data_5OMH # _entry.id 5OMH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.305 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5OMH WWPDB D_1200006048 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5OMH _pdbx_database_status.recvd_initial_deposition_date 2017-07-31 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Buehrmann, M.' 1 ? 'Rauh, D.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_id_ASTM BBRCA9 _citation.journal_id_CSD 0146 _citation.journal_id_ISSN 1090-2104 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 511 _citation.language ? _citation.page_first 579 _citation.page_last 586 _citation.title ;Co-crystal structure determination and cellular evaluation of 1,4-dihydropyrazolo[4,3-c] [1,2] benzothiazine 5,5-dioxide p38 alpha MAPK inhibitors. ; _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2019.02.063 _citation.pdbx_database_id_PubMed 30824186 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bartolini, D.' 1 ? primary 'Buhrmann, M.' 2 ? primary 'Barreca, M.L.' 3 ? primary 'Manfroni, G.' 4 ? primary 'Cecchetti, V.' 5 ? primary 'Rauh, D.' 6 ? primary 'Galli, F.' 7 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5OMH _cell.details ? _cell.formula_units_Z ? _cell.length_a 64.420 _cell.length_a_esd ? _cell.length_b 74.980 _cell.length_b_esd ? _cell.length_c 77.710 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5OMH _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Mitogen-activated protein kinase 14' 41343.195 1 2.7.11.24 ? ? ? 2 non-polymer syn '1-(3-chlorophenyl)-3-methyl-4~{H}-pyrazolo[4,3-c][1,2]benzothiazine 5,5-dioxide' 345.803 1 ? ? ? ? 3 water nat water 18.015 7 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;MAPK 14,Cytokine suppressive anti-inflammatory drug-binding protein,CSBP,MAP kinase MXI2,MAX-interacting protein 2,Mitogen-activated protein kinase p38 alpha,MAP kinase p38 alpha,Stress-activated protein kinase 2a,SAPK2a ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKH ENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNE DCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA DPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES ; _entity_poly.pdbx_seq_one_letter_code_can ;MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKH ENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNE DCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA DPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 GLN n 1 4 GLU n 1 5 ARG n 1 6 PRO n 1 7 THR n 1 8 PHE n 1 9 TYR n 1 10 ARG n 1 11 GLN n 1 12 GLU n 1 13 LEU n 1 14 ASN n 1 15 LYS n 1 16 THR n 1 17 ILE n 1 18 TRP n 1 19 GLU n 1 20 VAL n 1 21 PRO n 1 22 GLU n 1 23 ARG n 1 24 TYR n 1 25 GLN n 1 26 ASN n 1 27 LEU n 1 28 SER n 1 29 PRO n 1 30 VAL n 1 31 GLY n 1 32 SER n 1 33 GLY n 1 34 ALA n 1 35 TYR n 1 36 GLY n 1 37 SER n 1 38 VAL n 1 39 CYS n 1 40 ALA n 1 41 ALA n 1 42 PHE n 1 43 ASP n 1 44 THR n 1 45 LYS n 1 46 THR n 1 47 GLY n 1 48 LEU n 1 49 ARG n 1 50 VAL n 1 51 ALA n 1 52 VAL n 1 53 LYS n 1 54 LYS n 1 55 LEU n 1 56 SER n 1 57 ARG n 1 58 PRO n 1 59 PHE n 1 60 GLN n 1 61 SER n 1 62 ILE n 1 63 ILE n 1 64 HIS n 1 65 ALA n 1 66 LYS n 1 67 ARG n 1 68 THR n 1 69 TYR n 1 70 ARG n 1 71 GLU n 1 72 LEU n 1 73 ARG n 1 74 LEU n 1 75 LEU n 1 76 LYS n 1 77 HIS n 1 78 MET n 1 79 LYS n 1 80 HIS n 1 81 GLU n 1 82 ASN n 1 83 VAL n 1 84 ILE n 1 85 GLY n 1 86 LEU n 1 87 LEU n 1 88 ASP n 1 89 VAL n 1 90 PHE n 1 91 THR n 1 92 PRO n 1 93 ALA n 1 94 ARG n 1 95 SER n 1 96 LEU n 1 97 GLU n 1 98 GLU n 1 99 PHE n 1 100 ASN n 1 101 ASP n 1 102 VAL n 1 103 TYR n 1 104 LEU n 1 105 VAL n 1 106 THR n 1 107 HIS n 1 108 LEU n 1 109 MET n 1 110 GLY n 1 111 ALA n 1 112 ASP n 1 113 LEU n 1 114 ASN n 1 115 ASN n 1 116 ILE n 1 117 VAL n 1 118 LYS n 1 119 CYS n 1 120 GLN n 1 121 LYS n 1 122 LEU n 1 123 THR n 1 124 ASP n 1 125 ASP n 1 126 HIS n 1 127 VAL n 1 128 GLN n 1 129 PHE n 1 130 LEU n 1 131 ILE n 1 132 TYR n 1 133 GLN n 1 134 ILE n 1 135 LEU n 1 136 ARG n 1 137 GLY n 1 138 LEU n 1 139 LYS n 1 140 TYR n 1 141 ILE n 1 142 HIS n 1 143 SER n 1 144 ALA n 1 145 ASP n 1 146 ILE n 1 147 ILE n 1 148 HIS n 1 149 ARG n 1 150 ASP n 1 151 LEU n 1 152 LYS n 1 153 PRO n 1 154 SER n 1 155 ASN n 1 156 LEU n 1 157 ALA n 1 158 VAL n 1 159 ASN n 1 160 GLU n 1 161 ASP n 1 162 CYS n 1 163 GLU n 1 164 LEU n 1 165 LYS n 1 166 ILE n 1 167 LEU n 1 168 ASP n 1 169 PHE n 1 170 GLY n 1 171 LEU n 1 172 ALA n 1 173 ARG n 1 174 HIS n 1 175 THR n 1 176 ASP n 1 177 ASP n 1 178 GLU n 1 179 MET n 1 180 THR n 1 181 GLY n 1 182 TYR n 1 183 VAL n 1 184 ALA n 1 185 THR n 1 186 ARG n 1 187 TRP n 1 188 TYR n 1 189 ARG n 1 190 ALA n 1 191 PRO n 1 192 GLU n 1 193 ILE n 1 194 MET n 1 195 LEU n 1 196 ASN n 1 197 TRP n 1 198 MET n 1 199 HIS n 1 200 TYR n 1 201 ASN n 1 202 GLN n 1 203 THR n 1 204 VAL n 1 205 ASP n 1 206 ILE n 1 207 TRP n 1 208 SER n 1 209 VAL n 1 210 GLY n 1 211 CYS n 1 212 ILE n 1 213 MET n 1 214 ALA n 1 215 GLU n 1 216 LEU n 1 217 LEU n 1 218 THR n 1 219 GLY n 1 220 ARG n 1 221 THR n 1 222 LEU n 1 223 PHE n 1 224 PRO n 1 225 GLY n 1 226 THR n 1 227 ASP n 1 228 HIS n 1 229 ILE n 1 230 ASP n 1 231 GLN n 1 232 LEU n 1 233 LYS n 1 234 LEU n 1 235 ILE n 1 236 LEU n 1 237 ARG n 1 238 LEU n 1 239 VAL n 1 240 GLY n 1 241 THR n 1 242 PRO n 1 243 GLY n 1 244 ALA n 1 245 GLU n 1 246 LEU n 1 247 LEU n 1 248 LYS n 1 249 LYS n 1 250 ILE n 1 251 SER n 1 252 SER n 1 253 GLU n 1 254 SER n 1 255 ALA n 1 256 ARG n 1 257 ASN n 1 258 TYR n 1 259 ILE n 1 260 GLN n 1 261 SER n 1 262 LEU n 1 263 THR n 1 264 GLN n 1 265 MET n 1 266 PRO n 1 267 LYS n 1 268 MET n 1 269 ASN n 1 270 PHE n 1 271 ALA n 1 272 ASN n 1 273 VAL n 1 274 PHE n 1 275 ILE n 1 276 GLY n 1 277 ALA n 1 278 ASN n 1 279 PRO n 1 280 LEU n 1 281 ALA n 1 282 VAL n 1 283 ASP n 1 284 LEU n 1 285 LEU n 1 286 GLU n 1 287 LYS n 1 288 MET n 1 289 LEU n 1 290 VAL n 1 291 LEU n 1 292 ASP n 1 293 SER n 1 294 ASP n 1 295 LYS n 1 296 ARG n 1 297 ILE n 1 298 THR n 1 299 ALA n 1 300 ALA n 1 301 GLN n 1 302 ALA n 1 303 LEU n 1 304 ALA n 1 305 HIS n 1 306 ALA n 1 307 TYR n 1 308 PHE n 1 309 ALA n 1 310 GLN n 1 311 TYR n 1 312 HIS n 1 313 ASP n 1 314 PRO n 1 315 ASP n 1 316 ASP n 1 317 GLU n 1 318 PRO n 1 319 VAL n 1 320 ALA n 1 321 ASP n 1 322 PRO n 1 323 TYR n 1 324 ASP n 1 325 GLN n 1 326 SER n 1 327 PHE n 1 328 GLU n 1 329 SER n 1 330 ARG n 1 331 ASP n 1 332 LEU n 1 333 LEU n 1 334 ILE n 1 335 ASP n 1 336 GLU n 1 337 TRP n 1 338 LYS n 1 339 SER n 1 340 LEU n 1 341 THR n 1 342 TYR n 1 343 ASP n 1 344 GLU n 1 345 VAL n 1 346 ILE n 1 347 SER n 1 348 PHE n 1 349 VAL n 1 350 PRO n 1 351 PRO n 1 352 PRO n 1 353 LEU n 1 354 ASP n 1 355 GLN n 1 356 GLU n 1 357 GLU n 1 358 MET n 1 359 GLU n 1 360 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 360 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2, SAPK2A' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MK14_HUMAN _struct_ref.pdbx_db_accession Q16539 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKH ENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNE DCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA DPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5OMH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 360 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q16539 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 360 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 360 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 9Y5 non-polymer . '1-(3-chlorophenyl)-3-methyl-4~{H}-pyrazolo[4,3-c][1,2]benzothiazine 5,5-dioxide' ? 'C16 H12 Cl N3 O2 S' 345.803 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5OMH _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.27 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.81 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;100 mM MES pH 5.6-6.2, 20-30 % PEG4000, 50 mM BOG ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 90 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-10-20 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00001 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X10SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00001 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X10SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5OMH _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.50 _reflns.d_resolution_low 50.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12754 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.1 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.6 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 26.78 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.063 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.50 _reflns_shell.d_res_low 2.56 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.44 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 99.5 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 13.5 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.96 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 3.30 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][2] -3.76 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 0.46 _refine.B_iso_max ? _refine.B_iso_mean 63.876 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.942 _refine.correlation_coeff_Fo_to_Fc_free 0.910 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5OMH _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.50 _refine.ls_d_res_low 48.86 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12754 _refine.ls_number_reflns_R_free 672 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.11 _refine.ls_percent_reflns_R_free 5.0 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.21817 _refine.ls_R_factor_R_free 0.27716 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.21500 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.546 _refine.pdbx_overall_ESU_R_Free 0.316 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 11.366 _refine.overall_SU_ML 0.254 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 2517 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 23 _refine_hist.number_atoms_solvent 7 _refine_hist.number_atoms_total 2547 _refine_hist.d_res_high 2.50 _refine_hist.d_res_low 48.86 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.013 0.019 2602 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 2432 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.545 1.971 3555 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.972 3.001 5557 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 4.735 5.000 321 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 34.104 23.981 108 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 16.716 15.000 404 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 18.322 15.000 12 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.080 0.200 412 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.021 2920 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 591 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 5.041 6.470 1296 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 5.023 6.467 1295 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 7.295 9.689 1613 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 7.293 9.694 1614 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 5.424 6.763 1306 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 5.423 6.765 1307 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 7.925 10.022 1943 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 12.075 60.600 10899 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 12.075 60.603 10900 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.500 _refine_ls_shell.d_res_low 2.565 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 49 _refine_ls_shell.number_reflns_R_work 931 _refine_ls_shell.percent_reflns_obs 99.49 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.361 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.277 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5OMH _struct.title 'p38alpha in complex with pyrazolobenzothiazine inhibitor COXH11' _struct.pdbx_descriptor 'Mitogen-activated protein kinase 14 (E.C.2.7.11.24)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5OMH _struct_keywords.text 'p38, kinase, inhibitor, pyrazolobenzothiazine, complex, Transferase' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 61 ? MET A 78 ? SER A 61 MET A 78 1 ? 18 HELX_P HELX_P2 AA2 SER A 95 ? PHE A 99 ? SER A 95 PHE A 99 5 ? 5 HELX_P HELX_P3 AA3 THR A 123 ? SER A 143 ? THR A 123 SER A 143 1 ? 21 HELX_P HELX_P4 AA4 LYS A 152 ? SER A 154 ? LYS A 152 SER A 154 5 ? 3 HELX_P HELX_P5 AA5 THR A 185 ? ARG A 189 ? THR A 185 ARG A 189 5 ? 5 HELX_P HELX_P6 AA6 ALA A 190 ? LEU A 195 ? ALA A 190 LEU A 195 1 ? 6 HELX_P HELX_P7 AA7 THR A 203 ? GLY A 219 ? THR A 203 GLY A 219 1 ? 17 HELX_P HELX_P8 AA8 ILE A 229 ? GLY A 240 ? ILE A 229 GLY A 240 1 ? 12 HELX_P HELX_P9 AA9 GLY A 243 ? LYS A 248 ? GLY A 243 LYS A 248 1 ? 6 HELX_P HELX_P10 AB1 SER A 252 ? SER A 261 ? SER A 252 SER A 261 1 ? 10 HELX_P HELX_P11 AB2 ASN A 269 ? PHE A 274 ? ASN A 269 PHE A 274 1 ? 6 HELX_P HELX_P12 AB3 ASN A 278 ? LEU A 289 ? ASN A 278 LEU A 289 1 ? 12 HELX_P HELX_P13 AB4 ASP A 292 ? ARG A 296 ? ASP A 292 ARG A 296 5 ? 5 HELX_P HELX_P14 AB5 THR A 298 ? LEU A 303 ? THR A 298 LEU A 303 1 ? 6 HELX_P HELX_P15 AB6 ALA A 304 ? ALA A 309 ? ALA A 304 ALA A 309 5 ? 6 HELX_P HELX_P16 AB7 GLN A 325 ? ARG A 330 ? GLN A 325 ARG A 330 5 ? 6 HELX_P HELX_P17 AB8 LEU A 333 ? SER A 347 ? LEU A 333 SER A 347 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? AA3 ? 5 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 8 ? TYR A 9 ? PHE A 8 TYR A 9 AA1 2 VAL A 20 ? PRO A 21 ? VAL A 20 PRO A 21 AA2 1 GLU A 12 ? LEU A 13 ? GLU A 12 LEU A 13 AA2 2 THR A 16 ? ILE A 17 ? THR A 16 ILE A 17 AA3 1 TYR A 24 ? PRO A 29 ? TYR A 24 PRO A 29 AA3 2 SER A 37 ? ASP A 43 ? SER A 37 ASP A 43 AA3 3 ARG A 49 ? LYS A 54 ? ARG A 49 LYS A 54 AA3 4 TYR A 103 ? HIS A 107 ? TYR A 103 HIS A 107 AA3 5 ASP A 88 ? PHE A 90 ? ASP A 88 PHE A 90 AA4 1 LEU A 156 ? VAL A 158 ? LEU A 156 VAL A 158 AA4 2 LEU A 164 ? ILE A 166 ? LEU A 164 ILE A 166 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TYR A 9 ? N TYR A 9 O VAL A 20 ? O VAL A 20 AA2 1 2 N LEU A 13 ? N LEU A 13 O THR A 16 ? O THR A 16 AA3 1 2 N SER A 28 ? N SER A 28 O ALA A 40 ? O ALA A 40 AA3 2 3 N CYS A 39 ? N CYS A 39 O VAL A 52 ? O VAL A 52 AA3 3 4 N ALA A 51 ? N ALA A 51 O THR A 106 ? O THR A 106 AA3 4 5 O VAL A 105 ? O VAL A 105 N ASP A 88 ? N ASP A 88 AA4 1 2 N ALA A 157 ? N ALA A 157 O LYS A 165 ? O LYS A 165 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id 9Y5 _struct_site.pdbx_auth_seq_id 401 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 8 _struct_site.details 'binding site for residue 9Y5 A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 LYS A 53 ? LYS A 53 . ? 1_555 ? 2 AC1 8 GLU A 71 ? GLU A 71 . ? 1_555 ? 3 AC1 8 THR A 106 ? THR A 106 . ? 1_555 ? 4 AC1 8 HIS A 107 ? HIS A 107 . ? 1_555 ? 5 AC1 8 MET A 109 ? MET A 109 . ? 1_555 ? 6 AC1 8 LEU A 167 ? LEU A 167 . ? 1_555 ? 7 AC1 8 ASP A 168 ? ASP A 168 . ? 1_555 ? 8 AC1 8 HOH C . ? HOH A 507 . ? 1_555 ? # _atom_sites.entry_id 5OMH _atom_sites.fract_transf_matrix[1][1] 0.015523 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013337 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012868 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 GLN 3 3 ? ? ? A . n A 1 4 GLU 4 4 ? ? ? A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 TRP 18 18 18 TRP TRP A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 GLY 31 31 ? ? ? A . n A 1 32 SER 32 32 ? ? ? A . n A 1 33 GLY 33 33 ? ? ? A . n A 1 34 ALA 34 34 ? ? ? A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 HIS 77 77 77 HIS HIS A . n A 1 78 MET 78 78 78 MET MET A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 HIS 80 80 80 HIS HIS A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 PHE 99 99 99 PHE PHE A . n A 1 100 ASN 100 100 100 ASN ASN A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 TYR 103 103 103 TYR TYR A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 HIS 107 107 107 HIS HIS A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 MET 109 109 109 MET MET A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 ASN 114 114 114 ASN ASN A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 ILE 116 116 ? ? ? A . n A 1 117 VAL 117 117 ? ? ? A . n A 1 118 LYS 118 118 ? ? ? A . n A 1 119 CYS 119 119 ? ? ? A . n A 1 120 GLN 120 120 ? ? ? A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 THR 123 123 123 THR THR A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 ASP 125 125 125 ASP ASP A . n A 1 126 HIS 126 126 126 HIS HIS A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 GLN 128 128 128 GLN GLN A . n A 1 129 PHE 129 129 129 PHE PHE A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 TYR 132 132 132 TYR TYR A . n A 1 133 GLN 133 133 133 GLN GLN A . n A 1 134 ILE 134 134 134 ILE ILE A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 ARG 136 136 136 ARG ARG A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 TYR 140 140 140 TYR TYR A . n A 1 141 ILE 141 141 141 ILE ILE A . n A 1 142 HIS 142 142 142 HIS HIS A . n A 1 143 SER 143 143 143 SER SER A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 ILE 146 146 146 ILE ILE A . n A 1 147 ILE 147 147 147 ILE ILE A . n A 1 148 HIS 148 148 148 HIS HIS A . n A 1 149 ARG 149 149 149 ARG ARG A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 LYS 152 152 152 LYS LYS A . n A 1 153 PRO 153 153 153 PRO PRO A . n A 1 154 SER 154 154 154 SER SER A . n A 1 155 ASN 155 155 155 ASN ASN A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 ALA 157 157 157 ALA ALA A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 ASN 159 159 159 ASN ASN A . n A 1 160 GLU 160 160 160 GLU GLU A . n A 1 161 ASP 161 161 161 ASP ASP A . n A 1 162 CYS 162 162 162 CYS CYS A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 LYS 165 165 165 LYS LYS A . n A 1 166 ILE 166 166 166 ILE ILE A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 ASP 168 168 168 ASP ASP A . n A 1 169 PHE 169 169 ? ? ? A . n A 1 170 GLY 170 170 ? ? ? A . n A 1 171 LEU 171 171 ? ? ? A . n A 1 172 ALA 172 172 ? ? ? A . n A 1 173 ARG 173 173 ? ? ? A . n A 1 174 HIS 174 174 ? ? ? A . n A 1 175 THR 175 175 ? ? ? A . n A 1 176 ASP 176 176 ? ? ? A . n A 1 177 ASP 177 177 ? ? ? A . n A 1 178 GLU 178 178 ? ? ? A . n A 1 179 MET 179 179 ? ? ? A . n A 1 180 THR 180 180 ? ? ? A . n A 1 181 GLY 181 181 ? ? ? A . n A 1 182 TYR 182 182 ? ? ? A . n A 1 183 VAL 183 183 ? ? ? A . n A 1 184 ALA 184 184 184 ALA ALA A . n A 1 185 THR 185 185 185 THR THR A . n A 1 186 ARG 186 186 186 ARG ARG A . n A 1 187 TRP 187 187 187 TRP TRP A . n A 1 188 TYR 188 188 188 TYR TYR A . n A 1 189 ARG 189 189 189 ARG ARG A . n A 1 190 ALA 190 190 190 ALA ALA A . n A 1 191 PRO 191 191 191 PRO PRO A . n A 1 192 GLU 192 192 192 GLU GLU A . n A 1 193 ILE 193 193 193 ILE ILE A . n A 1 194 MET 194 194 194 MET MET A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 ASN 196 196 196 ASN ASN A . n A 1 197 TRP 197 197 197 TRP TRP A . n A 1 198 MET 198 198 198 MET MET A . n A 1 199 HIS 199 199 199 HIS HIS A . n A 1 200 TYR 200 200 200 TYR TYR A . n A 1 201 ASN 201 201 201 ASN ASN A . n A 1 202 GLN 202 202 202 GLN GLN A . n A 1 203 THR 203 203 203 THR THR A . n A 1 204 VAL 204 204 204 VAL VAL A . n A 1 205 ASP 205 205 205 ASP ASP A . n A 1 206 ILE 206 206 206 ILE ILE A . n A 1 207 TRP 207 207 207 TRP TRP A . n A 1 208 SER 208 208 208 SER SER A . n A 1 209 VAL 209 209 209 VAL VAL A . n A 1 210 GLY 210 210 210 GLY GLY A . n A 1 211 CYS 211 211 211 CYS CYS A . n A 1 212 ILE 212 212 212 ILE ILE A . n A 1 213 MET 213 213 213 MET MET A . n A 1 214 ALA 214 214 214 ALA ALA A . n A 1 215 GLU 215 215 215 GLU GLU A . n A 1 216 LEU 216 216 216 LEU LEU A . n A 1 217 LEU 217 217 217 LEU LEU A . n A 1 218 THR 218 218 218 THR THR A . n A 1 219 GLY 219 219 219 GLY GLY A . n A 1 220 ARG 220 220 220 ARG ARG A . n A 1 221 THR 221 221 221 THR THR A . n A 1 222 LEU 222 222 222 LEU LEU A . n A 1 223 PHE 223 223 223 PHE PHE A . n A 1 224 PRO 224 224 224 PRO PRO A . n A 1 225 GLY 225 225 225 GLY GLY A . n A 1 226 THR 226 226 226 THR THR A . n A 1 227 ASP 227 227 227 ASP ASP A . n A 1 228 HIS 228 228 228 HIS HIS A . n A 1 229 ILE 229 229 229 ILE ILE A . n A 1 230 ASP 230 230 230 ASP ASP A . n A 1 231 GLN 231 231 231 GLN GLN A . n A 1 232 LEU 232 232 232 LEU LEU A . n A 1 233 LYS 233 233 233 LYS LYS A . n A 1 234 LEU 234 234 234 LEU LEU A . n A 1 235 ILE 235 235 235 ILE ILE A . n A 1 236 LEU 236 236 236 LEU LEU A . n A 1 237 ARG 237 237 237 ARG ARG A . n A 1 238 LEU 238 238 238 LEU LEU A . n A 1 239 VAL 239 239 239 VAL VAL A . n A 1 240 GLY 240 240 240 GLY GLY A . n A 1 241 THR 241 241 241 THR THR A . n A 1 242 PRO 242 242 242 PRO PRO A . n A 1 243 GLY 243 243 243 GLY GLY A . n A 1 244 ALA 244 244 244 ALA ALA A . n A 1 245 GLU 245 245 245 GLU GLU A . n A 1 246 LEU 246 246 246 LEU LEU A . n A 1 247 LEU 247 247 247 LEU LEU A . n A 1 248 LYS 248 248 248 LYS LYS A . n A 1 249 LYS 249 249 249 LYS LYS A . n A 1 250 ILE 250 250 250 ILE ILE A . n A 1 251 SER 251 251 251 SER SER A . n A 1 252 SER 252 252 252 SER SER A . n A 1 253 GLU 253 253 253 GLU GLU A . n A 1 254 SER 254 254 254 SER SER A . n A 1 255 ALA 255 255 255 ALA ALA A . n A 1 256 ARG 256 256 256 ARG ARG A . n A 1 257 ASN 257 257 257 ASN ASN A . n A 1 258 TYR 258 258 258 TYR TYR A . n A 1 259 ILE 259 259 259 ILE ILE A . n A 1 260 GLN 260 260 260 GLN GLN A . n A 1 261 SER 261 261 261 SER SER A . n A 1 262 LEU 262 262 262 LEU LEU A . n A 1 263 THR 263 263 263 THR THR A . n A 1 264 GLN 264 264 264 GLN GLN A . n A 1 265 MET 265 265 265 MET MET A . n A 1 266 PRO 266 266 266 PRO PRO A . n A 1 267 LYS 267 267 267 LYS LYS A . n A 1 268 MET 268 268 268 MET MET A . n A 1 269 ASN 269 269 269 ASN ASN A . n A 1 270 PHE 270 270 270 PHE PHE A . n A 1 271 ALA 271 271 271 ALA ALA A . n A 1 272 ASN 272 272 272 ASN ASN A . n A 1 273 VAL 273 273 273 VAL VAL A . n A 1 274 PHE 274 274 274 PHE PHE A . n A 1 275 ILE 275 275 275 ILE ILE A . n A 1 276 GLY 276 276 276 GLY GLY A . n A 1 277 ALA 277 277 277 ALA ALA A . n A 1 278 ASN 278 278 278 ASN ASN A . n A 1 279 PRO 279 279 279 PRO PRO A . n A 1 280 LEU 280 280 280 LEU LEU A . n A 1 281 ALA 281 281 281 ALA ALA A . n A 1 282 VAL 282 282 282 VAL VAL A . n A 1 283 ASP 283 283 283 ASP ASP A . n A 1 284 LEU 284 284 284 LEU LEU A . n A 1 285 LEU 285 285 285 LEU LEU A . n A 1 286 GLU 286 286 286 GLU GLU A . n A 1 287 LYS 287 287 287 LYS LYS A . n A 1 288 MET 288 288 288 MET MET A . n A 1 289 LEU 289 289 289 LEU LEU A . n A 1 290 VAL 290 290 290 VAL VAL A . n A 1 291 LEU 291 291 291 LEU LEU A . n A 1 292 ASP 292 292 292 ASP ASP A . n A 1 293 SER 293 293 293 SER SER A . n A 1 294 ASP 294 294 294 ASP ASP A . n A 1 295 LYS 295 295 295 LYS LYS A . n A 1 296 ARG 296 296 296 ARG ARG A . n A 1 297 ILE 297 297 297 ILE ILE A . n A 1 298 THR 298 298 298 THR THR A . n A 1 299 ALA 299 299 299 ALA ALA A . n A 1 300 ALA 300 300 300 ALA ALA A . n A 1 301 GLN 301 301 301 GLN GLN A . n A 1 302 ALA 302 302 302 ALA ALA A . n A 1 303 LEU 303 303 303 LEU LEU A . n A 1 304 ALA 304 304 304 ALA ALA A . n A 1 305 HIS 305 305 305 HIS HIS A . n A 1 306 ALA 306 306 306 ALA ALA A . n A 1 307 TYR 307 307 307 TYR TYR A . n A 1 308 PHE 308 308 308 PHE PHE A . n A 1 309 ALA 309 309 309 ALA ALA A . n A 1 310 GLN 310 310 310 GLN GLN A . n A 1 311 TYR 311 311 311 TYR TYR A . n A 1 312 HIS 312 312 312 HIS HIS A . n A 1 313 ASP 313 313 313 ASP ASP A . n A 1 314 PRO 314 314 314 PRO PRO A . n A 1 315 ASP 315 315 315 ASP ASP A . n A 1 316 ASP 316 316 316 ASP ASP A . n A 1 317 GLU 317 317 317 GLU GLU A . n A 1 318 PRO 318 318 318 PRO PRO A . n A 1 319 VAL 319 319 319 VAL VAL A . n A 1 320 ALA 320 320 320 ALA ALA A . n A 1 321 ASP 321 321 321 ASP ASP A . n A 1 322 PRO 322 322 322 PRO PRO A . n A 1 323 TYR 323 323 323 TYR TYR A . n A 1 324 ASP 324 324 324 ASP ASP A . n A 1 325 GLN 325 325 325 GLN GLN A . n A 1 326 SER 326 326 326 SER SER A . n A 1 327 PHE 327 327 327 PHE PHE A . n A 1 328 GLU 328 328 328 GLU GLU A . n A 1 329 SER 329 329 329 SER SER A . n A 1 330 ARG 330 330 330 ARG ARG A . n A 1 331 ASP 331 331 331 ASP ASP A . n A 1 332 LEU 332 332 332 LEU LEU A . n A 1 333 LEU 333 333 333 LEU LEU A . n A 1 334 ILE 334 334 334 ILE ILE A . n A 1 335 ASP 335 335 335 ASP ASP A . n A 1 336 GLU 336 336 336 GLU GLU A . n A 1 337 TRP 337 337 337 TRP TRP A . n A 1 338 LYS 338 338 338 LYS LYS A . n A 1 339 SER 339 339 339 SER SER A . n A 1 340 LEU 340 340 340 LEU LEU A . n A 1 341 THR 341 341 341 THR THR A . n A 1 342 TYR 342 342 342 TYR TYR A . n A 1 343 ASP 343 343 343 ASP ASP A . n A 1 344 GLU 344 344 344 GLU GLU A . n A 1 345 VAL 345 345 345 VAL VAL A . n A 1 346 ILE 346 346 346 ILE ILE A . n A 1 347 SER 347 347 347 SER SER A . n A 1 348 PHE 348 348 348 PHE PHE A . n A 1 349 VAL 349 349 349 VAL VAL A . n A 1 350 PRO 350 350 350 PRO PRO A . n A 1 351 PRO 351 351 351 PRO PRO A . n A 1 352 PRO 352 352 352 PRO PRO A . n A 1 353 LEU 353 353 353 LEU LEU A . n A 1 354 ASP 354 354 ? ? ? A . n A 1 355 GLN 355 355 ? ? ? A . n A 1 356 GLU 356 356 ? ? ? A . n A 1 357 GLU 357 357 ? ? ? A . n A 1 358 MET 358 358 ? ? ? A . n A 1 359 GLU 359 359 ? ? ? A . n A 1 360 SER 360 360 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 9Y5 1 401 1 9Y5 DRG A . C 3 HOH 1 501 1 HOH HOH A . C 3 HOH 2 502 3 HOH HOH A . C 3 HOH 3 503 4 HOH HOH A . C 3 HOH 4 504 7 HOH HOH A . C 3 HOH 5 505 2 HOH HOH A . C 3 HOH 6 506 5 HOH HOH A . C 3 HOH 7 507 6 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 15850 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-03-13 2 'Structure model' 1 1 2019-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' pdbx_database_proc # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_volume' 3 2 'Structure model' '_citation.page_first' 4 2 'Structure model' '_citation.page_last' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0103 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 13 ? ? 178.05 148.96 2 1 PRO A 29 ? ? -54.94 170.19 3 1 ARG A 149 ? ? 81.58 -12.11 4 1 ASP A 150 ? ? -147.57 35.87 5 1 LEU A 289 ? ? -89.23 33.08 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 5 ? CG ? A ARG 5 CG 2 1 Y 1 A ARG 5 ? CD ? A ARG 5 CD 3 1 Y 1 A ARG 5 ? NE ? A ARG 5 NE 4 1 Y 1 A ARG 5 ? CZ ? A ARG 5 CZ 5 1 Y 1 A ARG 5 ? NH1 ? A ARG 5 NH1 6 1 Y 1 A ARG 5 ? NH2 ? A ARG 5 NH2 7 1 Y 1 A ARG 10 ? CG ? A ARG 10 CG 8 1 Y 1 A ARG 10 ? CD ? A ARG 10 CD 9 1 Y 1 A ARG 10 ? NE ? A ARG 10 NE 10 1 Y 1 A ARG 10 ? CZ ? A ARG 10 CZ 11 1 Y 1 A ARG 10 ? NH1 ? A ARG 10 NH1 12 1 Y 1 A ARG 10 ? NH2 ? A ARG 10 NH2 13 1 Y 1 A GLN 11 ? CG ? A GLN 11 CG 14 1 Y 1 A GLN 11 ? CD ? A GLN 11 CD 15 1 Y 1 A GLN 11 ? OE1 ? A GLN 11 OE1 16 1 Y 1 A GLN 11 ? NE2 ? A GLN 11 NE2 17 1 Y 1 A GLU 12 ? CG ? A GLU 12 CG 18 1 Y 1 A GLU 12 ? CD ? A GLU 12 CD 19 1 Y 1 A GLU 12 ? OE1 ? A GLU 12 OE1 20 1 Y 1 A GLU 12 ? OE2 ? A GLU 12 OE2 21 1 Y 1 A LEU 13 ? CG ? A LEU 13 CG 22 1 Y 1 A LEU 13 ? CD1 ? A LEU 13 CD1 23 1 Y 1 A LEU 13 ? CD2 ? A LEU 13 CD2 24 1 Y 1 A ASN 14 ? CG ? A ASN 14 CG 25 1 Y 1 A ASN 14 ? OD1 ? A ASN 14 OD1 26 1 Y 1 A ASN 14 ? ND2 ? A ASN 14 ND2 27 1 Y 1 A LYS 15 ? CG ? A LYS 15 CG 28 1 Y 1 A LYS 15 ? CD ? A LYS 15 CD 29 1 Y 1 A LYS 15 ? CE ? A LYS 15 CE 30 1 Y 1 A LYS 15 ? NZ ? A LYS 15 NZ 31 1 Y 1 A GLU 19 ? CG ? A GLU 19 CG 32 1 Y 1 A GLU 19 ? CD ? A GLU 19 CD 33 1 Y 1 A GLU 19 ? OE1 ? A GLU 19 OE1 34 1 Y 1 A GLU 19 ? OE2 ? A GLU 19 OE2 35 1 Y 1 A GLU 22 ? CG ? A GLU 22 CG 36 1 Y 1 A GLU 22 ? CD ? A GLU 22 CD 37 1 Y 1 A GLU 22 ? OE1 ? A GLU 22 OE1 38 1 Y 1 A GLU 22 ? OE2 ? A GLU 22 OE2 39 1 Y 1 A TYR 35 ? CG ? A TYR 35 CG 40 1 Y 1 A TYR 35 ? CD1 ? A TYR 35 CD1 41 1 Y 1 A TYR 35 ? CD2 ? A TYR 35 CD2 42 1 Y 1 A TYR 35 ? CE1 ? A TYR 35 CE1 43 1 Y 1 A TYR 35 ? CE2 ? A TYR 35 CE2 44 1 Y 1 A TYR 35 ? CZ ? A TYR 35 CZ 45 1 Y 1 A TYR 35 ? OH ? A TYR 35 OH 46 1 Y 1 A LYS 45 ? CG ? A LYS 45 CG 47 1 Y 1 A LYS 45 ? CD ? A LYS 45 CD 48 1 Y 1 A LYS 45 ? CE ? A LYS 45 CE 49 1 Y 1 A LYS 45 ? NZ ? A LYS 45 NZ 50 1 Y 1 A LEU 48 ? CG ? A LEU 48 CG 51 1 Y 1 A LEU 48 ? CD1 ? A LEU 48 CD1 52 1 Y 1 A LEU 48 ? CD2 ? A LEU 48 CD2 53 1 Y 1 A ARG 49 ? CG ? A ARG 49 CG 54 1 Y 1 A ARG 49 ? CD ? A ARG 49 CD 55 1 Y 1 A ARG 49 ? NE ? A ARG 49 NE 56 1 Y 1 A ARG 49 ? CZ ? A ARG 49 CZ 57 1 Y 1 A ARG 49 ? NH1 ? A ARG 49 NH1 58 1 Y 1 A ARG 49 ? NH2 ? A ARG 49 NH2 59 1 Y 1 A LYS 54 ? CE ? A LYS 54 CE 60 1 Y 1 A LYS 54 ? NZ ? A LYS 54 NZ 61 1 Y 1 A ARG 57 ? CG ? A ARG 57 CG 62 1 Y 1 A ARG 57 ? CD ? A ARG 57 CD 63 1 Y 1 A ARG 57 ? NE ? A ARG 57 NE 64 1 Y 1 A ARG 57 ? CZ ? A ARG 57 CZ 65 1 Y 1 A ARG 57 ? NH1 ? A ARG 57 NH1 66 1 Y 1 A ARG 57 ? NH2 ? A ARG 57 NH2 67 1 Y 1 A ARG 94 ? CG ? A ARG 94 CG 68 1 Y 1 A ARG 94 ? CD ? A ARG 94 CD 69 1 Y 1 A ARG 94 ? NE ? A ARG 94 NE 70 1 Y 1 A ARG 94 ? CZ ? A ARG 94 CZ 71 1 Y 1 A ARG 94 ? NH1 ? A ARG 94 NH1 72 1 Y 1 A ARG 94 ? NH2 ? A ARG 94 NH2 73 1 Y 1 A GLU 97 ? CG ? A GLU 97 CG 74 1 Y 1 A GLU 97 ? CD ? A GLU 97 CD 75 1 Y 1 A GLU 97 ? OE1 ? A GLU 97 OE1 76 1 Y 1 A GLU 97 ? OE2 ? A GLU 97 OE2 77 1 Y 1 A GLU 98 ? CG ? A GLU 98 CG 78 1 Y 1 A GLU 98 ? CD ? A GLU 98 CD 79 1 Y 1 A GLU 98 ? OE1 ? A GLU 98 OE1 80 1 Y 1 A GLU 98 ? OE2 ? A GLU 98 OE2 81 1 Y 1 A ASP 101 ? CG ? A ASP 101 CG 82 1 Y 1 A ASP 101 ? OD1 ? A ASP 101 OD1 83 1 Y 1 A ASP 101 ? OD2 ? A ASP 101 OD2 84 1 Y 1 A LYS 121 ? CG ? A LYS 121 CG 85 1 Y 1 A LYS 121 ? CD ? A LYS 121 CD 86 1 Y 1 A LYS 121 ? CE ? A LYS 121 CE 87 1 Y 1 A LYS 121 ? NZ ? A LYS 121 NZ 88 1 Y 1 A ASP 145 ? CG ? A ASP 145 CG 89 1 Y 1 A ASP 145 ? OD1 ? A ASP 145 OD1 90 1 Y 1 A ASP 145 ? OD2 ? A ASP 145 OD2 91 1 Y 1 A GLU 160 ? CG ? A GLU 160 CG 92 1 Y 1 A GLU 160 ? CD ? A GLU 160 CD 93 1 Y 1 A GLU 160 ? OE1 ? A GLU 160 OE1 94 1 Y 1 A GLU 160 ? OE2 ? A GLU 160 OE2 95 1 Y 1 A LYS 165 ? CE ? A LYS 165 CE 96 1 Y 1 A LYS 165 ? NZ ? A LYS 165 NZ 97 1 Y 1 A ASN 196 ? CG ? A ASN 196 CG 98 1 Y 1 A ASN 196 ? OD1 ? A ASN 196 OD1 99 1 Y 1 A ASN 196 ? ND2 ? A ASN 196 ND2 100 1 Y 1 A MET 198 ? CG ? A MET 198 CG 101 1 Y 1 A MET 198 ? SD ? A MET 198 SD 102 1 Y 1 A MET 198 ? CE ? A MET 198 CE 103 1 Y 1 A LYS 233 ? CG ? A LYS 233 CG 104 1 Y 1 A LYS 233 ? CD ? A LYS 233 CD 105 1 Y 1 A LYS 233 ? CE ? A LYS 233 CE 106 1 Y 1 A LYS 233 ? NZ ? A LYS 233 NZ 107 1 Y 1 A ARG 237 ? CZ ? A ARG 237 CZ 108 1 Y 1 A ARG 237 ? NH1 ? A ARG 237 NH1 109 1 Y 1 A ARG 237 ? NH2 ? A ARG 237 NH2 110 1 Y 1 A GLU 245 ? CG ? A GLU 245 CG 111 1 Y 1 A GLU 245 ? CD ? A GLU 245 CD 112 1 Y 1 A GLU 245 ? OE1 ? A GLU 245 OE1 113 1 Y 1 A GLU 245 ? OE2 ? A GLU 245 OE2 114 1 Y 1 A GLN 264 ? CG ? A GLN 264 CG 115 1 Y 1 A GLN 264 ? CD ? A GLN 264 CD 116 1 Y 1 A GLN 264 ? OE1 ? A GLN 264 OE1 117 1 Y 1 A GLN 264 ? NE2 ? A GLN 264 NE2 118 1 Y 1 A LYS 267 ? CE ? A LYS 267 CE 119 1 Y 1 A LYS 267 ? NZ ? A LYS 267 NZ 120 1 Y 1 A LEU 353 ? CG ? A LEU 353 CG 121 1 Y 1 A LEU 353 ? CD1 ? A LEU 353 CD1 122 1 Y 1 A LEU 353 ? CD2 ? A LEU 353 CD2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A GLN 3 ? A GLN 3 4 1 Y 1 A GLU 4 ? A GLU 4 5 1 Y 1 A GLY 31 ? A GLY 31 6 1 Y 1 A SER 32 ? A SER 32 7 1 Y 1 A GLY 33 ? A GLY 33 8 1 Y 1 A ALA 34 ? A ALA 34 9 1 Y 1 A ILE 116 ? A ILE 116 10 1 Y 1 A VAL 117 ? A VAL 117 11 1 Y 1 A LYS 118 ? A LYS 118 12 1 Y 1 A CYS 119 ? A CYS 119 13 1 Y 1 A GLN 120 ? A GLN 120 14 1 Y 1 A PHE 169 ? A PHE 169 15 1 Y 1 A GLY 170 ? A GLY 170 16 1 Y 1 A LEU 171 ? A LEU 171 17 1 Y 1 A ALA 172 ? A ALA 172 18 1 Y 1 A ARG 173 ? A ARG 173 19 1 Y 1 A HIS 174 ? A HIS 174 20 1 Y 1 A THR 175 ? A THR 175 21 1 Y 1 A ASP 176 ? A ASP 176 22 1 Y 1 A ASP 177 ? A ASP 177 23 1 Y 1 A GLU 178 ? A GLU 178 24 1 Y 1 A MET 179 ? A MET 179 25 1 Y 1 A THR 180 ? A THR 180 26 1 Y 1 A GLY 181 ? A GLY 181 27 1 Y 1 A TYR 182 ? A TYR 182 28 1 Y 1 A VAL 183 ? A VAL 183 29 1 Y 1 A ASP 354 ? A ASP 354 30 1 Y 1 A GLN 355 ? A GLN 355 31 1 Y 1 A GLU 356 ? A GLU 356 32 1 Y 1 A GLU 357 ? A GLU 357 33 1 Y 1 A MET 358 ? A MET 358 34 1 Y 1 A GLU 359 ? A GLU 359 35 1 Y 1 A SER 360 ? A SER 360 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 9Y5 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 9Y5 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '1-(3-chlorophenyl)-3-methyl-4~{H}-pyrazolo[4,3-c][1,2]benzothiazine 5,5-dioxide' 9Y5 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #