data_5OHD # _entry.id 5OHD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.395 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5OHD pdb_00005ohd 10.2210/pdb5ohd/pdb WWPDB D_1200005786 ? ? BMRB 34164 ? 10.13018/BMR34164 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-04-11 2 'Structure model' 1 1 2019-05-08 3 'Structure model' 1 2 2024-07-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_nmr_software 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_database_status 6 3 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_nmr_software.name' 2 3 'Structure model' '_database_2.pdbx_DOI' 3 3 'Structure model' '_database_2.pdbx_database_accession' 4 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 5 3 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5OHD _pdbx_database_status.recvd_initial_deposition_date 2017-07-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'Putative active dimeric state of GHR transmembrane domain' 5OEK unspecified BMRB 'Putative inactive (dormant) dimeric state of GHR transmembrane domain' 34164 unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lesovoy, D.M.' 1 0000-0002-9130-715X 'Bocharov, E.V.' 2 0000-0002-3635-1609 'Bocharova, O.V.' 3 0000-0002-5056-1506 'Urban, A.S.' 4 0000-0001-6372-758X 'Arseniev, A.S.' 5 0000-0002-4986-6716 # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.unpublished_flag ? ? ? ? ? ? ? NE ? ? primary 'Biochim. Biophys. Acta' BBACAQ 0113 0006-3002 ? ? 1862 ? 1410 1420 'Structural basis of the signal transduction via transmembrane domain of the human growth hormone receptor.' 2018 ? 10.1016/j.bbagen.2018.03.022 29571748 ? ? ? ? ? ? ? ? UR ? ? 1 'Bioorg. Khim.' BIKHD7 0364 0132-3423 ? ? 41 ? 701 708 'Preparation of Transmembrane Fragments Growth Hormone Receptor GHR in a Cell-Free Expression System for Structural Studies.' 2015 ? ? 27125024 ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bocharov, E.V.' 1 ? primary 'Lesovoy, D.M.' 2 ? primary 'Bocharova, O.V.' 3 ? primary 'Urban, A.S.' 4 ? primary 'Pavlov, K.V.' 5 ? primary 'Volynsky, P.E.' 6 ? primary 'Efremov, R.G.' 7 ? primary 'Arseniev, A.S.' 8 ? 1 'Bocharova, O.V.' 9 ? 1 'Kuzmichev, P.K.' 10 ? 1 'Urban, A.S.' 11 ? 1 'Goncharuk, S.A.' 12 ? 1 'Bocharov, E.V.' 13 ? 1 'Arsenyev, A.S.' 14 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Growth hormone receptor' _entity.formula_weight 5145.129 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details 'The author sequence numbering corresponds to the Swiss-Prot annotation of the human Growth hormone receptor (GHR), P10912' # _entity_name_com.entity_id 1 _entity_name_com.name 'GH receptor,Somatotropin receptor' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSMSQFTCEEDFYFPWLLIIIFGIFGLTVMLFVFLFSKQQRIK _entity_poly.pdbx_seq_one_letter_code_can GSMSQFTCEEDFYFPWLLIIIFGIFGLTVMLFVFLFSKQQRIK _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MET n 1 4 SER n 1 5 GLN n 1 6 PHE n 1 7 THR n 1 8 CYS n 1 9 GLU n 1 10 GLU n 1 11 ASP n 1 12 PHE n 1 13 TYR n 1 14 PHE n 1 15 PRO n 1 16 TRP n 1 17 LEU n 1 18 LEU n 1 19 ILE n 1 20 ILE n 1 21 ILE n 1 22 PHE n 1 23 GLY n 1 24 ILE n 1 25 PHE n 1 26 GLY n 1 27 LEU n 1 28 THR n 1 29 VAL n 1 30 MET n 1 31 LEU n 1 32 PHE n 1 33 VAL n 1 34 PHE n 1 35 LEU n 1 36 PHE n 1 37 SER n 1 38 LYS n 1 39 GLN n 1 40 GLN n 1 41 ARG n 1 42 ILE n 1 43 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 43 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene GHR _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 252 252 GLY GLY A . n A 1 2 SER 2 253 253 SER SER A . n A 1 3 MET 3 254 254 MET MET A . n A 1 4 SER 4 255 255 SER SER A . n A 1 5 GLN 5 256 256 GLN GLN A . n A 1 6 PHE 6 257 257 PHE PHE A . n A 1 7 THR 7 258 258 THR THR A . n A 1 8 CYS 8 259 259 CYS CYS A . n A 1 9 GLU 9 260 260 GLU GLU A . n A 1 10 GLU 10 261 261 GLU GLU A . n A 1 11 ASP 11 262 262 ASP ASP A . n A 1 12 PHE 12 263 263 PHE PHE A . n A 1 13 TYR 13 264 264 TYR TYR A . n A 1 14 PHE 14 265 265 PHE PHE A . n A 1 15 PRO 15 266 266 PRO PRO A . n A 1 16 TRP 16 267 267 TRP TRP A . n A 1 17 LEU 17 268 268 LEU LEU A . n A 1 18 LEU 18 269 269 LEU LEU A . n A 1 19 ILE 19 270 270 ILE ILE A . n A 1 20 ILE 20 271 271 ILE ILE A . n A 1 21 ILE 21 272 272 ILE ILE A . n A 1 22 PHE 22 273 273 PHE PHE A . n A 1 23 GLY 23 274 274 GLY GLY A . n A 1 24 ILE 24 275 275 ILE ILE A . n A 1 25 PHE 25 276 276 PHE PHE A . n A 1 26 GLY 26 277 277 GLY GLY A . n A 1 27 LEU 27 278 278 LEU LEU A . n A 1 28 THR 28 279 279 THR THR A . n A 1 29 VAL 29 280 280 VAL VAL A . n A 1 30 MET 30 281 281 MET MET A . n A 1 31 LEU 31 282 282 LEU LEU A . n A 1 32 PHE 32 283 283 PHE PHE A . n A 1 33 VAL 33 284 284 VAL VAL A . n A 1 34 PHE 34 285 285 PHE PHE A . n A 1 35 LEU 35 286 286 LEU LEU A . n A 1 36 PHE 36 287 287 PHE PHE A . n A 1 37 SER 37 288 288 SER SER A . n A 1 38 LYS 38 289 289 LYS LYS A . n A 1 39 GLN 39 290 290 GLN GLN A . n A 1 40 GLN 40 291 291 GLN GLN A . n A 1 41 ARG 41 292 292 ARG ARG A . n A 1 42 ILE 42 293 293 ILE ILE A . n A 1 43 LYS 43 294 294 LYS LYS A . n B 1 1 GLY 1 252 252 GLY GLY B . n B 1 2 SER 2 253 253 SER SER B . n B 1 3 MET 3 254 254 MET MET B . n B 1 4 SER 4 255 255 SER SER B . n B 1 5 GLN 5 256 256 GLN GLN B . n B 1 6 PHE 6 257 257 PHE PHE B . n B 1 7 THR 7 258 258 THR THR B . n B 1 8 CYS 8 259 259 CYS CYS B . n B 1 9 GLU 9 260 260 GLU GLU B . n B 1 10 GLU 10 261 261 GLU GLU B . n B 1 11 ASP 11 262 262 ASP ASP B . n B 1 12 PHE 12 263 263 PHE PHE B . n B 1 13 TYR 13 264 264 TYR TYR B . n B 1 14 PHE 14 265 265 PHE PHE B . n B 1 15 PRO 15 266 266 PRO PRO B . n B 1 16 TRP 16 267 267 TRP TRP B . n B 1 17 LEU 17 268 268 LEU LEU B . n B 1 18 LEU 18 269 269 LEU LEU B . n B 1 19 ILE 19 270 270 ILE ILE B . n B 1 20 ILE 20 271 271 ILE ILE B . n B 1 21 ILE 21 272 272 ILE ILE B . n B 1 22 PHE 22 273 273 PHE PHE B . n B 1 23 GLY 23 274 274 GLY GLY B . n B 1 24 ILE 24 275 275 ILE ILE B . n B 1 25 PHE 25 276 276 PHE PHE B . n B 1 26 GLY 26 277 277 GLY GLY B . n B 1 27 LEU 27 278 278 LEU LEU B . n B 1 28 THR 28 279 279 THR THR B . n B 1 29 VAL 29 280 280 VAL VAL B . n B 1 30 MET 30 281 281 MET MET B . n B 1 31 LEU 31 282 282 LEU LEU B . n B 1 32 PHE 32 283 283 PHE PHE B . n B 1 33 VAL 33 284 284 VAL VAL B . n B 1 34 PHE 34 285 285 PHE PHE B . n B 1 35 LEU 35 286 286 LEU LEU B . n B 1 36 PHE 36 287 287 PHE PHE B . n B 1 37 SER 37 288 288 SER SER B . n B 1 38 LYS 38 289 289 LYS LYS B . n B 1 39 GLN 39 290 290 GLN GLN B . n B 1 40 GLN 40 291 291 GLN GLN B . n B 1 41 ARG 41 292 292 ARG ARG B . n B 1 42 ILE 42 293 293 ILE ILE B . n B 1 43 LYS 43 294 294 LYS LYS B . n # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5OHD _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.000 _cell.length_a_esd ? _cell.length_b 1.000 _cell.length_b_esd ? _cell.length_c 1.000 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5OHD _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5OHD _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _database_PDB_matrix.entry_id 5OHD _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 5OHD _struct.title 'Putative inactive (dormant) dimeric state of GHR transmembrane domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5OHD _struct_keywords.text 'Dimer, GHR, Growth hormone receptor, Homodimer, Human, Receptor, Transmembrane domain, JAK2 tyrosine kinase, MEMBRANE PROTEIN' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GHR_HUMAN _struct_ref.pdbx_db_accession P10912 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MSQFTCEEDFYFPWLLIIIFGIFGLTVMLFVFLFSKQQRIK _struct_ref.pdbx_align_begin 254 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5OHD A 3 ? 43 ? P10912 254 ? 294 ? 254 294 2 1 5OHD B 3 ? 43 ? P10912 254 ? 294 ? 254 294 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5OHD GLY A 1 ? UNP P10912 ? ? 'expression tag' 252 1 1 5OHD SER A 2 ? UNP P10912 ? ? 'expression tag' 253 2 2 5OHD GLY B 1 ? UNP P10912 ? ? 'expression tag' 252 3 2 5OHD SER B 2 ? UNP P10912 ? ? 'expression tag' 253 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 890 ? 1 MORE -14 ? 1 'SSA (A^2)' 9540 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'native gel electrophoresis' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 7 ? ASP A 11 ? THR A 258 ASP A 262 5 ? 5 HELX_P HELX_P2 AA2 TRP A 16 ? GLN A 40 ? TRP A 267 GLN A 291 1 ? 25 HELX_P HELX_P3 AA3 PHE B 14 ? GLN B 40 ? PHE B 265 GLN B 291 1 ? 27 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PHE 14 A . ? PHE 265 A PRO 15 A ? PRO 266 A 1 0.05 2 PHE 14 A . ? PHE 265 A PRO 15 A ? PRO 266 A 2 0.01 3 PHE 14 A . ? PHE 265 A PRO 15 A ? PRO 266 A 3 0.04 4 PHE 14 A . ? PHE 265 A PRO 15 A ? PRO 266 A 4 0.03 5 PHE 14 A . ? PHE 265 A PRO 15 A ? PRO 266 A 5 -0.03 6 PHE 14 A . ? PHE 265 A PRO 15 A ? PRO 266 A 6 0.00 7 PHE 14 A . ? PHE 265 A PRO 15 A ? PRO 266 A 7 -0.03 8 PHE 14 A . ? PHE 265 A PRO 15 A ? PRO 266 A 8 0.03 9 PHE 14 A . ? PHE 265 A PRO 15 A ? PRO 266 A 9 0.04 10 PHE 14 A . ? PHE 265 A PRO 15 A ? PRO 266 A 10 -0.06 11 PHE 14 A . ? PHE 265 A PRO 15 A ? PRO 266 A 11 0.02 12 PHE 14 A . ? PHE 265 A PRO 15 A ? PRO 266 A 12 -0.06 13 PHE 14 A . ? PHE 265 A PRO 15 A ? PRO 266 A 13 0.03 14 PHE 14 A . ? PHE 265 A PRO 15 A ? PRO 266 A 14 0.06 15 PHE 14 A . ? PHE 265 A PRO 15 A ? PRO 266 A 15 0.04 16 PHE 14 A . ? PHE 265 A PRO 15 A ? PRO 266 A 16 0.05 17 PHE 14 A . ? PHE 265 A PRO 15 A ? PRO 266 A 17 -0.12 18 PHE 14 A . ? PHE 265 A PRO 15 A ? PRO 266 A 18 0.06 19 PHE 14 A . ? PHE 265 A PRO 15 A ? PRO 266 A 19 -0.07 20 PHE 14 A . ? PHE 265 A PRO 15 A ? PRO 266 A 20 0.03 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE B 265 ? ? -117.68 71.16 2 3 PHE A 265 ? ? 60.63 85.94 3 3 PRO B 266 ? ? -69.78 91.37 4 3 ARG B 292 ? ? -137.64 -42.00 5 4 PHE A 263 ? ? -58.73 -177.17 6 4 TYR A 264 ? ? -57.97 -178.18 7 4 PHE A 265 ? ? 62.96 161.06 8 4 PRO B 266 ? ? -69.78 78.92 9 5 PHE B 265 ? ? -171.20 70.13 10 5 PRO B 266 ? ? -69.78 86.84 11 6 ASP B 262 ? ? 61.93 67.08 12 6 PHE B 265 ? ? 60.33 73.11 13 7 CYS A 259 ? ? -58.57 178.37 14 7 PHE A 265 ? ? 57.87 86.01 15 7 ARG A 292 ? ? -52.79 109.67 16 7 PRO B 266 ? ? -69.70 82.14 17 8 ASP B 262 ? ? 61.64 61.53 18 8 ILE B 293 ? ? 57.26 86.85 19 9 THR A 258 ? ? -92.73 -67.07 20 9 GLN A 291 ? ? 52.48 71.75 21 10 ASP A 262 ? ? 63.60 69.01 22 10 PHE A 265 ? ? 63.27 91.40 23 10 PHE B 263 ? ? -53.97 171.72 24 10 PHE B 265 ? ? 62.45 70.73 25 11 ASP A 262 ? ? 61.38 68.86 26 11 TYR B 264 ? ? -53.17 171.96 27 11 PRO B 266 ? ? -69.75 82.48 28 12 CYS B 259 ? ? -160.25 55.31 29 12 PHE B 265 ? ? -163.84 70.39 30 12 PRO B 266 ? ? -69.78 78.47 31 13 ASP A 262 ? ? 62.79 68.47 32 13 PHE B 265 ? ? 51.99 73.30 33 13 PRO B 266 ? ? -69.76 79.49 34 13 GLN B 291 ? ? 37.24 43.74 35 14 PHE B 265 ? ? 61.47 160.72 36 14 PRO B 266 ? ? -69.74 86.50 37 15 PHE A 263 ? ? -96.36 -68.38 38 15 PHE A 265 ? ? 63.19 161.14 39 15 PHE B 265 ? ? 63.30 160.55 40 15 PRO B 266 ? ? -69.73 84.73 41 15 GLN B 291 ? ? 39.24 41.71 42 16 ASP A 262 ? ? 63.25 67.29 43 16 PRO B 266 ? ? -69.70 81.80 44 17 PHE B 265 ? ? 63.10 160.56 45 17 PRO B 266 ? ? -69.78 79.75 46 18 PHE B 265 ? ? 37.01 67.94 47 18 PRO B 266 ? ? -69.76 90.02 48 18 GLN B 291 ? ? 39.26 42.12 49 19 PHE B 265 ? ? -113.95 73.40 50 20 PHE A 263 ? ? 37.21 43.88 51 20 PRO B 266 ? ? -69.75 78.77 # _pdbx_nmr_ensemble.entry_id 5OHD _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5OHD _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 ;0.7 mM [U-99% 13C; U-99% 15N] GHRtm, 1.2 mM GHRtm, 100 mM [U-99% 2H] DPC, 0.3 mM sodium azide, 8 mM TCEP, 10 mM citric acid, 20 mM Na2HPO4, 95% H2O/5% D2O ; '95% H2O/5% D2O' sample_1 micelle 'for intermolecular NOE' 2 '0.8 mM [U-99% 15N] GHRtm, 50 mM [U-99% 2H] DPC, 0.3 mM sodium azide, 8 mM TCEP, 10 mM citric acid, 20 mM Na2HPO4, 95% H2O/5% D2O' '95% H2O/5% D2O' sample_2 micelle ? 3 ;0.8 mM [U-99% 13C; U-99% 15N] GHRtm, 50 mM [U-99% 2H] DPC, 0.3 mM sodium azide, 8 mM TCEP, 10 mM citric acid, 20 mM Na2HPO4, 95% H2O/5% D2O ; '95% H2O/5% D2O' sample_3 micelle 'reference for intermolecular NOE' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 GHRtm-13C-15N 0.7 ? mM '[U-99% 13C; U-99% 15N]' 1 GHRtm 1.2 ? mM 'natural abundance' 1 DPC 100 ? mM '[U-99% 2H]' 1 'sodium azide' 0.3 ? mM 'natural abundance' 1 TCEP 8 ? mM 'natural abundance' 1 'citric acid' 10 ? mM 'natural abundance' 1 Na2HPO4 20 ? mM 'natural abundance' 2 GHRtm 0.8 ? mM '[U-99% 15N]' 2 DPC 50 ? mM '[U-99% 2H]' 2 'sodium azide' 0.3 ? mM 'natural abundance' 2 TCEP 8 ? mM 'natural abundance' 2 'citric acid' 10 ? mM 'natural abundance' 2 Na2HPO4 20 ? mM 'natural abundance' 3 GHRtm 0.8 ? mM '[U-99% 13C; U-99% 15N]' 3 DPC 50 ? mM '[U-99% 2H]' 3 'sodium azide' 0.3 ? mM 'natural abundance' 3 TCEP 8 ? mM 'natural abundance' 3 'citric acid' 10 ? mM 'natural abundance' 3 Na2HPO4 20 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 313 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 5.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 40 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err 10 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label sample_conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err 0.05 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 15N,13C-F1-filtered/F3-edited-NOESY 2 isotropic 2 1 3 15N,13C-F1-filtered/F3-edited-NOESY 2 isotropic 3 1 3 '3D 1H-13C(constant time) NOESY aliphatic' 1 isotropic 4 1 3 '3D 1H-13C NOESY aliphatic' 2 isotropic 5 1 2 '3D 1H-15N(TROSY) NOESY' 1 isotropic 6 1 3 '3D 1H-13C NOESY aromatic' 1 isotropic 7 1 2 '3D 1H-15N(TROSY) HNHB' 1 isotropic 8 1 2 '3D 1H-15N(TROSY) HNHA' 1 isotropic 9 1 3 '3D 1H-15N(TROSY) HNCO' 1 isotropic 10 1 3 '3D 1H-15N(TROSY) HNCA' 1 isotropic 11 1 3 '3D 1H-15N(TROSY) HN(CA)CO' 1 isotropic 12 1 3 '3D 1H-15N(TROSY) HN(CO)CA' 1 isotropic 13 1 1 '2D 1H-15N HSQC' 1 isotropic 14 1 1 '2D 1H-15N TROSY' 1 isotropic 15 1 3 '2D 1H-INEPT-13CA-detected' 1 isotropic 16 1 1 '2D 1H-13C constant time HSQC aliphatic' 1 isotropic 17 1 1 '2D 1H-13C constant time HSQC aromatic' 1 isotropic 18 1 3 '2D 1H-13C(TROSY) constant time HSQC aromatic' 1 isotropic 19 1 3 '3D HCCH-TOCSY' 2 isotropic 20 1 3 '3D 1H-13C constant time HCCH-TOCSY' 1 isotropic 21 1 2 '2D 1H-15N CSA/dipole cross-correlation' 1 isotropic 22 1 2 '2D 1H-15N(TROSY) CLEANEX' 1 isotropic # _pdbx_nmr_refine.entry_id 5OHD _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 3 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin 3.2 'Bruker Biospin' 2 'chemical shift assignment' CARA 1.9 'Keller and Wuthrich' 3 'structure calculation' CYANA 3.97 'Guntert, Mumenthaler and Wuthrich' 4 'data analysis' Mathematica Linux 'Wolfram Research' 5 processing MddNMR 2.4 'V. Orekhov, V. Jaravine, M. Mayzel, K. Kazimierczuk' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASP N N N N 28 ASP CA C N S 29 ASP C C N N 30 ASP O O N N 31 ASP CB C N N 32 ASP CG C N N 33 ASP OD1 O N N 34 ASP OD2 O N N 35 ASP OXT O N N 36 ASP H H N N 37 ASP H2 H N N 38 ASP HA H N N 39 ASP HB2 H N N 40 ASP HB3 H N N 41 ASP HD2 H N N 42 ASP HXT H N N 43 CYS N N N N 44 CYS CA C N R 45 CYS C C N N 46 CYS O O N N 47 CYS CB C N N 48 CYS SG S N N 49 CYS OXT O N N 50 CYS H H N N 51 CYS H2 H N N 52 CYS HA H N N 53 CYS HB2 H N N 54 CYS HB3 H N N 55 CYS HG H N N 56 CYS HXT H N N 57 GLN N N N N 58 GLN CA C N S 59 GLN C C N N 60 GLN O O N N 61 GLN CB C N N 62 GLN CG C N N 63 GLN CD C N N 64 GLN OE1 O N N 65 GLN NE2 N N N 66 GLN OXT O N N 67 GLN H H N N 68 GLN H2 H N N 69 GLN HA H N N 70 GLN HB2 H N N 71 GLN HB3 H N N 72 GLN HG2 H N N 73 GLN HG3 H N N 74 GLN HE21 H N N 75 GLN HE22 H N N 76 GLN HXT H N N 77 GLU N N N N 78 GLU CA C N S 79 GLU C C N N 80 GLU O O N N 81 GLU CB C N N 82 GLU CG C N N 83 GLU CD C N N 84 GLU OE1 O N N 85 GLU OE2 O N N 86 GLU OXT O N N 87 GLU H H N N 88 GLU H2 H N N 89 GLU HA H N N 90 GLU HB2 H N N 91 GLU HB3 H N N 92 GLU HG2 H N N 93 GLU HG3 H N N 94 GLU HE2 H N N 95 GLU HXT H N N 96 GLY N N N N 97 GLY CA C N N 98 GLY C C N N 99 GLY O O N N 100 GLY OXT O N N 101 GLY H H N N 102 GLY H2 H N N 103 GLY HA2 H N N 104 GLY HA3 H N N 105 GLY HXT H N N 106 ILE N N N N 107 ILE CA C N S 108 ILE C C N N 109 ILE O O N N 110 ILE CB C N S 111 ILE CG1 C N N 112 ILE CG2 C N N 113 ILE CD1 C N N 114 ILE OXT O N N 115 ILE H H N N 116 ILE H2 H N N 117 ILE HA H N N 118 ILE HB H N N 119 ILE HG12 H N N 120 ILE HG13 H N N 121 ILE HG21 H N N 122 ILE HG22 H N N 123 ILE HG23 H N N 124 ILE HD11 H N N 125 ILE HD12 H N N 126 ILE HD13 H N N 127 ILE HXT H N N 128 LEU N N N N 129 LEU CA C N S 130 LEU C C N N 131 LEU O O N N 132 LEU CB C N N 133 LEU CG C N N 134 LEU CD1 C N N 135 LEU CD2 C N N 136 LEU OXT O N N 137 LEU H H N N 138 LEU H2 H N N 139 LEU HA H N N 140 LEU HB2 H N N 141 LEU HB3 H N N 142 LEU HG H N N 143 LEU HD11 H N N 144 LEU HD12 H N N 145 LEU HD13 H N N 146 LEU HD21 H N N 147 LEU HD22 H N N 148 LEU HD23 H N N 149 LEU HXT H N N 150 LYS N N N N 151 LYS CA C N S 152 LYS C C N N 153 LYS O O N N 154 LYS CB C N N 155 LYS CG C N N 156 LYS CD C N N 157 LYS CE C N N 158 LYS NZ N N N 159 LYS OXT O N N 160 LYS H H N N 161 LYS H2 H N N 162 LYS HA H N N 163 LYS HB2 H N N 164 LYS HB3 H N N 165 LYS HG2 H N N 166 LYS HG3 H N N 167 LYS HD2 H N N 168 LYS HD3 H N N 169 LYS HE2 H N N 170 LYS HE3 H N N 171 LYS HZ1 H N N 172 LYS HZ2 H N N 173 LYS HZ3 H N N 174 LYS HXT H N N 175 MET N N N N 176 MET CA C N S 177 MET C C N N 178 MET O O N N 179 MET CB C N N 180 MET CG C N N 181 MET SD S N N 182 MET CE C N N 183 MET OXT O N N 184 MET H H N N 185 MET H2 H N N 186 MET HA H N N 187 MET HB2 H N N 188 MET HB3 H N N 189 MET HG2 H N N 190 MET HG3 H N N 191 MET HE1 H N N 192 MET HE2 H N N 193 MET HE3 H N N 194 MET HXT H N N 195 PHE N N N N 196 PHE CA C N S 197 PHE C C N N 198 PHE O O N N 199 PHE CB C N N 200 PHE CG C Y N 201 PHE CD1 C Y N 202 PHE CD2 C Y N 203 PHE CE1 C Y N 204 PHE CE2 C Y N 205 PHE CZ C Y N 206 PHE OXT O N N 207 PHE H H N N 208 PHE H2 H N N 209 PHE HA H N N 210 PHE HB2 H N N 211 PHE HB3 H N N 212 PHE HD1 H N N 213 PHE HD2 H N N 214 PHE HE1 H N N 215 PHE HE2 H N N 216 PHE HZ H N N 217 PHE HXT H N N 218 PRO N N N N 219 PRO CA C N S 220 PRO C C N N 221 PRO O O N N 222 PRO CB C N N 223 PRO CG C N N 224 PRO CD C N N 225 PRO OXT O N N 226 PRO H H N N 227 PRO HA H N N 228 PRO HB2 H N N 229 PRO HB3 H N N 230 PRO HG2 H N N 231 PRO HG3 H N N 232 PRO HD2 H N N 233 PRO HD3 H N N 234 PRO HXT H N N 235 SER N N N N 236 SER CA C N S 237 SER C C N N 238 SER O O N N 239 SER CB C N N 240 SER OG O N N 241 SER OXT O N N 242 SER H H N N 243 SER H2 H N N 244 SER HA H N N 245 SER HB2 H N N 246 SER HB3 H N N 247 SER HG H N N 248 SER HXT H N N 249 THR N N N N 250 THR CA C N S 251 THR C C N N 252 THR O O N N 253 THR CB C N R 254 THR OG1 O N N 255 THR CG2 C N N 256 THR OXT O N N 257 THR H H N N 258 THR H2 H N N 259 THR HA H N N 260 THR HB H N N 261 THR HG1 H N N 262 THR HG21 H N N 263 THR HG22 H N N 264 THR HG23 H N N 265 THR HXT H N N 266 TRP N N N N 267 TRP CA C N S 268 TRP C C N N 269 TRP O O N N 270 TRP CB C N N 271 TRP CG C Y N 272 TRP CD1 C Y N 273 TRP CD2 C Y N 274 TRP NE1 N Y N 275 TRP CE2 C Y N 276 TRP CE3 C Y N 277 TRP CZ2 C Y N 278 TRP CZ3 C Y N 279 TRP CH2 C Y N 280 TRP OXT O N N 281 TRP H H N N 282 TRP H2 H N N 283 TRP HA H N N 284 TRP HB2 H N N 285 TRP HB3 H N N 286 TRP HD1 H N N 287 TRP HE1 H N N 288 TRP HE3 H N N 289 TRP HZ2 H N N 290 TRP HZ3 H N N 291 TRP HH2 H N N 292 TRP HXT H N N 293 TYR N N N N 294 TYR CA C N S 295 TYR C C N N 296 TYR O O N N 297 TYR CB C N N 298 TYR CG C Y N 299 TYR CD1 C Y N 300 TYR CD2 C Y N 301 TYR CE1 C Y N 302 TYR CE2 C Y N 303 TYR CZ C Y N 304 TYR OH O N N 305 TYR OXT O N N 306 TYR H H N N 307 TYR H2 H N N 308 TYR HA H N N 309 TYR HB2 H N N 310 TYR HB3 H N N 311 TYR HD1 H N N 312 TYR HD2 H N N 313 TYR HE1 H N N 314 TYR HE2 H N N 315 TYR HH H N N 316 TYR HXT H N N 317 VAL N N N N 318 VAL CA C N S 319 VAL C C N N 320 VAL O O N N 321 VAL CB C N N 322 VAL CG1 C N N 323 VAL CG2 C N N 324 VAL OXT O N N 325 VAL H H N N 326 VAL H2 H N N 327 VAL HA H N N 328 VAL HB H N N 329 VAL HG11 H N N 330 VAL HG12 H N N 331 VAL HG13 H N N 332 VAL HG21 H N N 333 VAL HG22 H N N 334 VAL HG23 H N N 335 VAL HXT H N N 336 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASP N CA sing N N 27 ASP N H sing N N 28 ASP N H2 sing N N 29 ASP CA C sing N N 30 ASP CA CB sing N N 31 ASP CA HA sing N N 32 ASP C O doub N N 33 ASP C OXT sing N N 34 ASP CB CG sing N N 35 ASP CB HB2 sing N N 36 ASP CB HB3 sing N N 37 ASP CG OD1 doub N N 38 ASP CG OD2 sing N N 39 ASP OD2 HD2 sing N N 40 ASP OXT HXT sing N N 41 CYS N CA sing N N 42 CYS N H sing N N 43 CYS N H2 sing N N 44 CYS CA C sing N N 45 CYS CA CB sing N N 46 CYS CA HA sing N N 47 CYS C O doub N N 48 CYS C OXT sing N N 49 CYS CB SG sing N N 50 CYS CB HB2 sing N N 51 CYS CB HB3 sing N N 52 CYS SG HG sing N N 53 CYS OXT HXT sing N N 54 GLN N CA sing N N 55 GLN N H sing N N 56 GLN N H2 sing N N 57 GLN CA C sing N N 58 GLN CA CB sing N N 59 GLN CA HA sing N N 60 GLN C O doub N N 61 GLN C OXT sing N N 62 GLN CB CG sing N N 63 GLN CB HB2 sing N N 64 GLN CB HB3 sing N N 65 GLN CG CD sing N N 66 GLN CG HG2 sing N N 67 GLN CG HG3 sing N N 68 GLN CD OE1 doub N N 69 GLN CD NE2 sing N N 70 GLN NE2 HE21 sing N N 71 GLN NE2 HE22 sing N N 72 GLN OXT HXT sing N N 73 GLU N CA sing N N 74 GLU N H sing N N 75 GLU N H2 sing N N 76 GLU CA C sing N N 77 GLU CA CB sing N N 78 GLU CA HA sing N N 79 GLU C O doub N N 80 GLU C OXT sing N N 81 GLU CB CG sing N N 82 GLU CB HB2 sing N N 83 GLU CB HB3 sing N N 84 GLU CG CD sing N N 85 GLU CG HG2 sing N N 86 GLU CG HG3 sing N N 87 GLU CD OE1 doub N N 88 GLU CD OE2 sing N N 89 GLU OE2 HE2 sing N N 90 GLU OXT HXT sing N N 91 GLY N CA sing N N 92 GLY N H sing N N 93 GLY N H2 sing N N 94 GLY CA C sing N N 95 GLY CA HA2 sing N N 96 GLY CA HA3 sing N N 97 GLY C O doub N N 98 GLY C OXT sing N N 99 GLY OXT HXT sing N N 100 ILE N CA sing N N 101 ILE N H sing N N 102 ILE N H2 sing N N 103 ILE CA C sing N N 104 ILE CA CB sing N N 105 ILE CA HA sing N N 106 ILE C O doub N N 107 ILE C OXT sing N N 108 ILE CB CG1 sing N N 109 ILE CB CG2 sing N N 110 ILE CB HB sing N N 111 ILE CG1 CD1 sing N N 112 ILE CG1 HG12 sing N N 113 ILE CG1 HG13 sing N N 114 ILE CG2 HG21 sing N N 115 ILE CG2 HG22 sing N N 116 ILE CG2 HG23 sing N N 117 ILE CD1 HD11 sing N N 118 ILE CD1 HD12 sing N N 119 ILE CD1 HD13 sing N N 120 ILE OXT HXT sing N N 121 LEU N CA sing N N 122 LEU N H sing N N 123 LEU N H2 sing N N 124 LEU CA C sing N N 125 LEU CA CB sing N N 126 LEU CA HA sing N N 127 LEU C O doub N N 128 LEU C OXT sing N N 129 LEU CB CG sing N N 130 LEU CB HB2 sing N N 131 LEU CB HB3 sing N N 132 LEU CG CD1 sing N N 133 LEU CG CD2 sing N N 134 LEU CG HG sing N N 135 LEU CD1 HD11 sing N N 136 LEU CD1 HD12 sing N N 137 LEU CD1 HD13 sing N N 138 LEU CD2 HD21 sing N N 139 LEU CD2 HD22 sing N N 140 LEU CD2 HD23 sing N N 141 LEU OXT HXT sing N N 142 LYS N CA sing N N 143 LYS N H sing N N 144 LYS N H2 sing N N 145 LYS CA C sing N N 146 LYS CA CB sing N N 147 LYS CA HA sing N N 148 LYS C O doub N N 149 LYS C OXT sing N N 150 LYS CB CG sing N N 151 LYS CB HB2 sing N N 152 LYS CB HB3 sing N N 153 LYS CG CD sing N N 154 LYS CG HG2 sing N N 155 LYS CG HG3 sing N N 156 LYS CD CE sing N N 157 LYS CD HD2 sing N N 158 LYS CD HD3 sing N N 159 LYS CE NZ sing N N 160 LYS CE HE2 sing N N 161 LYS CE HE3 sing N N 162 LYS NZ HZ1 sing N N 163 LYS NZ HZ2 sing N N 164 LYS NZ HZ3 sing N N 165 LYS OXT HXT sing N N 166 MET N CA sing N N 167 MET N H sing N N 168 MET N H2 sing N N 169 MET CA C sing N N 170 MET CA CB sing N N 171 MET CA HA sing N N 172 MET C O doub N N 173 MET C OXT sing N N 174 MET CB CG sing N N 175 MET CB HB2 sing N N 176 MET CB HB3 sing N N 177 MET CG SD sing N N 178 MET CG HG2 sing N N 179 MET CG HG3 sing N N 180 MET SD CE sing N N 181 MET CE HE1 sing N N 182 MET CE HE2 sing N N 183 MET CE HE3 sing N N 184 MET OXT HXT sing N N 185 PHE N CA sing N N 186 PHE N H sing N N 187 PHE N H2 sing N N 188 PHE CA C sing N N 189 PHE CA CB sing N N 190 PHE CA HA sing N N 191 PHE C O doub N N 192 PHE C OXT sing N N 193 PHE CB CG sing N N 194 PHE CB HB2 sing N N 195 PHE CB HB3 sing N N 196 PHE CG CD1 doub Y N 197 PHE CG CD2 sing Y N 198 PHE CD1 CE1 sing Y N 199 PHE CD1 HD1 sing N N 200 PHE CD2 CE2 doub Y N 201 PHE CD2 HD2 sing N N 202 PHE CE1 CZ doub Y N 203 PHE CE1 HE1 sing N N 204 PHE CE2 CZ sing Y N 205 PHE CE2 HE2 sing N N 206 PHE CZ HZ sing N N 207 PHE OXT HXT sing N N 208 PRO N CA sing N N 209 PRO N CD sing N N 210 PRO N H sing N N 211 PRO CA C sing N N 212 PRO CA CB sing N N 213 PRO CA HA sing N N 214 PRO C O doub N N 215 PRO C OXT sing N N 216 PRO CB CG sing N N 217 PRO CB HB2 sing N N 218 PRO CB HB3 sing N N 219 PRO CG CD sing N N 220 PRO CG HG2 sing N N 221 PRO CG HG3 sing N N 222 PRO CD HD2 sing N N 223 PRO CD HD3 sing N N 224 PRO OXT HXT sing N N 225 SER N CA sing N N 226 SER N H sing N N 227 SER N H2 sing N N 228 SER CA C sing N N 229 SER CA CB sing N N 230 SER CA HA sing N N 231 SER C O doub N N 232 SER C OXT sing N N 233 SER CB OG sing N N 234 SER CB HB2 sing N N 235 SER CB HB3 sing N N 236 SER OG HG sing N N 237 SER OXT HXT sing N N 238 THR N CA sing N N 239 THR N H sing N N 240 THR N H2 sing N N 241 THR CA C sing N N 242 THR CA CB sing N N 243 THR CA HA sing N N 244 THR C O doub N N 245 THR C OXT sing N N 246 THR CB OG1 sing N N 247 THR CB CG2 sing N N 248 THR CB HB sing N N 249 THR OG1 HG1 sing N N 250 THR CG2 HG21 sing N N 251 THR CG2 HG22 sing N N 252 THR CG2 HG23 sing N N 253 THR OXT HXT sing N N 254 TRP N CA sing N N 255 TRP N H sing N N 256 TRP N H2 sing N N 257 TRP CA C sing N N 258 TRP CA CB sing N N 259 TRP CA HA sing N N 260 TRP C O doub N N 261 TRP C OXT sing N N 262 TRP CB CG sing N N 263 TRP CB HB2 sing N N 264 TRP CB HB3 sing N N 265 TRP CG CD1 doub Y N 266 TRP CG CD2 sing Y N 267 TRP CD1 NE1 sing Y N 268 TRP CD1 HD1 sing N N 269 TRP CD2 CE2 doub Y N 270 TRP CD2 CE3 sing Y N 271 TRP NE1 CE2 sing Y N 272 TRP NE1 HE1 sing N N 273 TRP CE2 CZ2 sing Y N 274 TRP CE3 CZ3 doub Y N 275 TRP CE3 HE3 sing N N 276 TRP CZ2 CH2 doub Y N 277 TRP CZ2 HZ2 sing N N 278 TRP CZ3 CH2 sing Y N 279 TRP CZ3 HZ3 sing N N 280 TRP CH2 HH2 sing N N 281 TRP OXT HXT sing N N 282 TYR N CA sing N N 283 TYR N H sing N N 284 TYR N H2 sing N N 285 TYR CA C sing N N 286 TYR CA CB sing N N 287 TYR CA HA sing N N 288 TYR C O doub N N 289 TYR C OXT sing N N 290 TYR CB CG sing N N 291 TYR CB HB2 sing N N 292 TYR CB HB3 sing N N 293 TYR CG CD1 doub Y N 294 TYR CG CD2 sing Y N 295 TYR CD1 CE1 sing Y N 296 TYR CD1 HD1 sing N N 297 TYR CD2 CE2 doub Y N 298 TYR CD2 HD2 sing N N 299 TYR CE1 CZ doub Y N 300 TYR CE1 HE1 sing N N 301 TYR CE2 CZ sing Y N 302 TYR CE2 HE2 sing N N 303 TYR CZ OH sing N N 304 TYR OH HH sing N N 305 TYR OXT HXT sing N N 306 VAL N CA sing N N 307 VAL N H sing N N 308 VAL N H2 sing N N 309 VAL CA C sing N N 310 VAL CA CB sing N N 311 VAL CA HA sing N N 312 VAL C O doub N N 313 VAL C OXT sing N N 314 VAL CB CG1 sing N N 315 VAL CB CG2 sing N N 316 VAL CB HB sing N N 317 VAL CG1 HG11 sing N N 318 VAL CG1 HG12 sing N N 319 VAL CG1 HG13 sing N N 320 VAL CG2 HG21 sing N N 321 VAL CG2 HG22 sing N N 322 VAL CG2 HG23 sing N N 323 VAL OXT HXT sing N N 324 # _pdbx_audit_support.funding_organization 'Russian Science Foundation' _pdbx_audit_support.country 'Russian Federation' _pdbx_audit_support.grant_number 14-50-00131 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 800 '13C 1H CryoProbe' 2 'AVANCE III' ? Bruker 600 '1H CryoProbe' # _atom_sites.entry_id 5OHD _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_