data_5OBJ # _entry.id 5OBJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.284 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5OBJ WWPDB D_1200005535 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5OBJ _pdbx_database_status.recvd_initial_deposition_date 2017-06-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Rossmann, M.' 1 0000-0001-8811-3277 'Janecek, M.' 2 ? 'Hyvonen, M.' 3 0000-0001-8683-4070 # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.unpublished_flag ? ? ? ? ? ? ? UK ? ? primary 'Chem. Commun. (Camb.)' ? ? 1364-548X ? ? 53 ? 9372 9375 'Computationally-guided optimization of small-molecule inhibitors of the Aurora A kinase-TPX2 protein-protein interaction.' 2017 ? 10.1039/c7cc05379g 28787041 ? ? ? ? ? ? ? ? UK ? ? 1 'Sci Rep' ? ? 2045-2322 ? ? 6 ? 28528 ? 'Allosteric modulation of AURKA kinase activity by a small-molecule inhibitor of its protein-protein interaction with TPX2.' 2016 ? 10.1038/srep28528 27339427 ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Cole, D.J.' 1 primary 'Janecek, M.' 2 primary 'Stokes, J.E.' 3 primary 'Rossmann, M.' 4 primary 'Faver, J.C.' 5 primary 'McKenzie, G.J.' 6 primary 'Venkitaraman, A.R.' 7 primary 'Hyvonen, M.' 8 primary 'Spring, D.R.' 9 primary 'Huggins, D.J.' 10 primary 'Jorgensen, W.L.' 11 1 'Janecek, M.' 12 1 'Rossmann, M.' 13 1 'Sharma, P.' 14 1 'Emery, A.' 15 1 'Huggins, D.J.' 16 1 'Stockwell, S.R.' 17 1 'Stokes, J.E.' 18 1 'Tan, Y.S.' 19 1 'Almeida, E.G.' 20 1 'Hardwick, B.' 21 1 'Narvaez, A.J.' 22 1 'Hyvonen, M.' 23 1 'Spring, D.R.' 24 1 'McKenzie, G.J.' 25 1 'Venkitaraman, A.R.' 26 # _cell.entry_id 5OBJ _cell.length_a 83.410 _cell.length_b 83.410 _cell.length_c 172.090 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5OBJ _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Aurora kinase A' 31456.150 1 2.7.11.1 ? ? 'Aurora A kinase domain' 2 non-polymer syn 'MAGNESIUM ION' 24.305 2 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 4 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE" 507.181 1 ? ? ? ? 5 non-polymer syn '2-(3-fluorophenyl)quinoline-4-carboxylic acid' 267.255 1 ? ? ? ? 6 water nat water 18.015 3 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Aurora 2,Aurora/IPL1-related kinase 1,hARK1,Breast tumor-amplified kinase,Serine/threonine-protein kinase 15,Serine/threonine-protein kinase 6,Serine/threonine-protein kinase aurora-A ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSMGSKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGY FHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSV HAPSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDL ISRLLKHNPSQRPMLREVLEHPWITANSSKPS ; _entity_poly.pdbx_seq_one_letter_code_can ;GSMGSKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGY FHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSV HAPSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDL ISRLLKHNPSQRPMLREVLEHPWITANSSKPS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MET n 1 4 GLY n 1 5 SER n 1 6 LYS n 1 7 ARG n 1 8 GLN n 1 9 TRP n 1 10 ALA n 1 11 LEU n 1 12 GLU n 1 13 ASP n 1 14 PHE n 1 15 GLU n 1 16 ILE n 1 17 GLY n 1 18 ARG n 1 19 PRO n 1 20 LEU n 1 21 GLY n 1 22 LYS n 1 23 GLY n 1 24 LYS n 1 25 PHE n 1 26 GLY n 1 27 ASN n 1 28 VAL n 1 29 TYR n 1 30 LEU n 1 31 ALA n 1 32 ARG n 1 33 GLU n 1 34 LYS n 1 35 GLN n 1 36 SER n 1 37 LYS n 1 38 PHE n 1 39 ILE n 1 40 LEU n 1 41 ALA n 1 42 LEU n 1 43 LYS n 1 44 VAL n 1 45 LEU n 1 46 PHE n 1 47 LYS n 1 48 ALA n 1 49 GLN n 1 50 LEU n 1 51 GLU n 1 52 LYS n 1 53 ALA n 1 54 GLY n 1 55 VAL n 1 56 GLU n 1 57 HIS n 1 58 GLN n 1 59 LEU n 1 60 ARG n 1 61 ARG n 1 62 GLU n 1 63 VAL n 1 64 GLU n 1 65 ILE n 1 66 GLN n 1 67 SER n 1 68 HIS n 1 69 LEU n 1 70 ARG n 1 71 HIS n 1 72 PRO n 1 73 ASN n 1 74 ILE n 1 75 LEU n 1 76 ARG n 1 77 LEU n 1 78 TYR n 1 79 GLY n 1 80 TYR n 1 81 PHE n 1 82 HIS n 1 83 ASP n 1 84 ALA n 1 85 THR n 1 86 ARG n 1 87 VAL n 1 88 TYR n 1 89 LEU n 1 90 ILE n 1 91 LEU n 1 92 GLU n 1 93 TYR n 1 94 ALA n 1 95 PRO n 1 96 LEU n 1 97 GLY n 1 98 THR n 1 99 VAL n 1 100 TYR n 1 101 ARG n 1 102 GLU n 1 103 LEU n 1 104 GLN n 1 105 LYS n 1 106 LEU n 1 107 SER n 1 108 LYS n 1 109 PHE n 1 110 ASP n 1 111 GLU n 1 112 GLN n 1 113 ARG n 1 114 THR n 1 115 ALA n 1 116 THR n 1 117 TYR n 1 118 ILE n 1 119 THR n 1 120 GLU n 1 121 LEU n 1 122 ALA n 1 123 ASN n 1 124 ALA n 1 125 LEU n 1 126 SER n 1 127 TYR n 1 128 CYS n 1 129 HIS n 1 130 SER n 1 131 LYS n 1 132 ARG n 1 133 VAL n 1 134 ILE n 1 135 HIS n 1 136 ARG n 1 137 ASP n 1 138 ILE n 1 139 LYS n 1 140 PRO n 1 141 GLU n 1 142 ASN n 1 143 LEU n 1 144 LEU n 1 145 LEU n 1 146 GLY n 1 147 SER n 1 148 ALA n 1 149 GLY n 1 150 GLU n 1 151 LEU n 1 152 LYS n 1 153 ILE n 1 154 ALA n 1 155 ASP n 1 156 PHE n 1 157 GLY n 1 158 TRP n 1 159 SER n 1 160 VAL n 1 161 HIS n 1 162 ALA n 1 163 PRO n 1 164 SER n 1 165 SER n 1 166 ARG n 1 167 ARG n 1 168 THR n 1 169 THR n 1 170 LEU n 1 171 CYS n 1 172 GLY n 1 173 THR n 1 174 LEU n 1 175 ASP n 1 176 TYR n 1 177 LEU n 1 178 PRO n 1 179 PRO n 1 180 GLU n 1 181 MET n 1 182 ILE n 1 183 GLU n 1 184 GLY n 1 185 ARG n 1 186 MET n 1 187 HIS n 1 188 ASP n 1 189 GLU n 1 190 LYS n 1 191 VAL n 1 192 ASP n 1 193 LEU n 1 194 TRP n 1 195 SER n 1 196 LEU n 1 197 GLY n 1 198 VAL n 1 199 LEU n 1 200 CYS n 1 201 TYR n 1 202 GLU n 1 203 PHE n 1 204 LEU n 1 205 VAL n 1 206 GLY n 1 207 LYS n 1 208 PRO n 1 209 PRO n 1 210 PHE n 1 211 GLU n 1 212 ALA n 1 213 ASN n 1 214 THR n 1 215 TYR n 1 216 GLN n 1 217 GLU n 1 218 THR n 1 219 TYR n 1 220 LYS n 1 221 ARG n 1 222 ILE n 1 223 SER n 1 224 ARG n 1 225 VAL n 1 226 GLU n 1 227 PHE n 1 228 THR n 1 229 PHE n 1 230 PRO n 1 231 ASP n 1 232 PHE n 1 233 VAL n 1 234 THR n 1 235 GLU n 1 236 GLY n 1 237 ALA n 1 238 ARG n 1 239 ASP n 1 240 LEU n 1 241 ILE n 1 242 SER n 1 243 ARG n 1 244 LEU n 1 245 LEU n 1 246 LYS n 1 247 HIS n 1 248 ASN n 1 249 PRO n 1 250 SER n 1 251 GLN n 1 252 ARG n 1 253 PRO n 1 254 MET n 1 255 LEU n 1 256 ARG n 1 257 GLU n 1 258 VAL n 1 259 LEU n 1 260 GLU n 1 261 HIS n 1 262 PRO n 1 263 TRP n 1 264 ILE n 1 265 THR n 1 266 ALA n 1 267 ASN n 1 268 SER n 1 269 SER n 1 270 LYS n 1 271 PRO n 1 272 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 272 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'AURKA, AIK, AIRK1, ARK1, AURA, AYK1, BTAK, IAK1, STK15, STK6' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant pUBS520 _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pHAT4 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AURKA_HUMAN _struct_ref.pdbx_db_accession O14965 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDAT RVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSS RRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLL KHNPSQRPMLREVLEHPWITANSSKPS ; _struct_ref.pdbx_align_begin 125 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5OBJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 272 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O14965 _struct_ref_seq.db_align_beg 125 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 391 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 125 _struct_ref_seq.pdbx_auth_seq_align_end 391 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5OBJ GLY A 1 ? UNP O14965 ? ? 'expression tag' 120 1 1 5OBJ SER A 2 ? UNP O14965 ? ? 'expression tag' 121 2 1 5OBJ MET A 3 ? UNP O14965 ? ? 'expression tag' 122 3 1 5OBJ GLY A 4 ? UNP O14965 ? ? 'expression tag' 123 4 1 5OBJ SER A 5 ? UNP O14965 ? ? 'expression tag' 124 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 9QK non-polymer . '2-(3-fluorophenyl)quinoline-4-carboxylic acid' ? 'C16 H10 F N O2' 267.255 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 ATP non-polymer . "ADENOSINE-5'-TRIPHOSPHATE" ? 'C10 H16 N5 O13 P3' 507.181 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5OBJ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.75 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 55.22 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 292 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '50 MM HEPES, 200 MM MAGNESIUM SULFATE, 20% PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-02-15 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9200 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9200 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04-1 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5OBJ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.90 _reflns.d_resolution_low 72.24 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8428 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.5 _reflns.pdbx_Rmerge_I_obs 0.017 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 24.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.066 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.0 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.90 _reflns_shell.d_res_low 3.00 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.5 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 604 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.188 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 8.1 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.731 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.90 _reflns_shell.pdbx_R_split ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5OBJ _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 8382 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.37 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 55.324 _refine.ls_d_res_high 2.901 _refine.ls_percent_reflns_obs 99.66 _refine.ls_R_factor_obs 0.2154 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2137 _refine.ls_R_factor_R_free 0.2455 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.64 _refine.ls_number_reflns_R_free 389 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values MLHL _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.29 _refine.pdbx_overall_phase_error 25.07 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2125 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 58 _refine_hist.number_atoms_solvent 3 _refine_hist.number_atoms_total 2186 _refine_hist.d_res_high 2.901 _refine_hist.d_res_low 55.324 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.010 ? ? 2238 'X-RAY DIFFRACTION' ? f_angle_d 1.188 ? ? 3035 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 9.564 ? ? 1342 'X-RAY DIFFRACTION' ? f_chiral_restr 0.057 ? ? 320 'X-RAY DIFFRACTION' ? f_plane_restr 0.006 ? ? 403 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all 'X-RAY DIFFRACTION' . 2.9005 3.3202 2594 0.2657 100.00 0.2956 . . 117 . . 'X-RAY DIFFRACTION' . 3.3202 4.1829 2615 0.2180 99.00 0.2765 . . 129 . . 'X-RAY DIFFRACTION' . 4.1829 55.3344 2784 0.1997 100.00 0.2214 . . 143 . . # _struct.entry_id 5OBJ _struct.title 'Aurora A kinase in complex with 2-(3-fluorophenyl)quinoline-4-carboxylic acid and ATP' _struct.pdbx_descriptor 'Aurora kinase A (E.C.2.7.11.1)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5OBJ _struct_keywords.text 'inhibitor, kinase, allostery, protein-protein interface, CELL CYCLE' _struct_keywords.pdbx_keywords 'CELL CYCLE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 5 ? G N N 6 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 10 ? GLU A 12 ? ALA A 129 GLU A 131 5 ? 3 HELX_P HELX_P2 AA2 LYS A 47 ? GLY A 54 ? LYS A 166 GLY A 173 1 ? 8 HELX_P HELX_P3 AA3 VAL A 55 ? HIS A 68 ? VAL A 174 HIS A 187 1 ? 14 HELX_P HELX_P4 AA4 THR A 98 ? SER A 107 ? THR A 217 SER A 226 1 ? 10 HELX_P HELX_P5 AA5 ASP A 110 ? LYS A 131 ? ASP A 229 LYS A 250 1 ? 22 HELX_P HELX_P6 AA6 LYS A 139 ? GLU A 141 ? LYS A 258 GLU A 260 5 ? 3 HELX_P HELX_P7 AA7 THR A 173 ? LEU A 177 ? THR A 292 LEU A 296 5 ? 5 HELX_P HELX_P8 AA8 PRO A 178 ? GLU A 183 ? PRO A 297 GLU A 302 1 ? 6 HELX_P HELX_P9 AA9 LYS A 190 ? GLY A 206 ? LYS A 309 GLY A 325 1 ? 17 HELX_P HELX_P10 AB1 THR A 214 ? VAL A 225 ? THR A 333 VAL A 344 1 ? 12 HELX_P HELX_P11 AB2 THR A 234 ? LEU A 245 ? THR A 353 LEU A 364 1 ? 12 HELX_P HELX_P12 AB3 ASN A 248 ? ARG A 252 ? ASN A 367 ARG A 371 5 ? 5 HELX_P HELX_P13 AB4 MET A 254 ? GLU A 260 ? MET A 373 GLU A 379 1 ? 7 HELX_P HELX_P14 AB5 HIS A 261 ? SER A 268 ? HIS A 380 SER A 387 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A ASN 142 OD1 ? ? ? 1_555 B MG . MG ? ? A ASN 261 A MG 401 1_555 ? ? ? ? ? ? ? 1.957 ? metalc2 metalc ? ? B MG . MG ? ? ? 1_555 E ATP . O1B ? ? A MG 401 A ATP 404 1_555 ? ? ? ? ? ? ? 2.542 ? metalc3 metalc ? ? B MG . MG ? ? ? 1_555 E ATP . O2A ? ? A MG 401 A ATP 404 1_555 ? ? ? ? ? ? ? 2.143 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 162 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 281 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 163 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 282 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -4.29 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 14 ? GLY A 23 ? PHE A 133 GLY A 142 AA1 2 GLY A 26 ? GLU A 33 ? GLY A 145 GLU A 152 AA1 3 ILE A 39 ? PHE A 46 ? ILE A 158 PHE A 165 AA1 4 ARG A 86 ? LEU A 91 ? ARG A 205 LEU A 210 AA1 5 LEU A 77 ? HIS A 82 ? LEU A 196 HIS A 201 AA2 1 VAL A 133 ? ILE A 134 ? VAL A 252 ILE A 253 AA2 2 VAL A 160 ? HIS A 161 ? VAL A 279 HIS A 280 AA3 1 LEU A 143 ? LEU A 145 ? LEU A 262 LEU A 264 AA3 2 LEU A 151 ? ILE A 153 ? LEU A 270 ILE A 272 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 23 ? N GLY A 142 O GLY A 26 ? O GLY A 145 AA1 2 3 N ASN A 27 ? N ASN A 146 O VAL A 44 ? O VAL A 163 AA1 3 4 N LEU A 45 ? N LEU A 164 O VAL A 87 ? O VAL A 206 AA1 4 5 O TYR A 88 ? O TYR A 207 N PHE A 81 ? N PHE A 200 AA2 1 2 N ILE A 134 ? N ILE A 253 O VAL A 160 ? O VAL A 279 AA3 1 2 N LEU A 144 ? N LEU A 263 O LYS A 152 ? O LYS A 271 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MG 401 ? 2 'binding site for residue MG A 401' AC2 Software A MG 402 ? 4 'binding site for residue MG A 402' AC3 Software A SO4 403 ? 2 'binding site for residue SO4 A 403' AC4 Software A ATP 404 ? 16 'binding site for residue ATP A 404' AC5 Software A 9QK 405 ? 10 'binding site for residue 9QK A 405' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 ASN A 142 ? ASN A 261 . ? 1_555 ? 2 AC1 2 ATP E . ? ATP A 404 . ? 1_555 ? 3 AC2 4 GLU A 56 ? GLU A 175 . ? 1_555 ? 4 AC2 4 GLU A 56 ? GLU A 175 . ? 10_554 ? 5 AC2 4 9QK F . ? 9QK A 405 . ? 1_555 ? 6 AC2 4 9QK F . ? 9QK A 405 . ? 10_554 ? 7 AC3 2 ARG A 60 ? ARG A 179 . ? 1_555 ? 8 AC3 2 HIS A 82 ? HIS A 201 . ? 1_555 ? 9 AC4 16 GLY A 21 ? GLY A 140 . ? 1_555 ? 10 AC4 16 LYS A 22 ? LYS A 141 . ? 1_555 ? 11 AC4 16 GLY A 23 ? GLY A 142 . ? 1_555 ? 12 AC4 16 LYS A 24 ? LYS A 143 . ? 1_555 ? 13 AC4 16 PHE A 25 ? PHE A 144 . ? 1_555 ? 14 AC4 16 VAL A 28 ? VAL A 147 . ? 1_555 ? 15 AC4 16 ALA A 41 ? ALA A 160 . ? 1_555 ? 16 AC4 16 LYS A 43 ? LYS A 162 . ? 1_555 ? 17 AC4 16 GLU A 92 ? GLU A 211 . ? 1_555 ? 18 AC4 16 ALA A 94 ? ALA A 213 . ? 1_555 ? 19 AC4 16 THR A 98 ? THR A 217 . ? 1_555 ? 20 AC4 16 GLU A 141 ? GLU A 260 . ? 1_555 ? 21 AC4 16 ASN A 142 ? ASN A 261 . ? 1_555 ? 22 AC4 16 LEU A 144 ? LEU A 263 . ? 1_555 ? 23 AC4 16 ASP A 155 ? ASP A 274 . ? 1_555 ? 24 AC4 16 MG B . ? MG A 401 . ? 1_555 ? 25 AC5 10 LYS A 47 ? LYS A 166 . ? 1_555 ? 26 AC5 10 GLU A 56 ? GLU A 175 . ? 1_555 ? 27 AC5 10 LEU A 59 ? LEU A 178 . ? 1_555 ? 28 AC5 10 ARG A 60 ? ARG A 179 . ? 1_555 ? 29 AC5 10 VAL A 63 ? VAL A 182 . ? 1_555 ? 30 AC5 10 TYR A 80 ? TYR A 199 . ? 1_555 ? 31 AC5 10 HIS A 82 ? HIS A 201 . ? 1_555 ? 32 AC5 10 VAL A 87 ? VAL A 206 . ? 1_555 ? 33 AC5 10 MG C . ? MG A 402 . ? 10_554 ? 34 AC5 10 MG C . ? MG A 402 . ? 1_555 ? # _atom_sites.entry_id 5OBJ _atom_sites.fract_transf_matrix[1][1] 0.011989 _atom_sites.fract_transf_matrix[1][2] 0.006922 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013844 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005811 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C F MG N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 120 ? ? ? A . n A 1 2 SER 2 121 ? ? ? A . n A 1 3 MET 3 122 ? ? ? A . n A 1 4 GLY 4 123 ? ? ? A . n A 1 5 SER 5 124 ? ? ? A . n A 1 6 LYS 6 125 ? ? ? A . n A 1 7 ARG 7 126 ? ? ? A . n A 1 8 GLN 8 127 127 GLN GLN A . n A 1 9 TRP 9 128 128 TRP TRP A . n A 1 10 ALA 10 129 129 ALA ALA A . n A 1 11 LEU 11 130 130 LEU LEU A . n A 1 12 GLU 12 131 131 GLU GLU A . n A 1 13 ASP 13 132 132 ASP ASP A . n A 1 14 PHE 14 133 133 PHE PHE A . n A 1 15 GLU 15 134 134 GLU GLU A . n A 1 16 ILE 16 135 135 ILE ILE A . n A 1 17 GLY 17 136 136 GLY GLY A . n A 1 18 ARG 18 137 137 ARG ARG A . n A 1 19 PRO 19 138 138 PRO PRO A . n A 1 20 LEU 20 139 139 LEU LEU A . n A 1 21 GLY 21 140 140 GLY GLY A . n A 1 22 LYS 22 141 141 LYS LYS A . n A 1 23 GLY 23 142 142 GLY GLY A . n A 1 24 LYS 24 143 143 LYS LYS A . n A 1 25 PHE 25 144 144 PHE PHE A . n A 1 26 GLY 26 145 145 GLY GLY A . n A 1 27 ASN 27 146 146 ASN ASN A . n A 1 28 VAL 28 147 147 VAL VAL A . n A 1 29 TYR 29 148 148 TYR TYR A . n A 1 30 LEU 30 149 149 LEU LEU A . n A 1 31 ALA 31 150 150 ALA ALA A . n A 1 32 ARG 32 151 151 ARG ARG A . n A 1 33 GLU 33 152 152 GLU GLU A . n A 1 34 LYS 34 153 153 LYS LYS A . n A 1 35 GLN 35 154 154 GLN GLN A . n A 1 36 SER 36 155 155 SER SER A . n A 1 37 LYS 37 156 156 LYS LYS A . n A 1 38 PHE 38 157 157 PHE PHE A . n A 1 39 ILE 39 158 158 ILE ILE A . n A 1 40 LEU 40 159 159 LEU LEU A . n A 1 41 ALA 41 160 160 ALA ALA A . n A 1 42 LEU 42 161 161 LEU LEU A . n A 1 43 LYS 43 162 162 LYS LYS A . n A 1 44 VAL 44 163 163 VAL VAL A . n A 1 45 LEU 45 164 164 LEU LEU A . n A 1 46 PHE 46 165 165 PHE PHE A . n A 1 47 LYS 47 166 166 LYS LYS A . n A 1 48 ALA 48 167 167 ALA ALA A . n A 1 49 GLN 49 168 168 GLN GLN A . n A 1 50 LEU 50 169 169 LEU LEU A . n A 1 51 GLU 51 170 170 GLU GLU A . n A 1 52 LYS 52 171 171 LYS LYS A . n A 1 53 ALA 53 172 172 ALA ALA A . n A 1 54 GLY 54 173 173 GLY GLY A . n A 1 55 VAL 55 174 174 VAL VAL A . n A 1 56 GLU 56 175 175 GLU GLU A . n A 1 57 HIS 57 176 176 HIS HIS A . n A 1 58 GLN 58 177 177 GLN GLN A . n A 1 59 LEU 59 178 178 LEU LEU A . n A 1 60 ARG 60 179 179 ARG ARG A . n A 1 61 ARG 61 180 180 ARG ARG A . n A 1 62 GLU 62 181 181 GLU GLU A . n A 1 63 VAL 63 182 182 VAL VAL A . n A 1 64 GLU 64 183 183 GLU GLU A . n A 1 65 ILE 65 184 184 ILE ILE A . n A 1 66 GLN 66 185 185 GLN GLN A . n A 1 67 SER 67 186 186 SER SER A . n A 1 68 HIS 68 187 187 HIS HIS A . n A 1 69 LEU 69 188 188 LEU LEU A . n A 1 70 ARG 70 189 189 ARG ARG A . n A 1 71 HIS 71 190 190 HIS HIS A . n A 1 72 PRO 72 191 191 PRO PRO A . n A 1 73 ASN 73 192 192 ASN ASN A . n A 1 74 ILE 74 193 193 ILE ILE A . n A 1 75 LEU 75 194 194 LEU LEU A . n A 1 76 ARG 76 195 195 ARG ARG A . n A 1 77 LEU 77 196 196 LEU LEU A . n A 1 78 TYR 78 197 197 TYR TYR A . n A 1 79 GLY 79 198 198 GLY GLY A . n A 1 80 TYR 80 199 199 TYR TYR A . n A 1 81 PHE 81 200 200 PHE PHE A . n A 1 82 HIS 82 201 201 HIS HIS A . n A 1 83 ASP 83 202 202 ASP ASP A . n A 1 84 ALA 84 203 203 ALA ALA A . n A 1 85 THR 85 204 204 THR THR A . n A 1 86 ARG 86 205 205 ARG ARG A . n A 1 87 VAL 87 206 206 VAL VAL A . n A 1 88 TYR 88 207 207 TYR TYR A . n A 1 89 LEU 89 208 208 LEU LEU A . n A 1 90 ILE 90 209 209 ILE ILE A . n A 1 91 LEU 91 210 210 LEU LEU A . n A 1 92 GLU 92 211 211 GLU GLU A . n A 1 93 TYR 93 212 212 TYR TYR A . n A 1 94 ALA 94 213 213 ALA ALA A . n A 1 95 PRO 95 214 214 PRO PRO A . n A 1 96 LEU 96 215 215 LEU LEU A . n A 1 97 GLY 97 216 216 GLY GLY A . n A 1 98 THR 98 217 217 THR THR A . n A 1 99 VAL 99 218 218 VAL VAL A . n A 1 100 TYR 100 219 219 TYR TYR A . n A 1 101 ARG 101 220 220 ARG ARG A . n A 1 102 GLU 102 221 221 GLU GLU A . n A 1 103 LEU 103 222 222 LEU LEU A . n A 1 104 GLN 104 223 223 GLN GLN A . n A 1 105 LYS 105 224 224 LYS LYS A . n A 1 106 LEU 106 225 225 LEU LEU A . n A 1 107 SER 107 226 226 SER SER A . n A 1 108 LYS 108 227 227 LYS LYS A . n A 1 109 PHE 109 228 228 PHE PHE A . n A 1 110 ASP 110 229 229 ASP ASP A . n A 1 111 GLU 111 230 230 GLU GLU A . n A 1 112 GLN 112 231 231 GLN GLN A . n A 1 113 ARG 113 232 232 ARG ARG A . n A 1 114 THR 114 233 233 THR THR A . n A 1 115 ALA 115 234 234 ALA ALA A . n A 1 116 THR 116 235 235 THR THR A . n A 1 117 TYR 117 236 236 TYR TYR A . n A 1 118 ILE 118 237 237 ILE ILE A . n A 1 119 THR 119 238 238 THR THR A . n A 1 120 GLU 120 239 239 GLU GLU A . n A 1 121 LEU 121 240 240 LEU LEU A . n A 1 122 ALA 122 241 241 ALA ALA A . n A 1 123 ASN 123 242 242 ASN ASN A . n A 1 124 ALA 124 243 243 ALA ALA A . n A 1 125 LEU 125 244 244 LEU LEU A . n A 1 126 SER 126 245 245 SER SER A . n A 1 127 TYR 127 246 246 TYR TYR A . n A 1 128 CYS 128 247 247 CYS CYS A . n A 1 129 HIS 129 248 248 HIS HIS A . n A 1 130 SER 130 249 249 SER SER A . n A 1 131 LYS 131 250 250 LYS LYS A . n A 1 132 ARG 132 251 251 ARG ARG A . n A 1 133 VAL 133 252 252 VAL VAL A . n A 1 134 ILE 134 253 253 ILE ILE A . n A 1 135 HIS 135 254 254 HIS HIS A . n A 1 136 ARG 136 255 255 ARG ARG A . n A 1 137 ASP 137 256 256 ASP ASP A . n A 1 138 ILE 138 257 257 ILE ILE A . n A 1 139 LYS 139 258 258 LYS LYS A . n A 1 140 PRO 140 259 259 PRO PRO A . n A 1 141 GLU 141 260 260 GLU GLU A . n A 1 142 ASN 142 261 261 ASN ASN A . n A 1 143 LEU 143 262 262 LEU LEU A . n A 1 144 LEU 144 263 263 LEU LEU A . n A 1 145 LEU 145 264 264 LEU LEU A . n A 1 146 GLY 146 265 265 GLY GLY A . n A 1 147 SER 147 266 266 SER SER A . n A 1 148 ALA 148 267 267 ALA ALA A . n A 1 149 GLY 149 268 268 GLY GLY A . n A 1 150 GLU 150 269 269 GLU GLU A . n A 1 151 LEU 151 270 270 LEU LEU A . n A 1 152 LYS 152 271 271 LYS LYS A . n A 1 153 ILE 153 272 272 ILE ILE A . n A 1 154 ALA 154 273 273 ALA ALA A . n A 1 155 ASP 155 274 274 ASP ASP A . n A 1 156 PHE 156 275 275 PHE PHE A . n A 1 157 GLY 157 276 276 GLY GLY A . n A 1 158 TRP 158 277 277 TRP TRP A . n A 1 159 SER 159 278 278 SER SER A . n A 1 160 VAL 160 279 279 VAL VAL A . n A 1 161 HIS 161 280 280 HIS HIS A . n A 1 162 ALA 162 281 281 ALA ALA A . n A 1 163 PRO 163 282 282 PRO PRO A . n A 1 164 SER 164 283 283 SER SER A . n A 1 165 SER 165 284 284 SER SER A . n A 1 166 ARG 166 285 285 ARG ARG A . n A 1 167 ARG 167 286 ? ? ? A . n A 1 168 THR 168 287 ? ? ? A . n A 1 169 THR 169 288 ? ? ? A . n A 1 170 LEU 170 289 ? ? ? A . n A 1 171 CYS 171 290 290 CYS CYS A . n A 1 172 GLY 172 291 291 GLY GLY A . n A 1 173 THR 173 292 292 THR THR A . n A 1 174 LEU 174 293 293 LEU LEU A . n A 1 175 ASP 175 294 294 ASP ASP A . n A 1 176 TYR 176 295 295 TYR TYR A . n A 1 177 LEU 177 296 296 LEU LEU A . n A 1 178 PRO 178 297 297 PRO PRO A . n A 1 179 PRO 179 298 298 PRO PRO A . n A 1 180 GLU 180 299 299 GLU GLU A . n A 1 181 MET 181 300 300 MET MET A . n A 1 182 ILE 182 301 301 ILE ILE A . n A 1 183 GLU 183 302 302 GLU GLU A . n A 1 184 GLY 184 303 303 GLY GLY A . n A 1 185 ARG 185 304 304 ARG ARG A . n A 1 186 MET 186 305 305 MET MET A . n A 1 187 HIS 187 306 306 HIS HIS A . n A 1 188 ASP 188 307 307 ASP ASP A . n A 1 189 GLU 189 308 308 GLU GLU A . n A 1 190 LYS 190 309 309 LYS LYS A . n A 1 191 VAL 191 310 310 VAL VAL A . n A 1 192 ASP 192 311 311 ASP ASP A . n A 1 193 LEU 193 312 312 LEU LEU A . n A 1 194 TRP 194 313 313 TRP TRP A . n A 1 195 SER 195 314 314 SER SER A . n A 1 196 LEU 196 315 315 LEU LEU A . n A 1 197 GLY 197 316 316 GLY GLY A . n A 1 198 VAL 198 317 317 VAL VAL A . n A 1 199 LEU 199 318 318 LEU LEU A . n A 1 200 CYS 200 319 319 CYS CYS A . n A 1 201 TYR 201 320 320 TYR TYR A . n A 1 202 GLU 202 321 321 GLU GLU A . n A 1 203 PHE 203 322 322 PHE PHE A . n A 1 204 LEU 204 323 323 LEU LEU A . n A 1 205 VAL 205 324 324 VAL VAL A . n A 1 206 GLY 206 325 325 GLY GLY A . n A 1 207 LYS 207 326 326 LYS LYS A . n A 1 208 PRO 208 327 327 PRO PRO A . n A 1 209 PRO 209 328 328 PRO PRO A . n A 1 210 PHE 210 329 329 PHE PHE A . n A 1 211 GLU 211 330 330 GLU GLU A . n A 1 212 ALA 212 331 331 ALA ALA A . n A 1 213 ASN 213 332 332 ASN ASN A . n A 1 214 THR 214 333 333 THR THR A . n A 1 215 TYR 215 334 334 TYR TYR A . n A 1 216 GLN 216 335 335 GLN GLN A . n A 1 217 GLU 217 336 336 GLU GLU A . n A 1 218 THR 218 337 337 THR THR A . n A 1 219 TYR 219 338 338 TYR TYR A . n A 1 220 LYS 220 339 339 LYS LYS A . n A 1 221 ARG 221 340 340 ARG ARG A . n A 1 222 ILE 222 341 341 ILE ILE A . n A 1 223 SER 223 342 342 SER SER A . n A 1 224 ARG 224 343 343 ARG ARG A . n A 1 225 VAL 225 344 344 VAL VAL A . n A 1 226 GLU 226 345 345 GLU GLU A . n A 1 227 PHE 227 346 346 PHE PHE A . n A 1 228 THR 228 347 347 THR THR A . n A 1 229 PHE 229 348 348 PHE PHE A . n A 1 230 PRO 230 349 349 PRO PRO A . n A 1 231 ASP 231 350 350 ASP ASP A . n A 1 232 PHE 232 351 351 PHE PHE A . n A 1 233 VAL 233 352 352 VAL VAL A . n A 1 234 THR 234 353 353 THR THR A . n A 1 235 GLU 235 354 354 GLU GLU A . n A 1 236 GLY 236 355 355 GLY GLY A . n A 1 237 ALA 237 356 356 ALA ALA A . n A 1 238 ARG 238 357 357 ARG ARG A . n A 1 239 ASP 239 358 358 ASP ASP A . n A 1 240 LEU 240 359 359 LEU LEU A . n A 1 241 ILE 241 360 360 ILE ILE A . n A 1 242 SER 242 361 361 SER SER A . n A 1 243 ARG 243 362 362 ARG ARG A . n A 1 244 LEU 244 363 363 LEU LEU A . n A 1 245 LEU 245 364 364 LEU LEU A . n A 1 246 LYS 246 365 365 LYS LYS A . n A 1 247 HIS 247 366 366 HIS HIS A . n A 1 248 ASN 248 367 367 ASN ASN A . n A 1 249 PRO 249 368 368 PRO PRO A . n A 1 250 SER 250 369 369 SER SER A . n A 1 251 GLN 251 370 370 GLN GLN A . n A 1 252 ARG 252 371 371 ARG ARG A . n A 1 253 PRO 253 372 372 PRO PRO A . n A 1 254 MET 254 373 373 MET MET A . n A 1 255 LEU 255 374 374 LEU LEU A . n A 1 256 ARG 256 375 375 ARG ARG A . n A 1 257 GLU 257 376 376 GLU GLU A . n A 1 258 VAL 258 377 377 VAL VAL A . n A 1 259 LEU 259 378 378 LEU LEU A . n A 1 260 GLU 260 379 379 GLU GLU A . n A 1 261 HIS 261 380 380 HIS HIS A . n A 1 262 PRO 262 381 381 PRO PRO A . n A 1 263 TRP 263 382 382 TRP TRP A . n A 1 264 ILE 264 383 383 ILE ILE A . n A 1 265 THR 265 384 384 THR THR A . n A 1 266 ALA 266 385 385 ALA ALA A . n A 1 267 ASN 267 386 386 ASN ASN A . n A 1 268 SER 268 387 387 SER SER A . n A 1 269 SER 269 388 388 SER SER A . n A 1 270 LYS 270 389 389 LYS LYS A . n A 1 271 PRO 271 390 390 PRO PRO A . n A 1 272 SER 272 391 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 401 1 MG MG A . C 2 MG 1 402 2 MG MG A . D 3 SO4 1 403 1 SO4 SO4 A . E 4 ATP 1 404 1 ATP ATP A . F 5 9QK 1 405 1 9QK 026 A . G 6 HOH 1 501 1 HOH HOH A . G 6 HOH 2 502 3 HOH HOH A . G 6 HOH 3 503 4 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1300 ? 1 MORE -26 ? 1 'SSA (A^2)' 13090 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id MG _pdbx_struct_special_symmetry.auth_seq_id 402 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id MG _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASN 142 ? A ASN 261 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O1B ? E ATP . ? A ATP 404 ? 1_555 173.2 ? 2 OD1 ? A ASN 142 ? A ASN 261 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O2A ? E ATP . ? A ATP 404 ? 1_555 109.4 ? 3 O1B ? E ATP . ? A ATP 404 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O2A ? E ATP . ? A ATP 404 ? 1_555 68.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-08-09 2 'Structure model' 1 1 2017-08-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_volume' 3 2 'Structure model' '_citation.page_first' 4 2 'Structure model' '_citation.page_last' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.11.1_2575: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD2 A ASP 358 ? ? NH2 A ARG 362 ? ? 1.07 2 1 OG1 A THR 333 ? ? OE2 A GLU 336 ? ? 1.98 3 1 CG A ASP 358 ? ? NH2 A ARG 362 ? ? 2.07 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 226 ? ? 69.80 -64.48 2 1 ASP A 256 ? ? -153.80 46.28 3 1 ALA A 273 ? ? -127.31 -156.34 4 1 ASP A 274 ? ? 57.90 -96.92 5 1 SER A 284 ? ? -168.30 52.09 6 1 ARG A 304 ? ? -64.44 -171.25 7 1 ASP A 307 ? ? -125.81 -142.28 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 285 ? CG ? A ARG 166 CG 2 1 Y 1 A ARG 285 ? CD ? A ARG 166 CD 3 1 Y 1 A ARG 285 ? NE ? A ARG 166 NE 4 1 Y 1 A ARG 285 ? CZ ? A ARG 166 CZ 5 1 Y 1 A ARG 285 ? NH1 ? A ARG 166 NH1 6 1 Y 1 A ARG 285 ? NH2 ? A ARG 166 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 120 ? A GLY 1 2 1 Y 1 A SER 121 ? A SER 2 3 1 Y 1 A MET 122 ? A MET 3 4 1 Y 1 A GLY 123 ? A GLY 4 5 1 Y 1 A SER 124 ? A SER 5 6 1 Y 1 A LYS 125 ? A LYS 6 7 1 Y 1 A ARG 126 ? A ARG 7 8 1 Y 1 A ARG 286 ? A ARG 167 9 1 Y 1 A THR 287 ? A THR 168 10 1 Y 1 A THR 288 ? A THR 169 11 1 Y 1 A LEU 289 ? A LEU 170 12 1 Y 1 A SER 391 ? A SER 272 # _pdbx_audit_support.funding_organization 'Wellcome Trust' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number 090340/Z/09/Z _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 'SULFATE ION' SO4 4 "ADENOSINE-5'-TRIPHOSPHATE" ATP 5 '2-(3-fluorophenyl)quinoline-4-carboxylic acid' 9QK 6 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #