data_5OEM # _entry.id 5OEM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5OEM pdb_00005oem 10.2210/pdb5oem/pdb WWPDB D_1200005672 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-01-24 2 'Structure model' 1 1 2018-01-31 3 'Structure model' 1 2 2024-01-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 3 'Structure model' '_database_2.pdbx_DOI' 5 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5OEM _pdbx_database_status.recvd_initial_deposition_date 2017-07-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Rengachari, S.' 1 ? 'Panne, D.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Proc. Natl. Acad. Sci. U.S.A.' _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 115 _citation.language ? _citation.page_first E601 _citation.page_last E609 _citation.title 'Structural basis of STAT2 recognition by IRF9 reveals molecular insights into ISGF3 function.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1718426115 _citation.pdbx_database_id_PubMed 29317535 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rengachari, S.' 1 ? primary 'Groiss, S.' 2 ? primary 'Devos, J.M.' 3 ? primary 'Caron, E.' 4 ? primary 'Grandvaux, N.' 5 ? primary 'Panne, D.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Interferon regulatory factor 9' 21242.975 1 ? ? ? ? 2 non-polymer syn 'PHOSPHATE ION' 94.971 1 ? ? ? ? 3 water nat water 18.015 32 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;IRF-9,IFN-alpha-responsive transcription factor subunit,ISGF3 p48 subunit,Interferon-stimulated gene factor 3 gamma,ISGF-3 gamma,Transcriptional regulator ISGF3 subunit gamma ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;EDPVFLEHQLPLNSDYSLLLTFIYGGRVVGKTQVHSLDCRLVAEASDSESSMEQVEFPKPDPLEPTQHLLNQLDRGVLVA SNSRGLFVQRLCPIPISWNAPEAPPGPGPHLLPSNKCVELFKTTYFCRDLAQYFQGQGPPPKFQATLHFWEESPGSSHSQ ENLITVQMEQAFARHLLEKIPEEEKAALF ; _entity_poly.pdbx_seq_one_letter_code_can ;EDPVFLEHQLPLNSDYSLLLTFIYGGRVVGKTQVHSLDCRLVAEASDSESSMEQVEFPKPDPLEPTQHLLNQLDRGVLVA SNSRGLFVQRLCPIPISWNAPEAPPGPGPHLLPSNKCVELFKTTYFCRDLAQYFQGQGPPPKFQATLHFWEESPGSSHSQ ENLITVQMEQAFARHLLEKIPEEEKAALF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PHOSPHATE ION' PO4 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 ASP n 1 3 PRO n 1 4 VAL n 1 5 PHE n 1 6 LEU n 1 7 GLU n 1 8 HIS n 1 9 GLN n 1 10 LEU n 1 11 PRO n 1 12 LEU n 1 13 ASN n 1 14 SER n 1 15 ASP n 1 16 TYR n 1 17 SER n 1 18 LEU n 1 19 LEU n 1 20 LEU n 1 21 THR n 1 22 PHE n 1 23 ILE n 1 24 TYR n 1 25 GLY n 1 26 GLY n 1 27 ARG n 1 28 VAL n 1 29 VAL n 1 30 GLY n 1 31 LYS n 1 32 THR n 1 33 GLN n 1 34 VAL n 1 35 HIS n 1 36 SER n 1 37 LEU n 1 38 ASP n 1 39 CYS n 1 40 ARG n 1 41 LEU n 1 42 VAL n 1 43 ALA n 1 44 GLU n 1 45 ALA n 1 46 SER n 1 47 ASP n 1 48 SER n 1 49 GLU n 1 50 SER n 1 51 SER n 1 52 MET n 1 53 GLU n 1 54 GLN n 1 55 VAL n 1 56 GLU n 1 57 PHE n 1 58 PRO n 1 59 LYS n 1 60 PRO n 1 61 ASP n 1 62 PRO n 1 63 LEU n 1 64 GLU n 1 65 PRO n 1 66 THR n 1 67 GLN n 1 68 HIS n 1 69 LEU n 1 70 LEU n 1 71 ASN n 1 72 GLN n 1 73 LEU n 1 74 ASP n 1 75 ARG n 1 76 GLY n 1 77 VAL n 1 78 LEU n 1 79 VAL n 1 80 ALA n 1 81 SER n 1 82 ASN n 1 83 SER n 1 84 ARG n 1 85 GLY n 1 86 LEU n 1 87 PHE n 1 88 VAL n 1 89 GLN n 1 90 ARG n 1 91 LEU n 1 92 CYS n 1 93 PRO n 1 94 ILE n 1 95 PRO n 1 96 ILE n 1 97 SER n 1 98 TRP n 1 99 ASN n 1 100 ALA n 1 101 PRO n 1 102 GLU n 1 103 ALA n 1 104 PRO n 1 105 PRO n 1 106 GLY n 1 107 PRO n 1 108 GLY n 1 109 PRO n 1 110 HIS n 1 111 LEU n 1 112 LEU n 1 113 PRO n 1 114 SER n 1 115 ASN n 1 116 LYS n 1 117 CYS n 1 118 VAL n 1 119 GLU n 1 120 LEU n 1 121 PHE n 1 122 LYS n 1 123 THR n 1 124 THR n 1 125 TYR n 1 126 PHE n 1 127 CYS n 1 128 ARG n 1 129 ASP n 1 130 LEU n 1 131 ALA n 1 132 GLN n 1 133 TYR n 1 134 PHE n 1 135 GLN n 1 136 GLY n 1 137 GLN n 1 138 GLY n 1 139 PRO n 1 140 PRO n 1 141 PRO n 1 142 LYS n 1 143 PHE n 1 144 GLN n 1 145 ALA n 1 146 THR n 1 147 LEU n 1 148 HIS n 1 149 PHE n 1 150 TRP n 1 151 GLU n 1 152 GLU n 1 153 SER n 1 154 PRO n 1 155 GLY n 1 156 SER n 1 157 SER n 1 158 HIS n 1 159 SER n 1 160 GLN n 1 161 GLU n 1 162 ASN n 1 163 LEU n 1 164 ILE n 1 165 THR n 1 166 VAL n 1 167 GLN n 1 168 MET n 1 169 GLU n 1 170 GLN n 1 171 ALA n 1 172 PHE n 1 173 ALA n 1 174 ARG n 1 175 HIS n 1 176 LEU n 1 177 LEU n 1 178 GLU n 1 179 LYS n 1 180 ILE n 1 181 PRO n 1 182 GLU n 1 183 GLU n 1 184 GLU n 1 185 LYS n 1 186 ALA n 1 187 ALA n 1 188 LEU n 1 189 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 189 _entity_src_gen.gene_src_common_name Mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Irf9, Isgf3g' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 197 197 GLU GLU A . n A 1 2 ASP 2 198 198 ASP ASP A . n A 1 3 PRO 3 199 199 PRO PRO A . n A 1 4 VAL 4 200 200 VAL VAL A . n A 1 5 PHE 5 201 201 PHE PHE A . n A 1 6 LEU 6 202 202 LEU LEU A . n A 1 7 GLU 7 203 203 GLU GLU A . n A 1 8 HIS 8 204 204 HIS HIS A . n A 1 9 GLN 9 205 205 GLN GLN A . n A 1 10 LEU 10 206 206 LEU LEU A . n A 1 11 PRO 11 207 207 PRO PRO A . n A 1 12 LEU 12 208 208 LEU LEU A . n A 1 13 ASN 13 209 209 ASN ASN A . n A 1 14 SER 14 210 210 SER SER A . n A 1 15 ASP 15 211 211 ASP ASP A . n A 1 16 TYR 16 212 212 TYR TYR A . n A 1 17 SER 17 213 213 SER SER A . n A 1 18 LEU 18 214 214 LEU LEU A . n A 1 19 LEU 19 215 215 LEU LEU A . n A 1 20 LEU 20 216 216 LEU LEU A . n A 1 21 THR 21 217 217 THR THR A . n A 1 22 PHE 22 218 218 PHE PHE A . n A 1 23 ILE 23 219 219 ILE ILE A . n A 1 24 TYR 24 220 220 TYR TYR A . n A 1 25 GLY 25 221 221 GLY GLY A . n A 1 26 GLY 26 222 222 GLY GLY A . n A 1 27 ARG 27 223 223 ARG ARG A . n A 1 28 VAL 28 224 224 VAL VAL A . n A 1 29 VAL 29 225 225 VAL VAL A . n A 1 30 GLY 30 226 226 GLY GLY A . n A 1 31 LYS 31 227 227 LYS LYS A . n A 1 32 THR 32 228 228 THR THR A . n A 1 33 GLN 33 229 229 GLN GLN A . n A 1 34 VAL 34 230 230 VAL VAL A . n A 1 35 HIS 35 231 231 HIS HIS A . n A 1 36 SER 36 232 232 SER SER A . n A 1 37 LEU 37 233 233 LEU LEU A . n A 1 38 ASP 38 234 234 ASP ASP A . n A 1 39 CYS 39 235 235 CYS CYS A . n A 1 40 ARG 40 236 236 ARG ARG A . n A 1 41 LEU 41 237 237 LEU LEU A . n A 1 42 VAL 42 238 238 VAL VAL A . n A 1 43 ALA 43 239 239 ALA ALA A . n A 1 44 GLU 44 240 240 GLU GLU A . n A 1 45 ALA 45 241 241 ALA ALA A . n A 1 46 SER 46 242 242 SER SER A . n A 1 47 ASP 47 243 243 ASP ASP A . n A 1 48 SER 48 244 244 SER SER A . n A 1 49 GLU 49 245 245 GLU GLU A . n A 1 50 SER 50 246 246 SER SER A . n A 1 51 SER 51 247 247 SER SER A . n A 1 52 MET 52 248 248 MET MET A . n A 1 53 GLU 53 249 249 GLU GLU A . n A 1 54 GLN 54 250 250 GLN GLN A . n A 1 55 VAL 55 251 251 VAL VAL A . n A 1 56 GLU 56 252 252 GLU GLU A . n A 1 57 PHE 57 253 253 PHE PHE A . n A 1 58 PRO 58 254 254 PRO PRO A . n A 1 59 LYS 59 255 255 LYS LYS A . n A 1 60 PRO 60 256 256 PRO PRO A . n A 1 61 ASP 61 257 257 ASP ASP A . n A 1 62 PRO 62 258 258 PRO PRO A . n A 1 63 LEU 63 259 259 LEU LEU A . n A 1 64 GLU 64 260 260 GLU GLU A . n A 1 65 PRO 65 261 261 PRO PRO A . n A 1 66 THR 66 262 262 THR THR A . n A 1 67 GLN 67 263 263 GLN GLN A . n A 1 68 HIS 68 264 264 HIS HIS A . n A 1 69 LEU 69 265 265 LEU LEU A . n A 1 70 LEU 70 266 266 LEU LEU A . n A 1 71 ASN 71 267 267 ASN ASN A . n A 1 72 GLN 72 268 268 GLN GLN A . n A 1 73 LEU 73 269 269 LEU LEU A . n A 1 74 ASP 74 270 270 ASP ASP A . n A 1 75 ARG 75 271 271 ARG ARG A . n A 1 76 GLY 76 272 272 GLY GLY A . n A 1 77 VAL 77 273 273 VAL VAL A . n A 1 78 LEU 78 274 274 LEU LEU A . n A 1 79 VAL 79 275 275 VAL VAL A . n A 1 80 ALA 80 276 276 ALA ALA A . n A 1 81 SER 81 277 277 SER SER A . n A 1 82 ASN 82 278 278 ASN ASN A . n A 1 83 SER 83 279 279 SER SER A . n A 1 84 ARG 84 280 280 ARG ARG A . n A 1 85 GLY 85 281 281 GLY GLY A . n A 1 86 LEU 86 282 282 LEU LEU A . n A 1 87 PHE 87 283 283 PHE PHE A . n A 1 88 VAL 88 284 284 VAL VAL A . n A 1 89 GLN 89 285 285 GLN GLN A . n A 1 90 ARG 90 286 286 ARG ARG A . n A 1 91 LEU 91 287 287 LEU LEU A . n A 1 92 CYS 92 288 288 CYS CYS A . n A 1 93 PRO 93 289 289 PRO PRO A . n A 1 94 ILE 94 290 290 ILE ILE A . n A 1 95 PRO 95 291 291 PRO PRO A . n A 1 96 ILE 96 292 292 ILE ILE A . n A 1 97 SER 97 293 293 SER SER A . n A 1 98 TRP 98 294 294 TRP TRP A . n A 1 99 ASN 99 295 295 ASN ASN A . n A 1 100 ALA 100 296 296 ALA ALA A . n A 1 101 PRO 101 297 297 PRO PRO A . n A 1 102 GLU 102 298 298 GLU GLU A . n A 1 103 ALA 103 299 299 ALA ALA A . n A 1 104 PRO 104 300 300 PRO PRO A . n A 1 105 PRO 105 301 301 PRO PRO A . n A 1 106 GLY 106 302 302 GLY GLY A . n A 1 107 PRO 107 303 303 PRO PRO A . n A 1 108 GLY 108 304 304 GLY GLY A . n A 1 109 PRO 109 305 305 PRO PRO A . n A 1 110 HIS 110 306 306 HIS HIS A . n A 1 111 LEU 111 307 307 LEU LEU A . n A 1 112 LEU 112 308 308 LEU LEU A . n A 1 113 PRO 113 309 309 PRO PRO A . n A 1 114 SER 114 310 310 SER SER A . n A 1 115 ASN 115 311 311 ASN ASN A . n A 1 116 LYS 116 312 312 LYS LYS A . n A 1 117 CYS 117 313 313 CYS CYS A . n A 1 118 VAL 118 314 314 VAL VAL A . n A 1 119 GLU 119 315 315 GLU GLU A . n A 1 120 LEU 120 316 316 LEU LEU A . n A 1 121 PHE 121 317 317 PHE PHE A . n A 1 122 LYS 122 318 318 LYS LYS A . n A 1 123 THR 123 319 319 THR THR A . n A 1 124 THR 124 320 320 THR THR A . n A 1 125 TYR 125 321 321 TYR TYR A . n A 1 126 PHE 126 322 322 PHE PHE A . n A 1 127 CYS 127 323 323 CYS CYS A . n A 1 128 ARG 128 324 324 ARG ARG A . n A 1 129 ASP 129 325 325 ASP ASP A . n A 1 130 LEU 130 326 326 LEU LEU A . n A 1 131 ALA 131 327 327 ALA ALA A . n A 1 132 GLN 132 328 328 GLN GLN A . n A 1 133 TYR 133 329 329 TYR TYR A . n A 1 134 PHE 134 330 330 PHE PHE A . n A 1 135 GLN 135 331 331 GLN GLN A . n A 1 136 GLY 136 332 332 GLY GLY A . n A 1 137 GLN 137 333 333 GLN GLN A . n A 1 138 GLY 138 334 334 GLY GLY A . n A 1 139 PRO 139 335 335 PRO PRO A . n A 1 140 PRO 140 336 336 PRO PRO A . n A 1 141 PRO 141 337 337 PRO PRO A . n A 1 142 LYS 142 338 338 LYS LYS A . n A 1 143 PHE 143 339 339 PHE PHE A . n A 1 144 GLN 144 340 340 GLN GLN A . n A 1 145 ALA 145 341 341 ALA ALA A . n A 1 146 THR 146 342 342 THR THR A . n A 1 147 LEU 147 343 343 LEU LEU A . n A 1 148 HIS 148 344 344 HIS HIS A . n A 1 149 PHE 149 345 345 PHE PHE A . n A 1 150 TRP 150 346 346 TRP TRP A . n A 1 151 GLU 151 347 347 GLU GLU A . n A 1 152 GLU 152 348 348 GLU GLU A . n A 1 153 SER 153 349 349 SER SER A . n A 1 154 PRO 154 350 350 PRO PRO A . n A 1 155 GLY 155 351 351 GLY GLY A . n A 1 156 SER 156 352 352 SER SER A . n A 1 157 SER 157 353 353 SER SER A . n A 1 158 HIS 158 354 354 HIS HIS A . n A 1 159 SER 159 355 355 SER SER A . n A 1 160 GLN 160 356 356 GLN GLN A . n A 1 161 GLU 161 357 357 GLU GLU A . n A 1 162 ASN 162 358 358 ASN ASN A . n A 1 163 LEU 163 359 359 LEU LEU A . n A 1 164 ILE 164 360 360 ILE ILE A . n A 1 165 THR 165 361 361 THR THR A . n A 1 166 VAL 166 362 362 VAL VAL A . n A 1 167 GLN 167 363 363 GLN GLN A . n A 1 168 MET 168 364 364 MET MET A . n A 1 169 GLU 169 365 365 GLU GLU A . n A 1 170 GLN 170 366 366 GLN GLN A . n A 1 171 ALA 171 367 367 ALA ALA A . n A 1 172 PHE 172 368 368 PHE PHE A . n A 1 173 ALA 173 369 369 ALA ALA A . n A 1 174 ARG 174 370 370 ARG ARG A . n A 1 175 HIS 175 371 371 HIS HIS A . n A 1 176 LEU 176 372 372 LEU LEU A . n A 1 177 LEU 177 373 373 LEU LEU A . n A 1 178 GLU 178 374 374 GLU GLU A . n A 1 179 LYS 179 375 375 LYS LYS A . n A 1 180 ILE 180 376 376 ILE ILE A . n A 1 181 PRO 181 377 377 PRO PRO A . n A 1 182 GLU 182 378 378 GLU GLU A . n A 1 183 GLU 183 379 379 GLU GLU A . n A 1 184 GLU 184 380 380 GLU GLU A . n A 1 185 LYS 185 381 381 LYS LYS A . n A 1 186 ALA 186 382 382 ALA ALA A . n A 1 187 ALA 187 383 383 ALA ALA A . n A 1 188 LEU 188 384 384 LEU LEU A . n A 1 189 PHE 189 385 385 PHE PHE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PO4 1 401 1 PO4 PO4 A . C 3 HOH 1 501 27 HOH HOH A . C 3 HOH 2 502 26 HOH HOH A . C 3 HOH 3 503 12 HOH HOH A . C 3 HOH 4 504 21 HOH HOH A . C 3 HOH 5 505 4 HOH HOH A . C 3 HOH 6 506 1 HOH HOH A . C 3 HOH 7 507 29 HOH HOH A . C 3 HOH 8 508 30 HOH HOH A . C 3 HOH 9 509 6 HOH HOH A . C 3 HOH 10 510 18 HOH HOH A . C 3 HOH 11 511 11 HOH HOH A . C 3 HOH 12 512 3 HOH HOH A . C 3 HOH 13 513 2 HOH HOH A . C 3 HOH 14 514 5 HOH HOH A . C 3 HOH 15 515 22 HOH HOH A . C 3 HOH 16 516 9 HOH HOH A . C 3 HOH 17 517 19 HOH HOH A . C 3 HOH 18 518 8 HOH HOH A . C 3 HOH 19 519 15 HOH HOH A . C 3 HOH 20 520 16 HOH HOH A . C 3 HOH 21 521 23 HOH HOH A . C 3 HOH 22 522 13 HOH HOH A . C 3 HOH 23 523 7 HOH HOH A . C 3 HOH 24 524 20 HOH HOH A . C 3 HOH 25 525 10 HOH HOH A . C 3 HOH 26 526 24 HOH HOH A . C 3 HOH 27 527 14 HOH HOH A . C 3 HOH 28 528 32 HOH HOH A . C 3 HOH 29 529 25 HOH HOH A . C 3 HOH 30 530 31 HOH HOH A . C 3 HOH 31 531 28 HOH HOH A . C 3 HOH 32 532 17 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 223 ? CG ? A ARG 27 CG 2 1 Y 1 A ARG 223 ? CD ? A ARG 27 CD 3 1 Y 1 A ARG 223 ? NE ? A ARG 27 NE 4 1 Y 1 A ARG 223 ? CZ ? A ARG 27 CZ 5 1 Y 1 A ARG 223 ? NH1 ? A ARG 27 NH1 6 1 Y 1 A ARG 223 ? NH2 ? A ARG 27 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.10_2155 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 5OEM _cell.details ? _cell.formula_units_Z ? _cell.length_a 76.770 _cell.length_a_esd ? _cell.length_b 76.770 _cell.length_b_esd ? _cell.length_c 85.605 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5OEM _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5OEM _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.43 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 64.12 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M HEPES pH 6.8, 1.5 M Ammonium phosphate monobasic and 0.1 M Ammonium sulphate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-11-08 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.966 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE MASSIF-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.966 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MASSIF-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5OEM _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.900 _reflns.d_resolution_low 35.989 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 22803 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3.000 _reflns.percent_possible_obs 96.700 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.923 _reflns.pdbx_Rmerge_I_obs 0.034 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.810 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.047 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.041 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 66645 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.900 2.010 ? 1.450 ? ? ? ? 3314 88.300 ? ? ? ? 0.656 ? ? ? ? ? ? ? ? 2.396 ? ? ? ? 0.815 ? ? 1 1 0.844 ? 2.010 2.150 ? 3.120 ? ? ? ? 3395 96.800 ? ? ? ? 0.377 ? ? ? ? ? ? ? ? 3.044 ? ? ? ? 0.456 ? ? 2 1 0.949 ? 2.150 2.320 ? 5.980 ? ? ? ? 3274 98.800 ? ? ? ? 0.179 ? ? ? ? ? ? ? ? 3.104 ? ? ? ? 0.215 ? ? 3 1 0.985 ? 2.320 2.540 ? 9.210 ? ? ? ? 3005 98.800 ? ? ? ? 0.101 ? ? ? ? ? ? ? ? 2.939 ? ? ? ? 0.123 ? ? 4 1 0.992 ? 2.540 2.840 ? 15.720 ? ? ? ? 2745 99.400 ? ? ? ? 0.058 ? ? ? ? ? ? ? ? 3.132 ? ? ? ? 0.070 ? ? 5 1 0.997 ? 2.840 3.280 ? 24.650 ? ? ? ? 2430 98.900 ? ? ? ? 0.038 ? ? ? ? ? ? ? ? 3.067 ? ? ? ? 0.045 ? ? 6 1 0.998 ? 3.280 4.010 ? 33.760 ? ? ? ? 2061 98.200 ? ? ? ? 0.026 ? ? ? ? ? ? ? ? 2.836 ? ? ? ? 0.032 ? ? 7 1 0.999 ? 4.010 5.640 ? 40.320 ? ? ? ? 1618 97.900 ? ? ? ? 0.022 ? ? ? ? ? ? ? ? 3.027 ? ? ? ? 0.027 ? ? 8 1 0.999 ? 5.640 35.989 ? 38.700 ? ? ? ? 961 96.600 ? ? ? ? 0.028 ? ? ? ? ? ? ? ? 2.688 ? ? ? ? 0.034 ? ? 9 1 0.998 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 297.710 _refine.B_iso_mean 76.8937 _refine.B_iso_min 32.890 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5OEM _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.9 _refine.ls_d_res_low 35.9890 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 38295 _refine.ls_number_reflns_R_free 1927 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 85.6700 _refine.ls_percent_reflns_R_free 5.0300 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2086 _refine.ls_R_factor_R_free 0.2421 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2069 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3dsh _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 31.3900 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2600 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.9 _refine_hist.d_res_low 35.9890 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 32 _refine_hist.number_atoms_total 1528 _refine_hist.pdbx_number_residues_total 189 _refine_hist.pdbx_B_iso_mean_ligand 68.35 _refine_hist.pdbx_B_iso_mean_solvent 55.73 _refine_hist.pdbx_number_atoms_protein 1491 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.014 ? 1539 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.263 ? 2099 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.068 ? 226 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 ? 280 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 12.578 ? 930 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.8970 1.9445 1908 . 93 1815 60.0000 . . . 0.3418 0.0000 0.3761 . . . . . . 14 . . . 'X-RAY DIFFRACTION' 1.9445 1.9970 2308 . 117 2191 71.0000 . . . 0.3435 0.0000 0.3341 . . . . . . 14 . . . 'X-RAY DIFFRACTION' 1.9970 2.0558 2611 . 132 2479 82.0000 . . . 0.3105 0.0000 0.3055 . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.0558 2.1221 2735 . 136 2599 86.0000 . . . 0.3305 0.0000 0.2925 . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.1221 2.1980 2779 . 137 2642 86.0000 . . . 0.3313 0.0000 0.2757 . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.1980 2.2860 2769 . 144 2625 88.0000 . . . 0.3216 0.0000 0.2589 . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.2860 2.3900 2818 . 139 2679 88.0000 . . . 0.2938 0.0000 0.2565 . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.3900 2.5160 2772 . 141 2631 87.0000 . . . 0.2776 0.0000 0.2520 . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.5160 2.6736 2835 . 143 2692 88.0000 . . . 0.2698 0.0000 0.2449 . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.6736 2.8799 2932 . 143 2789 92.0000 . . . 0.2888 0.0000 0.2226 . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.8799 3.1696 2944 . 148 2796 93.0000 . . . 0.2444 0.0000 0.2251 . . . . . . 14 . . . 'X-RAY DIFFRACTION' 3.1696 3.6278 2912 . 144 2768 91.0000 . . . 0.2456 0.0000 0.2077 . . . . . . 14 . . . 'X-RAY DIFFRACTION' 3.6278 4.5692 2967 . 154 2813 93.0000 . . . 0.2167 0.0000 0.1656 . . . . . . 14 . . . 'X-RAY DIFFRACTION' 4.5692 35.9957 3005 . 156 2849 93.0000 . . . 0.1933 0.0000 0.1742 . . . . . . 14 . . . # _struct.entry_id 5OEM _struct.title 'Crystal Structure of Interferon Regulatory Factor 9 IAD Domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5OEM _struct_keywords.text 'IRF9, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code IRF9_MOUSE _struct_ref.pdbx_db_accession Q61179 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EDPVFLEHQLPLNSDYSLLLTFIYGGRVVGKTQVHSLDCRLVAERSDSESSMEQVEFPKPDPLEPTQHLLNQLDRGVLVA SNSRGLFVQRLCPIPISWNAPEAPPGPGPHLLPSNKCVELFKTTYFCRDLAQYFQGQGPPPKFQATLHFWEESPGSSHSQ ENLITVQMEQAFARHLLEKIPEEEKAALF ; _struct_ref.pdbx_align_begin 197 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5OEM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 189 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q61179 _struct_ref_seq.db_align_beg 197 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 385 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 197 _struct_ref_seq.pdbx_auth_seq_align_end 385 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 5OEM _struct_ref_seq_dif.mon_id ALA _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 45 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q61179 _struct_ref_seq_dif.db_mon_id ARG _struct_ref_seq_dif.pdbx_seq_db_seq_num 241 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 241 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2170 ? 1 MORE -26 ? 1 'SSA (A^2)' 21450 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_555 y,x,-z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 65 ? ASN A 71 ? PRO A 261 ASN A 267 1 ? 7 HELX_P HELX_P2 AA2 THR A 123 ? GLN A 135 ? THR A 319 GLN A 331 1 ? 13 HELX_P HELX_P3 AA3 ALA A 171 ? PHE A 189 ? ALA A 367 PHE A 385 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ASP 2 A . ? ASP 198 A PRO 3 A ? PRO 199 A 1 -1.22 2 GLU 64 A . ? GLU 260 A PRO 65 A ? PRO 261 A 1 10.93 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 27 ? VAL A 34 ? ARG A 223 VAL A 230 AA1 2 LEU A 18 ? TYR A 24 ? LEU A 214 TYR A 220 AA1 3 GLN A 160 ? GLN A 170 ? GLN A 356 GLN A 366 AA1 4 ALA A 145 ? GLU A 152 ? ALA A 341 GLU A 348 AA1 5 ILE A 96 ? ASN A 99 ? ILE A 292 ASN A 295 AA2 1 GLU A 53 ? GLU A 56 ? GLU A 249 GLU A 252 AA2 2 ASP A 38 ? VAL A 42 ? ASP A 234 VAL A 238 AA2 3 VAL A 77 ? ASN A 82 ? VAL A 273 ASN A 278 AA2 4 GLY A 85 ? ARG A 90 ? GLY A 281 ARG A 286 AA2 5 CYS A 117 ? LYS A 122 ? CYS A 313 LYS A 318 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O VAL A 34 ? O VAL A 230 N LEU A 18 ? N LEU A 214 AA1 2 3 N LEU A 19 ? N LEU A 215 O GLU A 169 ? O GLU A 365 AA1 3 4 O VAL A 166 ? O VAL A 362 N LEU A 147 ? N LEU A 343 AA1 4 5 O HIS A 148 ? O HIS A 344 N SER A 97 ? N SER A 293 AA2 1 2 O VAL A 55 ? O VAL A 251 N ARG A 40 ? N ARG A 236 AA2 2 3 N LEU A 41 ? N LEU A 237 O VAL A 77 ? O VAL A 273 AA2 3 4 N ALA A 80 ? N ALA A 276 O PHE A 87 ? O PHE A 283 AA2 4 5 N VAL A 88 ? N VAL A 284 O VAL A 118 ? O VAL A 314 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id PO4 _struct_site.pdbx_auth_seq_id 401 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'binding site for residue PO4 A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ARG A 84 ? ARG A 280 . ? 1_555 ? 2 AC1 5 GLU A 119 ? GLU A 315 . ? 1_555 ? 3 AC1 5 LYS A 122 ? LYS A 318 . ? 1_555 ? 4 AC1 5 THR A 123 ? THR A 319 . ? 1_555 ? 5 AC1 5 THR A 124 ? THR A 320 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A LYS 255 ? ? O A HOH 501 ? ? 1.85 2 1 O A PHE 201 ? ? O A HOH 502 ? ? 2.04 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CB _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 CYS _pdbx_validate_rmsd_bond.auth_seq_id_1 313 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 SG _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 CYS _pdbx_validate_rmsd_bond.auth_seq_id_2 313 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.716 _pdbx_validate_rmsd_bond.bond_target_value 1.812 _pdbx_validate_rmsd_bond.bond_deviation -0.096 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.016 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 200 ? ? -59.05 -9.60 2 1 SER A 244 ? ? 61.25 164.62 3 1 SER A 246 ? ? 85.14 20.71 4 1 PRO A 258 ? ? -52.48 -6.48 5 1 LEU A 259 ? ? 85.13 -64.48 6 1 ASP A 270 ? ? 54.75 -122.24 # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 22.3049 _pdbx_refine_tls.origin_y 23.6272 _pdbx_refine_tls.origin_z 18.6301 _pdbx_refine_tls.T[1][1] 0.3054 _pdbx_refine_tls.T[2][2] 0.5231 _pdbx_refine_tls.T[3][3] 0.3016 _pdbx_refine_tls.T[1][2] 0.0410 _pdbx_refine_tls.T[1][3] -0.0059 _pdbx_refine_tls.T[2][3] 0.0046 _pdbx_refine_tls.L[1][1] 0.7357 _pdbx_refine_tls.L[2][2] 3.1148 _pdbx_refine_tls.L[3][3] 5.2426 _pdbx_refine_tls.L[1][2] -0.3581 _pdbx_refine_tls.L[1][3] -0.9006 _pdbx_refine_tls.L[2][3] 2.8240 _pdbx_refine_tls.S[1][1] 0.2634 _pdbx_refine_tls.S[2][2] -0.2498 _pdbx_refine_tls.S[3][3] -0.0629 _pdbx_refine_tls.S[1][2] 0.0553 _pdbx_refine_tls.S[1][3] 0.0330 _pdbx_refine_tls.S[2][3] -0.0147 _pdbx_refine_tls.S[2][1] -0.0570 _pdbx_refine_tls.S[3][1] -0.0330 _pdbx_refine_tls.S[3][2] -1.0026 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 197 A 385 all ? ? ? ? ? 'X-RAY DIFFRACTION' 2 1 B 1 B 1 all ? ? ? ? ? 'X-RAY DIFFRACTION' 3 1 S 1 S 32 all ? ? ? ? ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PO4 P P N N 273 PO4 O1 O N N 274 PO4 O2 O N N 275 PO4 O3 O N N 276 PO4 O4 O N N 277 PRO N N N N 278 PRO CA C N S 279 PRO C C N N 280 PRO O O N N 281 PRO CB C N N 282 PRO CG C N N 283 PRO CD C N N 284 PRO OXT O N N 285 PRO H H N N 286 PRO HA H N N 287 PRO HB2 H N N 288 PRO HB3 H N N 289 PRO HG2 H N N 290 PRO HG3 H N N 291 PRO HD2 H N N 292 PRO HD3 H N N 293 PRO HXT H N N 294 SER N N N N 295 SER CA C N S 296 SER C C N N 297 SER O O N N 298 SER CB C N N 299 SER OG O N N 300 SER OXT O N N 301 SER H H N N 302 SER H2 H N N 303 SER HA H N N 304 SER HB2 H N N 305 SER HB3 H N N 306 SER HG H N N 307 SER HXT H N N 308 THR N N N N 309 THR CA C N S 310 THR C C N N 311 THR O O N N 312 THR CB C N R 313 THR OG1 O N N 314 THR CG2 C N N 315 THR OXT O N N 316 THR H H N N 317 THR H2 H N N 318 THR HA H N N 319 THR HB H N N 320 THR HG1 H N N 321 THR HG21 H N N 322 THR HG22 H N N 323 THR HG23 H N N 324 THR HXT H N N 325 TRP N N N N 326 TRP CA C N S 327 TRP C C N N 328 TRP O O N N 329 TRP CB C N N 330 TRP CG C Y N 331 TRP CD1 C Y N 332 TRP CD2 C Y N 333 TRP NE1 N Y N 334 TRP CE2 C Y N 335 TRP CE3 C Y N 336 TRP CZ2 C Y N 337 TRP CZ3 C Y N 338 TRP CH2 C Y N 339 TRP OXT O N N 340 TRP H H N N 341 TRP H2 H N N 342 TRP HA H N N 343 TRP HB2 H N N 344 TRP HB3 H N N 345 TRP HD1 H N N 346 TRP HE1 H N N 347 TRP HE3 H N N 348 TRP HZ2 H N N 349 TRP HZ3 H N N 350 TRP HH2 H N N 351 TRP HXT H N N 352 TYR N N N N 353 TYR CA C N S 354 TYR C C N N 355 TYR O O N N 356 TYR CB C N N 357 TYR CG C Y N 358 TYR CD1 C Y N 359 TYR CD2 C Y N 360 TYR CE1 C Y N 361 TYR CE2 C Y N 362 TYR CZ C Y N 363 TYR OH O N N 364 TYR OXT O N N 365 TYR H H N N 366 TYR H2 H N N 367 TYR HA H N N 368 TYR HB2 H N N 369 TYR HB3 H N N 370 TYR HD1 H N N 371 TYR HD2 H N N 372 TYR HE1 H N N 373 TYR HE2 H N N 374 TYR HH H N N 375 TYR HXT H N N 376 VAL N N N N 377 VAL CA C N S 378 VAL C C N N 379 VAL O O N N 380 VAL CB C N N 381 VAL CG1 C N N 382 VAL CG2 C N N 383 VAL OXT O N N 384 VAL H H N N 385 VAL H2 H N N 386 VAL HA H N N 387 VAL HB H N N 388 VAL HG11 H N N 389 VAL HG12 H N N 390 VAL HG13 H N N 391 VAL HG21 H N N 392 VAL HG22 H N N 393 VAL HG23 H N N 394 VAL HXT H N N 395 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PO4 P O1 doub N N 260 PO4 P O2 sing N N 261 PO4 P O3 sing N N 262 PO4 P O4 sing N N 263 PRO N CA sing N N 264 PRO N CD sing N N 265 PRO N H sing N N 266 PRO CA C sing N N 267 PRO CA CB sing N N 268 PRO CA HA sing N N 269 PRO C O doub N N 270 PRO C OXT sing N N 271 PRO CB CG sing N N 272 PRO CB HB2 sing N N 273 PRO CB HB3 sing N N 274 PRO CG CD sing N N 275 PRO CG HG2 sing N N 276 PRO CG HG3 sing N N 277 PRO CD HD2 sing N N 278 PRO CD HD3 sing N N 279 PRO OXT HXT sing N N 280 SER N CA sing N N 281 SER N H sing N N 282 SER N H2 sing N N 283 SER CA C sing N N 284 SER CA CB sing N N 285 SER CA HA sing N N 286 SER C O doub N N 287 SER C OXT sing N N 288 SER CB OG sing N N 289 SER CB HB2 sing N N 290 SER CB HB3 sing N N 291 SER OG HG sing N N 292 SER OXT HXT sing N N 293 THR N CA sing N N 294 THR N H sing N N 295 THR N H2 sing N N 296 THR CA C sing N N 297 THR CA CB sing N N 298 THR CA HA sing N N 299 THR C O doub N N 300 THR C OXT sing N N 301 THR CB OG1 sing N N 302 THR CB CG2 sing N N 303 THR CB HB sing N N 304 THR OG1 HG1 sing N N 305 THR CG2 HG21 sing N N 306 THR CG2 HG22 sing N N 307 THR CG2 HG23 sing N N 308 THR OXT HXT sing N N 309 TRP N CA sing N N 310 TRP N H sing N N 311 TRP N H2 sing N N 312 TRP CA C sing N N 313 TRP CA CB sing N N 314 TRP CA HA sing N N 315 TRP C O doub N N 316 TRP C OXT sing N N 317 TRP CB CG sing N N 318 TRP CB HB2 sing N N 319 TRP CB HB3 sing N N 320 TRP CG CD1 doub Y N 321 TRP CG CD2 sing Y N 322 TRP CD1 NE1 sing Y N 323 TRP CD1 HD1 sing N N 324 TRP CD2 CE2 doub Y N 325 TRP CD2 CE3 sing Y N 326 TRP NE1 CE2 sing Y N 327 TRP NE1 HE1 sing N N 328 TRP CE2 CZ2 sing Y N 329 TRP CE3 CZ3 doub Y N 330 TRP CE3 HE3 sing N N 331 TRP CZ2 CH2 doub Y N 332 TRP CZ2 HZ2 sing N N 333 TRP CZ3 CH2 sing Y N 334 TRP CZ3 HZ3 sing N N 335 TRP CH2 HH2 sing N N 336 TRP OXT HXT sing N N 337 TYR N CA sing N N 338 TYR N H sing N N 339 TYR N H2 sing N N 340 TYR CA C sing N N 341 TYR CA CB sing N N 342 TYR CA HA sing N N 343 TYR C O doub N N 344 TYR C OXT sing N N 345 TYR CB CG sing N N 346 TYR CB HB2 sing N N 347 TYR CB HB3 sing N N 348 TYR CG CD1 doub Y N 349 TYR CG CD2 sing Y N 350 TYR CD1 CE1 sing Y N 351 TYR CD1 HD1 sing N N 352 TYR CD2 CE2 doub Y N 353 TYR CD2 HD2 sing N N 354 TYR CE1 CZ doub Y N 355 TYR CE1 HE1 sing N N 356 TYR CE2 CZ sing Y N 357 TYR CE2 HE2 sing N N 358 TYR CZ OH sing N N 359 TYR OH HH sing N N 360 TYR OXT HXT sing N N 361 VAL N CA sing N N 362 VAL N H sing N N 363 VAL N H2 sing N N 364 VAL CA C sing N N 365 VAL CA CB sing N N 366 VAL CA HA sing N N 367 VAL C O doub N N 368 VAL C OXT sing N N 369 VAL CB CG1 sing N N 370 VAL CB CG2 sing N N 371 VAL CB HB sing N N 372 VAL CG1 HG11 sing N N 373 VAL CG1 HG12 sing N N 374 VAL CG1 HG13 sing N N 375 VAL CG2 HG21 sing N N 376 VAL CG2 HG22 sing N N 377 VAL CG2 HG23 sing N N 378 VAL OXT HXT sing N N 379 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3DSH _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 5OEM _atom_sites.fract_transf_matrix[1][1] 0.013026 _atom_sites.fract_transf_matrix[1][2] 0.007521 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015041 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011682 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C H N O P S # loop_