Fo_to_Fc_free 0.970 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5O6R _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.36 _refine.ls_d_res_low 20 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 40948 _refine.ls_number_reflns_R_free 2183 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 91.93 _refine.ls_percent_reflns_R_free 5.1 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.11652 _refine.ls_R_factor_R_free 0.14898 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.11473 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1o08 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.050 _refine.pdbx_overall_ESU_R_Free 0.048 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.70 _refine.pdbx_solvent_shrinkage_radii 0.70 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 1.274 _refine.overall_SU_ML 0.024 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 1680 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 23 _refine_hist.number_atoms_solvent 379 _refine_hist.number_atoms_total 2082 _refine_hist.d_res_high 1.36 _refine_hist.d_res_low 20 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.014 0.019 1742 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 1661 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.741 1.989 2364 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.012 3.000 3868 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.474 5.000 221 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 39.576 25.658 76 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 11.015 15.000 305 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 16.782 15.000 7 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.287 0.200 272 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.010 0.021 1915 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 320 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 0.889 1.040 875 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 0.835 1.038 874 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 1.134 1.569 1093 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 1.142 1.571 1094 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 1.578 1.276 867 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 1.581 1.279 863 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 1.885 1.825 1264 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 2.693 15.040 2093 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 2.692 15.039 2094 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? 2.060 3.000 3403 ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? 22.969 5.000 240 ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? 7.126 5.000 3508 ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.362 _refine_ls_shell.d_res_low 1.397 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 162 _refine_ls_shell.number_reflns_R_work 2851 _refine_ls_shell.percent_reflns_obs 87.03 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.163 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.105 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5O6R _struct.title 'Structure of beta-phosphoglucomutase D10N mutant in complex with glucose-1-phosphate and aluminium tetrafluoride' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5O6R _struct_keywords.text 'phosphoryl transfer, catalysis, near attack complex, SUGAR BINDING PROTEIN' _struct_keywords.pdbx_keywords 'SUGAR BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 2 ? F N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PGMB_LACLA _struct_ref.pdbx_db_accession P71447 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNY VKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLEKMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGV APSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSYYTLEFLKEVWLQKQK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5O6R _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 221 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P71447 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 221 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 221 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5O6R ASN A 10 ? UNP P71447 ASP 10 'engineered mutation' 10 1 1 5O6R ARG A 125 ? UNP P71447 LYS 125 conflict 125 2 1 5O6R HIS A 206 ? UNP P71447 TYR 206 conflict 206 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 430 ? 1 MORE -11 ? 1 'SSA (A^2)' 10130 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 16 ? ILE A 31 ? THR A 16 ILE A 31 1 ? 16 HELX_P HELX_P2 AA2 ASP A 37 ? GLN A 43 ? ASP A 37 GLN A 43 1 ? 7 HELX_P HELX_P3 AA3 SER A 48 ? LEU A 59 ? SER A 48 LEU A 59 1 ? 12 HELX_P HELX_P4 AA4 SER A 65 ? ILE A 84 ? SER A 65 ILE A 84 1 ? 20 HELX_P HELX_P5 AA5 SER A 88 ? VAL A 92 ? SER A 88 VAL A 92 5 ? 5 HELX_P HELX_P6 AA6 GLY A 95 ? ASN A 106 ? GLY A 95 ASN A 106 1 ? 12 HELX_P HELX_P7 AA7 ASN A 118 ? MET A 126 ? ASN A 118 MET A 126 1 ? 9 HELX_P HELX_P8 AA8 LEU A 128 ? PHE A 132 ? LEU A 128 PHE A 132 5 ? 5 HELX_P HELX_P9 AA9 PRO A 148 ? VAL A 158 ? PRO A 148 VAL A 158 1 ? 11 HELX_P HELX_P10 AB1 ALA A 161 ? SER A 163 ? ALA A 161 SER A 163 5 ? 3 HELX_P HELX_P11 AB2 SER A 171 ? GLY A 182 ? SER A 171 GLY A 182 1 ? 12 HELX_P HELX_P12 AB3 ARG A 190 ? GLY A 195 ? ARG A 190 GLY A 195 1 ? 6 HELX_P HELX_P13 AB4 ASP A 203 ? TYR A 207 ? ASP A 203 TYR A 207 5 ? 5 HELX_P HELX_P14 AB5 THR A 208 ? GLN A 218 ? THR A 208 GLN A 218 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 8 OD2 ? ? ? 1_555 B MG . MG ? ? A ASP 8 A MG 301 1_555 ? ? ? ? ? ? ? 2.021 ? ? metalc2 metalc ? ? A ASN 10 O ? ? ? 1_555 B MG . MG ? ? A ASN 10 A MG 301 1_555 ? ? ? ? ? ? ? 2.052 ? ? metalc3 metalc ? ? A ASP 170 OD1 ? ? ? 1_555 B MG . MG ? ? A ASP 170 A MG 301 1_555 ? ? ? ? ? ? ? 2.059 ? ? metalc4 metalc ? ? B MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 301 A HOH 443 1_555 ? ? ? ? ? ? ? 2.084 ? ? metalc5 metalc ? ? B MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 301 A HOH 576 1_555 ? ? ? ? ? ? ? 2.061 ? ? metalc6 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 304 A HOH 530 1_555 ? ? ? ? ? ? ? 2.021 ? ? metalc7 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 304 A HOH 555 1_555 ? ? ? ? ? ? ? 1.927 ? ? metalc8 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 304 A HOH 634 1_555 ? ? ? ? ? ? ? 2.067 ? ? metalc9 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 304 A HOH 723 1_555 ? ? ? ? ? ? ? 2.066 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 8 ? A ASP 8 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? A ASN 10 ? A ASN 10 ? 1_555 91.7 ? 2 OD2 ? A ASP 8 ? A ASP 8 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 OD1 ? A ASP 170 ? A ASP 170 ? 1_555 91.2 ? 3 O ? A ASN 10 ? A ASN 10 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 OD1 ? A ASP 170 ? A ASP 170 ? 1_555 89.3 ? 4 OD2 ? A ASP 8 ? A ASP 8 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 443 ? 1_555 86.1 ? 5 O ? A ASN 10 ? A ASN 10 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 443 ? 1_555 176.8 ? 6 OD1 ? A ASP 170 ? A ASP 170 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 443 ? 1_555 88.4 ? 7 OD2 ? A ASP 8 ? A ASP 8 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 576 ? 1_555 174.9 ? 8 O ? A ASN 10 ? A ASN 10 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 576 ? 1_555 87.4 ? 9 OD1 ? A ASP 170 ? A ASP 170 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 576 ? 1_555 93.8 ? 10 O ? F HOH . ? A HOH 443 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 576 ? 1_555 95.0 ? 11 O ? F HOH . ? A HOH 530 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 O ? F HOH . ? A HOH 555 ? 1_555 97.7 ? 12 O ? F HOH . ? A HOH 530 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 O ? F HOH . ? A HOH 634 ? 1_555 71.2 ? 13 O ? F HOH . ? A HOH 555 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 O ? F HOH . ? A HOH 634 ? 1_555 88.8 ? 14 O ? F HOH . ? A HOH 530 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 O ? F HOH . ? A HOH 723 ? 1_555 84.5 ? 15 O ? F HOH . ? A HOH 555 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 O ? F HOH . ? A HOH 723 ? 1_555 177.3 ? 16 O ? F HOH . ? A HOH 634 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 O ? F HOH . ? A HOH 723 ? 1_555 93.5 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 145 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 145 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 146 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 146 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 20.25 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 134 ? ILE A 135 ? ALA A 134 ILE A 135 AA1 2 LYS A 109 ? LEU A 112 ? LYS A 109 LEU A 112 AA1 3 ALA A 4 ? PHE A 7 ? ALA A 4 PHE A 7 AA1 4 SER A 165 ? GLU A 169 ? SER A 165 GLU A 169 AA1 5 LEU A 184 ? VAL A 188 ? LEU A 184 VAL A 188 AA1 6 VAL A 199 ? VAL A 201 ? VAL A 199 VAL A 201 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ALA A 134 ? O ALA A 134 N LEU A 112 ? N LEU A 112 AA1 2 3 O ALA A 111 ? O ALA A 111 N PHE A 7 ? N PHE A 7 AA1 3 4 N LEU A 6 ? N LEU A 6 O ILE A 166 ? O ILE A 166 AA1 4 5 N GLY A 167 ? N GLY A 167 O LEU A 184 ? O LEU A 184 AA1 5 6 N GLY A 187 ? N GLY A 187 O VAL A 201 ? O VAL A 201 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 AL A ALF 303 ? ? O A HOH 407 ? ? 1.83 2 1 O A HOH 422 ? ? O A HOH 716 ? ? 1.91 3 1 OD1 A ASP 8 ? ? AL A ALF 303 ? ? 1.93 4 1 O A HOH 437 ? ? O A HOH 534 ? ? 2.15 5 1 O A HOH 698 ? ? O A HOH 716 ? ? 2.15 6 1 O A HOH 670 ? ? O A HOH 703 ? ? 2.17 7 1 O A HOH 675 ? ? O A HOH 716 ? ? 2.17 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 655 ? ? 1_555 O A HOH 703 ? ? 2_474 1.36 2 1 O A HOH 584 ? ? 1_555 O A HOH 716 ? ? 1_455 2.16 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CD A LYS 45 ? ? CE A LYS 45 ? ? NZ A LYS 45 ? ? 126.29 111.70 14.59 2.30 N 2 1 CD A LYS 82 ? ? CE A LYS 82 ? ? NZ A LYS 82 ? ? 127.98 111.70 16.28 2.30 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 9 ? ? -93.14 -74.10 2 1 LEU A 9 ? ? -96.88 -69.29 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 779 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 5.96 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LYS 219 ? A LYS 219 2 1 Y 1 A GLN 220 ? A GLN 220 3 1 Y 1 A LYS 221 ? A LYS 221 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ALF AL AL N N 14 ALF F1 F N N 15 ALF F2 F N N 16 ALF F3 F N N 17 ALF F4 F N N 18 ARG N N N N 19 ARG CA C N S 20 ARG C C N N 21 ARG O O N N 22 ARG CB C N N 23 ARG CG C N N 24 ARG CD C N N 25 ARG NE N N N 26 ARG CZ C N N 27 ARG NH1 N N N 28 ARG NH2 N N N 29 ARG OXT O N N 30 ARG H H N N 31 ARG H2 H N N 32 ARG HA H N N 33 ARG HB2 H N N 34 ARG HB3 H N N 35 ARG HG2 H N N 36 ARG HG3 H N N 37 ARG HD2 H N N 38 ARG HD3 H N N 39 ARG HE H N N 40 ARG HH11 H N N 41 ARG HH12 H N N 42 ARG HH21 H N N 43 ARG HH22 H N N 44 ARG HXT H N N 45 ASN N N N N 46 ASN CA C N S 47 ASN C C N N 48 ASN O O N N 49 ASN CB C N N 50 ASN CG C N N 51 ASN OD1 O N N 52 ASN ND2 N N N 53 ASN OXT O N N 54 ASN H H N N 55 ASN H2 H N N 56 ASN HA H N N 57 ASN HB2 H N N 58 ASN HB3 H N N 59 ASN HD21 H N N 60 ASN HD22 H N N 61 ASN HXT H N N 62 ASP N N N N 63 ASP CA C N S 64 ASP C C N N 65 ASP O O N N 66 ASP CB C N N 67 ASP CG C N N 68 ASP OD1 O N N 69 ASP OD2 O N N 70 ASP OXT O N N 71 ASP H H N N 72 ASP H2 H N N 73 ASP HA H N N 74 ASP HB2 H N N 75 ASP HB3 H N N 76 ASP HD2 H N N 77 ASP HXT H N N 78 GLN N N N N 79 GLN CA C N S 80 GLN C C N N 81 GLN O O N N 82 GLN CB C N N 83 GLN CG C N N 84 GLN CD C N N 85 GLN OE1 O N N 86 GLN NE2 N N N 87 GLN OXT O N N 88 GLN H H N N 89 GLN H2 H N N 90 GLN HA H N N 91 GLN HB2 H N N 92 GLN HB3 H N N 93 GLN HG2 H N N 94 GLN HG3 H N N 95 GLN HE21 H N N 96 GLN HE22 H N N 97 GLN HXT H N N 98 GLU N N N N 99 GLU CA C N S 100 GLU C C N N 101 GLU O O N N 102 GLU CB C N N 103 GLU CG C N N 104 GLU CD C N N 105 GLU OE1 O N N 106 GLU OE2 O N N 107 GLU OXT O N N 108 GLU H H N N 109 GLU H2 H N N 110 GLU HA H N N 111 GLU HB2 H N N 112 GLU HB3 H N N 113 GLU HG2 H N N 114 GLU HG3 H N N 115 GLU HE2 H N N 116 GLU HXT H N N 117 GLY N N N N 118 GLY CA C N N 119 GLY C C N N 120 GLY O O N N 121 GLY OXT O N N 122 GLY H H N N 123 GLY H2 H N N 124 GLY HA2 H N N 125 GLY HA3 H N N 126 GLY HXT H N N 127 HIS N N N N 128 HIS CA C N S 129 HIS C C N N 130 HIS O O N N 131 HIS CB C N N 132 HIS CG C Y N 133 HIS ND1 N Y N 134 HIS CD2 C Y N 135 HIS CE1 C Y N 136 HIS NE2 N Y N 137 HIS OXT O N N 138 HIS H H N N 139 HIS H2 H N N 140 HIS HA H N N 141 HIS HB2 H N N 142 HIS HB3 H N N 143 HIS HD1 H N N 144 HIS HD2 H N N 145 HIS HE1 H N N 146 HIS HE2 H N N 147 HIS HXT H N N 148 HOH O O N N 149 HOH H1 H N N 150 HOH H2 H N N 151 ILE N N N N 152 ILE CA C N S 153 ILE C C N N 154 ILE O O N N 155 ILE CB C N S 156 ILE CG1 C N N 157 ILE CG2 C N N 158 ILE CD1 C N N 159 ILE OXT O N N 160 ILE H H N N 161 ILE H2 H N N 162 ILE HA H N N 163 ILE HB H N N 164 ILE HG12 H N N 165 ILE HG13 H N N 166 ILE HG21 H N N 167 ILE HG22 H N N 168 ILE HG23 H N N 169 ILE HD11 H N N 170 ILE HD12 H N N 171 ILE HD13 H N N 172 ILE HXT H N N 173 LEU N N N N 174 LEU CA C N S 175 LEU C C N N 176 LEU O O N N 177 LEU CB C N N 178 LEU CG C N N 179 LEU CD1 C N N 180 LEU CD2 C N N 181 LEU OXT O N N 182 LEU H H N N 183 LEU H2 H N N 184 LEU HA H N N 185 LEU HB2 H N N 186 LEU HB3 H N N 187 LEU HG H N N 188 LEU HD11 H N N 189 LEU HD12 H N N 190 LEU HD13 H N N 191 LEU HD21 H N N 192 LEU HD22 H N N 193 LEU HD23 H N N 194 LEU HXT H N N 195 LYS N N N N 196 LYS CA C N S 197 LYS C C N N 198 LYS O O N N 199 LYS CB C N N 200 LYS CG C N N 201 LYS CD C N N 202 LYS CE C N N 203 LYS NZ N N N 204 LYS OXT O N N 205 LYS H H N N 206 LYS H2 H N N 207 LYS HA H N N 208 LYS HB2 H N N 209 LYS HB3 H N N 210 LYS HG2 H N N 211 LYS HG3 H N N 212 LYS HD2 H N N 213 LYS HD3 H N N 214 LYS HE2 H N N 215 LYS HE3 H N N 216 LYS HZ1 H N N 217 LYS HZ2 H N N 218 LYS HZ3 H N N 219 LYS HXT H N N 220 MET N N N N 221 MET CA C N S 222 MET C C N N 223 MET O O N N 224 MET CB C N N 225 MET CG C N N 226 MET SD S N N 227 MET CE C N N 228 MET OXT O N N 229 MET H H N N 230 MET H2 H N N 231 MET HA H N N 232 MET HB2 H N N 233 MET HB3 H N N 234 MET HG2 H N N 235 MET HG3 H N N 236 MET HE1 H N N 237 MET HE2 H N N 238 MET HE3 H N N 239 MET HXT H N N 240 MG MG MG N N 241 PHE N N N N 242 PHE CA C N S 243 PHE C C N N 244 PHE O O N N 245 PHE CB C N N 246 PHE CG C Y N 247 PHE CD1 C Y N 248 PHE CD2 C Y N 249 PHE CE1 C Y N 250 PHE CE2 C Y N 251 PHE CZ C Y N 252 PHE OXT O N N 253 PHE H H N N 254 PHE H2 H N N 255 PHE HA H N N 256 PHE HB2 H N N 257 PHE HB3 H N N 258 PHE HD1 H N N 259 PHE HD2 H N N 260 PHE HE1 H N N 261 PHE HE2 H N N 262 PHE HZ H N N 263 PHE HXT H N N 264 PRO N N N N 265 PRO CA C N S 266 PRO C C N N 267 PRO O O N N 268 PRO CB C N N 269 PRO CG C N N 270 PRO CD C N N 271 PRO OXT O N N 272 PRO H H N N 273 PRO HA H N N 274 PRO HB2 H N N 275 PRO HB3 H N N 276 PRO HG2 H N N 277 PRO HG3 H N N 278 PRO HD2 H N N 279 PRO HD3 H N N 280 PRO HXT H N N 281 SER N N N N 282 SER CA C N S 283 SER C C N N 284 SER O O N N 285 SER CB C N N 286 SER OG O N N 287 SER OXT O N N 288 SER H H N N 289 SER H2 H N N 290 SER HA H N N 291 SER HB2 H N N 292 SER HB3 H N N 293 SER HG H N N 294 SER HXT H N N 295 THR N N N N 296 THR CA C N S 297 THR C C N N 298 THR O O N N 299 THR CB C N R 300 THR OG1 O N N 301 THR CG2 C N N 302 THR OXT O N N 303 THR H H N N 304 THR H2 H N N 305 THR HA H N N 306 THR HB H N N 307 THR HG1 H N N 308 THR HG21 H N N 309 THR HG22 H N N 310 THR HG23 H N N 311 THR HXT H N N 312 TRP N N N N 313 TRP CA C N S 314 TRP C C N N 315 TRP O O N N 316 TRP CB C N N 317 TRP CG C Y N 318 TRP CD1 C Y N 319 TRP CD2 C Y N 320 TRP NE1 N Y N 321 TRP CE2 C Y N 322 TRP CE3 C Y N 323 TRP CZ2 C Y N 324 TRP CZ3 C Y N 325 TRP CH2 C Y N 326 TRP OXT O N N 327 TRP H H N N 328 TRP H2 H N N 329 TRP HA H N N 330 TRP HB2 H N N 331 TRP HB3 H N N 332 TRP HD1 H N N 333 TRP HE1 H N N 334 TRP HE3 H N N 335 TRP HZ2 H N N 336 TRP HZ3 H N N 337 TRP HH2 H N N 338 TRP HXT H N N 339 TYR N N N N 340 TYR CA C N S 341 TYR C C N N 342 TYR O O N N 343 TYR CB C N N 344 TYR CG C Y N 345 TYR CD1 C Y N 346 TYR CD2 C Y N 347 TYR CE1 C Y N 348 TYR CE2 C Y N 349 TYR CZ C Y N 350 TYR OH O N N 351 TYR OXT O N N 352 TYR H H N N 353 TYR H2 H N N 354 TYR HA H N N 355 TYR HB2 H N N 356 TYR HB3 H N N 357 TYR HD1 H N N 358 TYR HD2 H N N 359 TYR HE1 H N N 360 TYR HE2 H N N 361 TYR HH H N N 362 TYR HXT H N N 363 VAL N N N N 364 VAL CA C N S 365 VAL C C N N 366 VAL O O N N 367 VAL CB C N N 368 VAL CG1 C N N 369 VAL CG2 C N N 370 VAL OXT O N N 371 VAL H H N N 372 VAL H2 H N N 373 VAL HA H N N 374 VAL HB H N N 375 VAL HG11 H N N 376 VAL HG12 H N N 377 VAL HG13 H N N 378 VAL HG21 H N N 379 VAL HG22 H N N 380 VAL HG23 H N N 381 VAL HXT H N N 382 XGP P P N N 383 XGP C1 C N S 384 XGP C2 C N R 385 XGP O2 O N N 386 XGP C3 C N S 387 XGP O3 O N N 388 XGP C4 C N S 389 XGP O4 O N N 390 XGP C5 C N R 391 XGP O5 O N N 392 XGP C6 C N N 393 XGP O6 O N N 394 XGP O1 O N N 395 XGP OP2 O N N 396 XGP OP3 O N N 397 XGP OP4 O N N 398 XGP H1 H N N 399 XGP H2 H N N 400 XGP HO2 H N N 401 XGP H3 H N N 402 XGP HO3 H N N 403 XGP H4 H N N 404 XGP HO4 H N N 405 XGP H5 H N N 406 XGP H61 H N N 407 XGP H62 H N N 408 XGP HO6 H N N 409 XGP HOP3 H N N 410 XGP HOP4 H N N 411 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ALF AL F1 sing N N 13 ALF AL F2 sing N N 14 ALF AL F3 sing N N 15 ALF AL F4 sing N N 16 ARG N CA sing N N 17 ARG N H sing N N 18 ARG N H2 sing N N 19 ARG CA C sing N N 20 ARG CA CB sing N N 21 ARG CA HA sing N N 22 ARG C O doub N N 23 ARG C OXT sing N N 24 ARG CB CG sing N N 25 ARG CB HB2 sing N N 26 ARG CB HB3 sing N N 27 ARG CG CD sing N N 28 ARG CG HG2 sing N N 29 ARG CG HG3 sing N N 30 ARG CD NE sing N N 31 ARG CD HD2 sing N N 32 ARG CD HD3 sing N N 33 ARG NE CZ sing N N 34 ARG NE HE sing N N 35 ARG CZ NH1 sing N N 36 ARG CZ NH2 doub N N 37 ARG NH1 HH11 sing N N 38 ARG NH1 HH12 sing N N 39 ARG NH2 HH21 sing N N 40 ARG NH2 HH22 sing N N 41 ARG OXT HXT sing N N 42 ASN N CA sing N N 43 ASN N H sing N N 44 ASN N H2 sing N N 45 ASN CA C sing N N 46 ASN CA CB sing N N 47 ASN CA HA sing N N 48 ASN C O doub N N 49 ASN C OXT sing N N 50 ASN CB CG sing N N 51 ASN CB HB2 sing N N 52 ASN CB HB3 sing N N 53 ASN CG OD1 doub N N 54 ASN CG ND2 sing N N 55 ASN ND2 HD21 sing N N 56 ASN ND2 HD22 sing N N 57 ASN OXT HXT sing N N 58 ASP N CA sing N N 59 ASP N H sing N N 60 ASP N H2 sing N N 61 ASP CA C sing N N 62 ASP CA CB sing N N 63 ASP CA HA sing N N 64 ASP C O doub N N 65 ASP C OXT sing N N 66 ASP CB CG sing N N 67 ASP CB HB2 sing N N 68 ASP CB HB3 sing N N 69 ASP CG OD1 doub N N 70 ASP CG OD2 sing N N 71 ASP OD2 HD2 sing N N 72 ASP OXT HXT sing N N 73 GLN N CA sing N N 74 GLN N H sing N N 75 GLN N H2 sing N N 76 GLN CA C sing N N 77 GLN CA CB sing N N 78 GLN CA HA sing N N 79 GLN C O doub N N 80 GLN C OXT sing N N 81 GLN CB CG sing N N 82 GLN CB HB2 sing N N 83 GLN CB HB3 sing N N 84 GLN CG CD sing N N 85 GLN CG HG2 sing N N 86 GLN CG HG3 sing N N 87 GLN CD OE1 doub N N 88 GLN CD NE2 sing N N 89 GLN NE2 HE21 sing N N 90 GLN NE2 HE22 sing N N 91 GLN OXT HXT sing N N 92 GLU N CA sing N N 93 GLU N H sing N N 94 GLU N H2 sing N N 95 GLU CA C sing N N 96 GLU CA CB sing N N 97 GLU CA HA sing N N 98 GLU C O doub N N 99 GLU C OXT sing N N 100 GLU CB CG sing N N 101 GLU CB HB2 sing N N 102 GLU CB HB3 sing N N 103 GLU CG CD sing N N 104 GLU CG HG2 sing N N 105 GLU CG HG3 sing N N 106 GLU CD OE1 doub N N 107 GLU CD OE2 sing N N 108 GLU OE2 HE2 sing N N 109 GLU OXT HXT sing N N 110 GLY N CA sing N N 111 GLY N H sing N N 112 GLY N H2 sing N N 113 GLY CA C sing N N 114 GLY CA HA2 sing N N 115 GLY CA HA3 sing N N 116 GLY C O doub N N 117 GLY C OXT sing N N 118 GLY OXT HXT sing N N 119 HIS N CA sing N N 120 HIS N H sing N N 121 HIS N H2 sing N N 122 HIS CA C sing N N 123 HIS CA CB sing N N 124 HIS CA HA sing N N 125 HIS C O doub N N 126 HIS C OXT sing N N 127 HIS CB CG sing N N 128 HIS CB HB2 sing N N 129 HIS CB HB3 sing N N 130 HIS CG ND1 sing Y N 131 HIS CG CD2 doub Y N 132 HIS ND1 CE1 doub Y N 133 HIS ND1 HD1 sing N N 134 HIS CD2 NE2 sing Y N 135 HIS CD2 HD2 sing N N 136 HIS CE1 NE2 sing Y N 137 HIS CE1 HE1 sing N N 138 HIS NE2 HE2 sing N N 139 HIS OXT HXT sing N N 140 HOH O H1 sing N N 141 HOH O H2 sing N N 142 ILE N CA sing N N 143 ILE N H sing N N 144 ILE N H2 sing N N 145 ILE CA C sing N N 146 ILE CA CB sing N N 147 ILE CA HA sing N N 148 ILE C O doub N N 149 ILE C OXT sing N N 150 ILE CB CG1 sing N N 151 ILE CB CG2 sing N N 152 ILE CB HB sing N N 153 ILE CG1 CD1 sing N N 154 ILE CG1 HG12 sing N N 155 ILE CG1 HG13 sing N N 156 ILE CG2 HG21 sing N N 157 ILE CG2 HG22 sing N N 158 ILE CG2 HG23 sing N N 159 ILE CD1 HD11 sing N N 160 ILE CD1 HD12 sing N N 161 ILE CD1 HD13 sing N N 162 ILE OXT HXT sing N N 163 LEU N CA sing N N 164 LEU N H sing N N 165 LEU N H2 sing N N 166 LEU CA C sing N N 167 LEU CA CB sing N N 168 LEU CA HA sing N N 169 LEU C O doub N N 170 LEU C OXT sing N N 171 LEU CB CG sing N N 172 LEU CB HB2 sing N N 173 LEU CB HB3 sing N N 174 LEU CG CD1 sing N N 175 LEU CG CD2 sing N N 176 LEU CG HG sing N N 177 LEU CD1 HD11 sing N N 178 LEU CD1 HD12 sing N N 179 LEU CD1 HD13 sing N N 180 LEU CD2 HD21 sing N N 181 LEU CD2 HD22 sing N N 182 LEU CD2 HD23 sing N N 183 LEU OXT HXT sing N N 184 LYS N CA sing N N 185 LYS N H sing N N 186 LYS N H2 sing N N 187 LYS CA C sing N N 188 LYS CA CB sing N N 189 LYS CA HA sing N N 190 LYS C O doub N N 191 LYS C OXT sing N N 192 LYS CB CG sing N N 193 LYS CB HB2 sing N N 194 LYS CB HB3 sing N N 195 LYS CG CD sing N N 196 LYS CG HG2 sing N N 197 LYS CG HG3 sing N N 198 LYS CD CE sing N N 199 LYS CD HD2 sing N N 200 LYS CD HD3 sing N N 201 LYS CE NZ sing N N 202 LYS CE HE2 sing N N 203 LYS CE HE3 sing N N 204 LYS NZ HZ1 sing N N 205 LYS NZ HZ2 sing N N 206 LYS NZ HZ3 sing N N 207 LYS OXT HXT sing N N 208 MET N CA sing N N 209 MET N H sing N N 210 MET N H2 sing N N 211 MET CA C sing N N 212 MET CA CB sing N N 213 MET CA HA sing N N 214 MET C O doub N N 215 MET C OXT sing N N 216 MET CB CG sing N N 217 MET CB HB2 sing N N 218 MET CB HB3 sing N N 219 MET CG SD sing N N 220 MET CG HG2 sing N N 221 MET CG HG3 sing N N 222 MET SD CE sing N N 223 MET CE HE1 sing N N 224 MET CE HE2 sing N N 225 MET CE HE3 sing N N 226 MET OXT HXT sing N N 227 PHE N CA sing N N 228 PHE N H sing N N 229 PHE N H2 sing N N 230 PHE CA C sing N N 231 PHE CA CB sing N N 232 PHE CA HA sing N N 233 PHE C O doub N N 234 PHE C OXT sing N N 235 PHE CB CG sing N N 236 PHE CB HB2 sing N N 237 PHE CB HB3 sing N N 238 PHE CG CD1 doub Y N 239 PHE CG CD2 sing Y N 240 PHE CD1 CE1 sing Y N 241 PHE CD1 HD1 sing N N 242 PHE CD2 CE2 doub Y N 243 PHE CD2 HD2 sing N N 244 PHE CE1 CZ doub Y N 245 PHE CE1 HE1 sing N N 246 PHE CE2 CZ sing Y N 247 PHE CE2 HE2 sing N N 248 PHE CZ HZ sing N N 249 PHE OXT HXT sing N N 250 PRO N CA sing N N 251 PRO N CD sing N N 252 PRO N H sing N N 253 PRO CA C sing N N 254 PRO CA CB sing N N 255 PRO CA HA sing N N 256 PRO C O doub N N 257 PRO C OXT sing N N 258 PRO CB CG sing N N 259 PRO CB HB2 sing N N 260 PRO CB HB3 sing N N 261 PRO CG CD sing N N 262 PRO CG HG2 sing N N 263 PRO CG HG3 sing N N 264 PRO CD HD2 sing N N 265 PRO CD HD3 sing N N 266 PRO OXT HXT sing N N 267 SER N CA sing N N 268 SER N H sing N N 269 SER N H2 sing N N 270 SER CA C sing N N 271 SER CA CB sing N N 272 SER CA HA sing N N 273 SER C O doub N N 274 SER C OXT sing N N 275 SER CB OG sing N N 276 SER CB HB2 sing N N 277 SER CB HB3 sing N N 278 SER OG HG sing N N 279 SER OXT HXT sing N N 280 THR N CA sing N N 281 THR N H sing N N 282 THR N H2 sing N N 283 THR CA C sing N N 284 THR CA CB sing N N 285 THR CA HA sing N N 286 THR C O doub N N 287 THR C OXT sing N N 288 THR CB OG1 sing N N 289 THR CB CG2 sing N N 290 THR CB HB sing N N 291 THR OG1 HG1 sing N N 292 THR CG2 HG21 sing N N 293 THR CG2 HG22 sing N N 294 THR CG2 HG23 sing N N 295 THR OXT HXT sing N N 296 TRP N CA sing N N 297 TRP N H sing N N 298 TRP N H2 sing N N 299 TRP CA C sing N N 300 TRP CA CB sing N N 301 TRP CA HA sing N N 302 TRP C O doub N N 303 TRP C OXT sing N N 304 TRP CB CG sing N N 305 TRP CB HB2 sing N N 306 TRP CB HB3 sing N N 307 TRP CG CD1 doub Y N 308 TRP CG CD2 sing Y N 309 TRP CD1 NE1 sing Y N 310 TRP CD1 HD1 sing N N 311 TRP CD2 CE2 doub Y N 312 TRP CD2 CE3 sing Y N 313 TRP NE1 CE2 sing Y N 314 TRP NE1 HE1 sing N N 315 TRP CE2 CZ2 sing Y N 316 TRP CE3 CZ3 doub Y N 317 TRP CE3 HE3 sing N N 318 TRP CZ2 CH2 doub Y N 319 TRP CZ2 HZ2 sing N N 320 TRP CZ3 CH2 sing Y N 321 TRP CZ3 HZ3 sing N N 322 TRP CH2 HH2 sing N N 323 TRP OXT HXT sing N N 324 TYR N CA sing N N 325 TYR N H sing N N 326 TYR N H2 sing N N 327 TYR CA C sing N N 328 TYR CA CB sing N N 329 TYR CA HA sing N N 330 TYR C O doub N N 331 TYR C OXT sing N N 332 TYR CB CG sing N N 333 TYR CB HB2 sing N N 334 TYR CB HB3 sing N N 335 TYR CG CD1 doub Y N 336 TYR CG CD2 sing Y N 337 TYR CD1 CE1 sing Y N 338 TYR CD1 HD1 sing N N 339 TYR CD2 CE2 doub Y N 340 TYR CD2 HD2 sing N N 341 TYR CE1 CZ doub Y N 342 TYR CE1 HE1 sing N N 343 TYR CE2 CZ sing Y N 344 TYR CE2 HE2 sing N N 345 TYR CZ OH sing N N 346 TYR OH HH sing N N 347 TYR OXT HXT sing N N 348 VAL N CA sing N N 349 VAL N H sing N N 350 VAL N H2 sing N N 351 VAL CA C sing N N 352 VAL CA CB sing N N 353 VAL CA HA sing N N 354 VAL C O doub N N 355 VAL C OXT sing N N 356 VAL CB CG1 sing N N 357 VAL CB CG2 sing N N 358 VAL CB HB sing N N 359 VAL CG1 HG11 sing N N 360 VAL CG1 HG12 sing N N 361 VAL CG1 HG13 sing N N 362 VAL CG2 HG21 sing N N 363 VAL CG2 HG22 sing N N 364 VAL CG2 HG23 sing N N 365 VAL OXT HXT sing N N 366 XGP OP2 P doub N N 367 XGP P O1 sing N N 368 XGP P OP3 sing N N 369 XGP P OP4 sing N N 370 XGP O5 C1 sing N N 371 XGP C1 O1 sing N N 372 XGP C1 C2 sing N N 373 XGP C1 H1 sing N N 374 XGP C3 C2 sing N N 375 XGP C2 O2 sing N N 376 XGP C2 H2 sing N N 377 XGP O2 HO2 sing N N 378 XGP C4 C3 sing N N 379 XGP C3 O3 sing N N 380 XGP C3 H3 sing N N 381 XGP O3 HO3 sing N N 382 XGP O4 C4 sing N N 383 XGP C5 C4 sing N N 384 XGP C4 H4 sing N N 385 XGP O4 HO4 sing N N 386 XGP C6 C5 sing N N 387 XGP C5 O5 sing N N 388 XGP C5 H5 sing N N 389 XGP O6 C6 sing N N 390 XGP C6 H61 sing N N 391 XGP C6 H62 sing N N 392 XGP O6 HO6 sing N N 393 XGP OP3 HOP3 sing N N 394 XGP OP4 HOP4 sing N N 395 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 XGP ? ? XGP ? ? 'SUBJECT OF INVESTIGATION' ? 2 ALF ? ? ALF ? ? 'SUBJECT OF INVESTIGATION' ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1O08 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 5O6R _atom_sites.fract_transf_matrix[1][1] 0.027548 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018215 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009297 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol AL C F MG N O P S # loop_