data_5ONS # _entry.id 5ONS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.295 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5ONS WWPDB D_1200006080 # _pdbx_database_related.db_name PDB _pdbx_database_related.details 'Contains this complex on the 40S ribosomal subunit' _pdbx_database_related.db_id 5VYC _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5ONS _pdbx_database_status.recvd_initial_deposition_date 2017-08-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ahmed, Y.L.' 1 0000-0002-4364-1372 'Sinning, I.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'PLoS Biol.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1545-7885 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 16 _citation.language ? _citation.page_first e2005160 _citation.page_last e2005160 _citation.title 'DENR-MCTS1 heterodimerization and tRNA recruitment are required for translation reinitiation.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1371/journal.pbio.2005160 _citation.pdbx_database_id_PubMed 29889857 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Ahmed, Y.L.' 1 primary 'Schleich, S.' 2 primary 'Bohlen, J.' 3 primary 'Mandel, N.' 4 primary 'Simon, B.' 5 primary 'Sinning, I.' 6 primary 'Teleman, A.A.' 7 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5ONS _cell.details ? _cell.formula_units_Z ? _cell.length_a 49.030 _cell.length_a_esd ? _cell.length_b 49.030 _cell.length_b_esd ? _cell.length_c 207.980 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5ONS _symmetry.cell_setting ? _symmetry.Int_Tables_number 91 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Malignant T-cell-amplified sequence 1' 20585.303 1 ? ? ? ? 2 polymer man 'Density-regulated protein' 4147.695 1 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 3 ? ? ? ? 4 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 5 water nat water 18.015 33 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'MCT-1,Multiple copies T-cell malignancies' 2 'DRP,Protein DRP1,Smooth muscle cell-associated protein 3,SMAP-3' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYP TLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNK GIGIENIHYLNDGLWHMKTYK ; ;MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYP TLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNK GIGIENIHYLNDGLWHMKTYK ; A ? 2 'polypeptide(L)' no no MHHHHHHDADYPLRVLYCGVCSLPTEYCEYMPDVA MHHHHHHDADYPLRVLYCGVCSLPTEYCEYMPDVA B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PHE n 1 3 LYS n 1 4 LYS n 1 5 PHE n 1 6 ASP n 1 7 GLU n 1 8 LYS n 1 9 GLU n 1 10 ASN n 1 11 VAL n 1 12 SER n 1 13 ASN n 1 14 CYS n 1 15 ILE n 1 16 GLN n 1 17 LEU n 1 18 LYS n 1 19 THR n 1 20 SER n 1 21 VAL n 1 22 ILE n 1 23 LYS n 1 24 GLY n 1 25 ILE n 1 26 LYS n 1 27 ASN n 1 28 GLN n 1 29 LEU n 1 30 ILE n 1 31 GLU n 1 32 GLN n 1 33 PHE n 1 34 PRO n 1 35 GLY n 1 36 ILE n 1 37 GLU n 1 38 PRO n 1 39 TRP n 1 40 LEU n 1 41 ASN n 1 42 GLN n 1 43 ILE n 1 44 MET n 1 45 PRO n 1 46 LYS n 1 47 LYS n 1 48 ASP n 1 49 PRO n 1 50 VAL n 1 51 LYS n 1 52 ILE n 1 53 VAL n 1 54 ARG n 1 55 CYS n 1 56 HIS n 1 57 GLU n 1 58 HIS n 1 59 ILE n 1 60 GLU n 1 61 ILE n 1 62 LEU n 1 63 THR n 1 64 VAL n 1 65 ASN n 1 66 GLY n 1 67 GLU n 1 68 LEU n 1 69 LEU n 1 70 PHE n 1 71 PHE n 1 72 ARG n 1 73 GLN n 1 74 ARG n 1 75 GLU n 1 76 GLY n 1 77 PRO n 1 78 PHE n 1 79 TYR n 1 80 PRO n 1 81 THR n 1 82 LEU n 1 83 ARG n 1 84 LEU n 1 85 LEU n 1 86 HIS n 1 87 LYS n 1 88 TYR n 1 89 PRO n 1 90 PHE n 1 91 ILE n 1 92 LEU n 1 93 PRO n 1 94 HIS n 1 95 GLN n 1 96 GLN n 1 97 VAL n 1 98 ASP n 1 99 LYS n 1 100 GLY n 1 101 ALA n 1 102 ILE n 1 103 LYS n 1 104 PHE n 1 105 VAL n 1 106 LEU n 1 107 SER n 1 108 GLY n 1 109 ALA n 1 110 ASN n 1 111 ILE n 1 112 MET n 1 113 CYS n 1 114 PRO n 1 115 GLY n 1 116 LEU n 1 117 THR n 1 118 SER n 1 119 PRO n 1 120 GLY n 1 121 ALA n 1 122 LYS n 1 123 LEU n 1 124 TYR n 1 125 PRO n 1 126 ALA n 1 127 ALA n 1 128 VAL n 1 129 ASP n 1 130 THR n 1 131 ILE n 1 132 VAL n 1 133 ALA n 1 134 ILE n 1 135 MET n 1 136 ALA n 1 137 GLU n 1 138 GLY n 1 139 LYS n 1 140 GLN n 1 141 HIS n 1 142 ALA n 1 143 LEU n 1 144 CYS n 1 145 VAL n 1 146 GLY n 1 147 VAL n 1 148 MET n 1 149 LYS n 1 150 MET n 1 151 SER n 1 152 ALA n 1 153 GLU n 1 154 ASP n 1 155 ILE n 1 156 GLU n 1 157 LYS n 1 158 VAL n 1 159 ASN n 1 160 LYS n 1 161 GLY n 1 162 ILE n 1 163 GLY n 1 164 ILE n 1 165 GLU n 1 166 ASN n 1 167 ILE n 1 168 HIS n 1 169 TYR n 1 170 LEU n 1 171 ASN n 1 172 ASP n 1 173 GLY n 1 174 LEU n 1 175 TRP n 1 176 HIS n 1 177 MET n 1 178 LYS n 1 179 THR n 1 180 TYR n 1 181 LYS n 2 1 MET n 2 2 HIS n 2 3 HIS n 2 4 HIS n 2 5 HIS n 2 6 HIS n 2 7 HIS n 2 8 ASP n 2 9 ALA n 2 10 ASP n 2 11 TYR n 2 12 PRO n 2 13 LEU n 2 14 ARG n 2 15 VAL n 2 16 LEU n 2 17 TYR n 2 18 CYS n 2 19 GLY n 2 20 VAL n 2 21 CYS n 2 22 SER n 2 23 LEU n 2 24 PRO n 2 25 THR n 2 26 GLU n 2 27 TYR n 2 28 CYS n 2 29 GLU n 2 30 TYR n 2 31 MET n 2 32 PRO n 2 33 ASP n 2 34 VAL n 2 35 ALA n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 181 Human ? 'MCTS1, MCT1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 35 Human ? 'DENR, DRP1, H14' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP MCTS1_HUMAN Q9ULC4 ? 1 ;MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYP TLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNK GIGIENIHYLNDGLWHMKTYK ; 1 2 UNP DENR_HUMAN O43583 ? 2 DADYPLRVLYCGVCSLPTEYCEYMPDVA 24 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5ONS A 1 ? 181 ? Q9ULC4 1 ? 181 ? 1 181 2 2 5ONS B 8 ? 35 ? O43583 24 ? 51 ? 24 51 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 2 5ONS MET B 1 ? UNP O43583 ? ? 'initiating methionine' 17 1 2 5ONS HIS B 2 ? UNP O43583 ? ? 'expression tag' 18 2 2 5ONS HIS B 3 ? UNP O43583 ? ? 'expression tag' 19 3 2 5ONS HIS B 4 ? UNP O43583 ? ? 'expression tag' 20 4 2 5ONS HIS B 5 ? UNP O43583 ? ? 'expression tag' 21 5 2 5ONS HIS B 6 ? UNP O43583 ? ? 'expression tag' 22 6 2 5ONS HIS B 7 ? UNP O43583 ? ? 'expression tag' 23 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5ONS _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.53 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.32 _exptl_crystal.description 'rod shaped' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.4 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.2 M Ammonium sulphate 20 % PEG3350 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-05-14 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.28226 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.28226 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 50.520 _reflns.entry_id 5ONS _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.14 _reflns.d_resolution_low 44.35 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14846 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.4 _reflns.pdbx_Rmerge_I_obs 0.092 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.61 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.14 _reflns_shell.d_res_low 2.18 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.19 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs 17005 _reflns_shell.number_possible ? _reflns_shell.number_unique_all 1430 _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 98.96 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.839 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 11.9 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.65 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 143.210 _refine.B_iso_mean 70.4816 _refine.B_iso_min 30.220 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5ONS _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.1400 _refine.ls_d_res_low 44.3480 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14842 _refine.ls_number_reflns_R_free 784 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.5200 _refine.ls_percent_reflns_R_free 5.2800 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2028 _refine.ls_R_factor_R_free 0.2501 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2002 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.240 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.0800 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2700 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.1400 _refine_hist.d_res_low 44.3480 _refine_hist.pdbx_number_atoms_ligand 19 _refine_hist.number_atoms_solvent 33 _refine_hist.number_atoms_total 1688 _refine_hist.pdbx_number_residues_total 205 _refine_hist.pdbx_B_iso_mean_ligand 88.09 _refine_hist.pdbx_B_iso_mean_solvent 63.58 _refine_hist.pdbx_number_atoms_protein 1636 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 ? 1691 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.042 ? 2280 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.061 ? 249 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 287 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 7.146 ? 1026 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.1400 2.2741 2360 . 102 2258 99.0000 . . . 0.3520 0.0000 0.2832 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.2741 2.4497 2413 . 142 2271 99.0000 . . . 0.2579 0.0000 0.2482 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.4497 2.6962 2415 . 119 2296 100.0000 . . . 0.3761 0.0000 0.2437 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.6962 3.0862 2465 . 130 2335 100.0000 . . . 0.3164 0.0000 0.2368 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 3.0862 3.8880 2498 . 147 2351 100.0000 . . . 0.2617 0.0000 0.1937 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 3.8880 44.3574 2691 . 144 2547 100.0000 . . . 0.2126 0.0000 0.1760 . . . . . . 6 . . . # _struct.entry_id 5ONS _struct.title 'Crystal structure of the minimal DENR-MCTS1 complex' _struct.pdbx_descriptor 'Malignant T-cell-amplified sequence 1, Density-regulated protein' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5ONS _struct_keywords.text 'translation initiation, Ribosome, TRANSLATION' _struct_keywords.pdbx_keywords TRANSLATION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? G N N 5 ? H N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 6 ? ASN A 10 ? ASP A 6 ASN A 10 1 ? 5 HELX_P HELX_P2 AA2 LYS A 18 ? PHE A 33 ? LYS A 18 PHE A 33 1 ? 16 HELX_P HELX_P3 AA3 PRO A 34 ? PRO A 38 ? PRO A 34 PRO A 38 5 ? 5 HELX_P HELX_P4 AA4 TRP A 39 ? MET A 44 ? TRP A 39 MET A 44 1 ? 6 HELX_P HELX_P5 AA5 THR A 81 ? TYR A 88 ? THR A 81 TYR A 88 1 ? 8 HELX_P HELX_P6 AA6 PRO A 89 ? LEU A 92 ? PRO A 89 LEU A 92 5 ? 4 HELX_P HELX_P7 AA7 ASP A 98 ? GLY A 100 ? ASP A 98 GLY A 100 5 ? 3 HELX_P HELX_P8 AA8 ALA A 101 ? LEU A 106 ? ALA A 101 LEU A 106 1 ? 6 HELX_P HELX_P9 AA9 CYS A 113 ? SER A 118 ? CYS A 113 SER A 118 1 ? 6 HELX_P HELX_P10 AB1 SER A 151 ? ASN A 159 ? SER A 151 ASN A 159 1 ? 9 HELX_P HELX_P11 AB2 ASP A 172 ? MET A 177 ? ASP A 172 MET A 177 1 ? 6 HELX_P HELX_P12 AB3 TYR B 27 ? MET B 31 ? TYR B 43 MET B 47 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? B CYS 18 SG ? ? ? 1_555 F ZN . ZN ? ? B CYS 34 B ZN 101 1_555 ? ? ? ? ? ? ? 2.379 ? metalc2 metalc ? ? B CYS 21 SG ? ? ? 1_555 F ZN . ZN ? ? B CYS 37 B ZN 101 1_555 ? ? ? ? ? ? ? 2.328 ? metalc3 metalc ? ? B CYS 28 SG ? ? ? 1_555 F ZN . ZN ? ? B CYS 44 B ZN 101 1_555 ? ? ? ? ? ? ? 2.466 ? metalc4 metalc ? ? A HIS 58 NE2 ? ? ? 1_555 F ZN . ZN ? ? A HIS 58 B ZN 101 8_655 ? ? ? ? ? ? ? 2.130 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id TYR _struct_mon_prot_cis.label_seq_id 11 _struct_mon_prot_cis.label_asym_id B _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id TYR _struct_mon_prot_cis.auth_seq_id 27 _struct_mon_prot_cis.auth_asym_id B _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 12 _struct_mon_prot_cis.pdbx_label_asym_id_2 B _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 28 _struct_mon_prot_cis.pdbx_auth_asym_id_2 B _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -7.05 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 11 ? GLN A 16 ? VAL A 11 GLN A 16 AA1 2 VAL A 50 ? CYS A 55 ? VAL A 50 CYS A 55 AA1 3 ILE A 59 ? VAL A 64 ? ILE A 59 VAL A 64 AA1 4 GLU A 67 ? GLN A 73 ? GLU A 67 GLN A 73 AA1 5 TYR A 79 ? PRO A 80 ? TYR A 79 PRO A 80 AA2 1 HIS A 94 ? VAL A 97 ? HIS A 94 VAL A 97 AA2 2 ILE A 131 ? ALA A 136 ? ILE A 131 ALA A 136 AA2 3 CYS A 144 ? MET A 148 ? CYS A 144 MET A 148 AA2 4 ILE A 162 ? TYR A 169 ? ILE A 162 TYR A 169 AA2 5 ILE A 111 ? MET A 112 ? ILE A 111 MET A 112 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASN A 13 ? N ASN A 13 O ARG A 54 ? O ARG A 54 AA1 2 3 N VAL A 53 ? N VAL A 53 O ILE A 61 ? O ILE A 61 AA1 3 4 N LEU A 62 ? N LEU A 62 O LEU A 69 ? O LEU A 69 AA1 4 5 N PHE A 71 ? N PHE A 71 O TYR A 79 ? O TYR A 79 AA2 1 2 N GLN A 95 ? N GLN A 95 O MET A 135 ? O MET A 135 AA2 2 3 N ILE A 134 ? N ILE A 134 O CYS A 144 ? O CYS A 144 AA2 3 4 N VAL A 147 ? N VAL A 147 O GLU A 165 ? O GLU A 165 AA2 4 5 O ILE A 164 ? O ILE A 164 N ILE A 111 ? N ILE A 111 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A GOL 201 ? 5 'binding site for residue GOL A 201' AC2 Software A GOL 202 ? 4 'binding site for residue GOL A 202' AC3 Software A GOL 203 ? 6 'binding site for residue GOL A 203' AC4 Software B ZN 101 ? 4 'binding site for residue ZN B 101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 SER A 12 ? SER A 12 . ? 1_555 ? 2 AC1 5 LYS A 18 ? LYS A 18 . ? 8_665 ? 3 AC1 5 HIS A 56 ? HIS A 56 . ? 1_555 ? 4 AC1 5 GLU B 26 ? GLU B 42 . ? 8_655 ? 5 AC1 5 GLU B 29 ? GLU B 45 . ? 8_655 ? 6 AC2 4 MET A 1 ? MET A 1 . ? 1_555 ? 7 AC2 4 PHE A 2 ? PHE A 2 . ? 1_555 ? 8 AC2 4 LYS A 3 ? LYS A 3 . ? 1_555 ? 9 AC2 4 LYS A 4 ? LYS A 4 . ? 1_555 ? 10 AC3 6 GLN A 42 ? GLN A 42 . ? 1_555 ? 11 AC3 6 ILE A 43 ? ILE A 43 . ? 1_555 ? 12 AC3 6 VAL A 64 ? VAL A 64 . ? 1_555 ? 13 AC3 6 ASN A 65 ? ASN A 65 . ? 1_555 ? 14 AC3 6 GLU A 67 ? GLU A 67 . ? 1_555 ? 15 AC3 6 LEU A 69 ? LEU A 69 . ? 1_555 ? 16 AC4 4 HIS A 58 ? HIS A 58 . ? 8_565 ? 17 AC4 4 CYS B 18 ? CYS B 34 . ? 1_555 ? 18 AC4 4 CYS B 21 ? CYS B 37 . ? 1_555 ? 19 AC4 4 CYS B 28 ? CYS B 44 . ? 1_555 ? # _atom_sites.entry_id 5ONS _atom_sites.fract_transf_matrix[1][1] 0.020396 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020396 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004808 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 PHE 2 2 2 PHE PHE A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 TRP 39 39 39 TRP TRP A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 MET 44 44 44 MET MET A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 CYS 55 55 55 CYS CYS A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 HIS 58 58 58 HIS HIS A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 TYR 79 79 79 TYR TYR A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 HIS 86 86 86 HIS HIS A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 HIS 94 94 94 HIS HIS A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 PHE 104 104 104 PHE PHE A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 ASN 110 110 110 ASN ASN A . n A 1 111 ILE 111 111 111 ILE ILE A . n A 1 112 MET 112 112 112 MET MET A . n A 1 113 CYS 113 113 113 CYS CYS A . n A 1 114 PRO 114 114 114 PRO PRO A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 THR 117 117 117 THR THR A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 PRO 119 119 119 PRO PRO A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 TYR 124 124 124 TYR TYR A . n A 1 125 PRO 125 125 125 PRO PRO A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 ILE 134 134 134 ILE ILE A . n A 1 135 MET 135 135 135 MET MET A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 GLU 137 137 137 GLU GLU A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 GLN 140 140 140 GLN GLN A . n A 1 141 HIS 141 141 141 HIS HIS A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 CYS 144 144 144 CYS CYS A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 VAL 147 147 147 VAL VAL A . n A 1 148 MET 148 148 148 MET MET A . n A 1 149 LYS 149 149 149 LYS LYS A . n A 1 150 MET 150 150 150 MET MET A . n A 1 151 SER 151 151 151 SER SER A . n A 1 152 ALA 152 152 152 ALA ALA A . n A 1 153 GLU 153 153 153 GLU GLU A . n A 1 154 ASP 154 154 154 ASP ASP A . n A 1 155 ILE 155 155 155 ILE ILE A . n A 1 156 GLU 156 156 156 GLU GLU A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 ASN 159 159 159 ASN ASN A . n A 1 160 LYS 160 160 160 LYS LYS A . n A 1 161 GLY 161 161 161 GLY GLY A . n A 1 162 ILE 162 162 162 ILE ILE A . n A 1 163 GLY 163 163 163 GLY GLY A . n A 1 164 ILE 164 164 164 ILE ILE A . n A 1 165 GLU 165 165 165 GLU GLU A . n A 1 166 ASN 166 166 166 ASN ASN A . n A 1 167 ILE 167 167 167 ILE ILE A . n A 1 168 HIS 168 168 168 HIS HIS A . n A 1 169 TYR 169 169 169 TYR TYR A . n A 1 170 LEU 170 170 170 LEU LEU A . n A 1 171 ASN 171 171 171 ASN ASN A . n A 1 172 ASP 172 172 172 ASP ASP A . n A 1 173 GLY 173 173 173 GLY GLY A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 TRP 175 175 175 TRP TRP A . n A 1 176 HIS 176 176 176 HIS HIS A . n A 1 177 MET 177 177 177 MET MET A . n A 1 178 LYS 178 178 178 LYS LYS A . n A 1 179 THR 179 179 179 THR THR A . n A 1 180 TYR 180 180 180 TYR TYR A . n A 1 181 LYS 181 181 181 LYS LYS A . n B 2 1 MET 1 17 ? ? ? B . n B 2 2 HIS 2 18 ? ? ? B . n B 2 3 HIS 3 19 ? ? ? B . n B 2 4 HIS 4 20 ? ? ? B . n B 2 5 HIS 5 21 ? ? ? B . n B 2 6 HIS 6 22 ? ? ? B . n B 2 7 HIS 7 23 ? ? ? B . n B 2 8 ASP 8 24 ? ? ? B . n B 2 9 ALA 9 25 25 ALA ALA B . n B 2 10 ASP 10 26 26 ASP ASP B . n B 2 11 TYR 11 27 27 TYR TYR B . n B 2 12 PRO 12 28 28 PRO PRO B . n B 2 13 LEU 13 29 29 LEU LEU B . n B 2 14 ARG 14 30 30 ARG ARG B . n B 2 15 VAL 15 31 31 VAL VAL B . n B 2 16 LEU 16 32 32 LEU LEU B . n B 2 17 TYR 17 33 33 TYR TYR B . n B 2 18 CYS 18 34 34 CYS CYS B . n B 2 19 GLY 19 35 35 GLY GLY B . n B 2 20 VAL 20 36 36 VAL VAL B . n B 2 21 CYS 21 37 37 CYS CYS B . n B 2 22 SER 22 38 38 SER SER B . n B 2 23 LEU 23 39 39 LEU LEU B . n B 2 24 PRO 24 40 40 PRO PRO B . n B 2 25 THR 25 41 41 THR THR B . n B 2 26 GLU 26 42 42 GLU GLU B . n B 2 27 TYR 27 43 43 TYR TYR B . n B 2 28 CYS 28 44 44 CYS CYS B . n B 2 29 GLU 29 45 45 GLU GLU B . n B 2 30 TYR 30 46 46 TYR TYR B . n B 2 31 MET 31 47 47 MET MET B . n B 2 32 PRO 32 48 48 PRO PRO B . n B 2 33 ASP 33 49 ? ? ? B . n B 2 34 VAL 34 50 ? ? ? B . n B 2 35 ALA 35 51 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 GOL 1 201 1 GOL GOL A . D 3 GOL 1 202 2 GOL GOL A . E 3 GOL 1 203 3 GOL GOL A . F 4 ZN 1 101 1 ZN ZN B . G 5 HOH 1 301 9 HOH HOH A . G 5 HOH 2 302 24 HOH HOH A . G 5 HOH 3 303 16 HOH HOH A . G 5 HOH 4 304 21 HOH HOH A . G 5 HOH 5 305 8 HOH HOH A . G 5 HOH 6 306 1 HOH HOH A . G 5 HOH 7 307 27 HOH HOH A . G 5 HOH 8 308 31 HOH HOH A . G 5 HOH 9 309 20 HOH HOH A . G 5 HOH 10 310 28 HOH HOH A . G 5 HOH 11 311 33 HOH HOH A . G 5 HOH 12 312 26 HOH HOH A . G 5 HOH 13 313 12 HOH HOH A . G 5 HOH 14 314 5 HOH HOH A . G 5 HOH 15 315 2 HOH HOH A . G 5 HOH 16 316 6 HOH HOH A . G 5 HOH 17 317 7 HOH HOH A . G 5 HOH 18 318 29 HOH HOH A . G 5 HOH 19 319 22 HOH HOH A . G 5 HOH 20 320 23 HOH HOH A . G 5 HOH 21 321 19 HOH HOH A . G 5 HOH 22 322 4 HOH HOH A . G 5 HOH 23 323 25 HOH HOH A . G 5 HOH 24 324 18 HOH HOH A . G 5 HOH 25 325 17 HOH HOH A . G 5 HOH 26 326 10 HOH HOH A . G 5 HOH 27 327 32 HOH HOH A . G 5 HOH 28 328 14 HOH HOH A . G 5 HOH 29 329 30 HOH HOH A . H 5 HOH 1 201 13 HOH HOH B . H 5 HOH 2 202 3 HOH HOH B . H 5 HOH 3 203 15 HOH HOH B . H 5 HOH 4 204 11 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2200 ? 1 MORE -36 ? 1 'SSA (A^2)' 10630 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 306 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id G _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? B CYS 18 ? B CYS 34 ? 1_555 ZN ? F ZN . ? B ZN 101 ? 1_555 SG ? B CYS 21 ? B CYS 37 ? 1_555 115.6 ? 2 SG ? B CYS 18 ? B CYS 34 ? 1_555 ZN ? F ZN . ? B ZN 101 ? 1_555 SG ? B CYS 28 ? B CYS 44 ? 1_555 102.9 ? 3 SG ? B CYS 21 ? B CYS 37 ? 1_555 ZN ? F ZN . ? B ZN 101 ? 1_555 SG ? B CYS 28 ? B CYS 44 ? 1_555 117.1 ? 4 SG ? B CYS 18 ? B CYS 34 ? 1_555 ZN ? F ZN . ? B ZN 101 ? 1_555 NE2 ? A HIS 58 ? A HIS 58 ? 1_555 103.3 ? 5 SG ? B CYS 21 ? B CYS 37 ? 1_555 ZN ? F ZN . ? B ZN 101 ? 1_555 NE2 ? A HIS 58 ? A HIS 58 ? 1_555 12.2 ? 6 SG ? B CYS 28 ? B CYS 44 ? 1_555 ZN ? F ZN . ? B ZN 101 ? 1_555 NE2 ? A HIS 58 ? A HIS 58 ? 1_555 122.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-05-23 2 'Structure model' 1 1 2018-06-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_volume' 3 2 'Structure model' '_citation.page_first' 4 2 'Structure model' '_citation.page_last' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation_author.name' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -0.8607 _pdbx_refine_tls.origin_y 25.8357 _pdbx_refine_tls.origin_z 15.3027 _pdbx_refine_tls.T[1][1] 0.3632 _pdbx_refine_tls.T[2][2] 0.3500 _pdbx_refine_tls.T[3][3] 0.3725 _pdbx_refine_tls.T[1][2] -0.0048 _pdbx_refine_tls.T[1][3] 0.0155 _pdbx_refine_tls.T[2][3] -0.0120 _pdbx_refine_tls.L[1][1] 3.2643 _pdbx_refine_tls.L[2][2] 1.6109 _pdbx_refine_tls.L[3][3] 5.0311 _pdbx_refine_tls.L[1][2] 0.7698 _pdbx_refine_tls.L[1][3] -0.9906 _pdbx_refine_tls.L[2][3] 0.1190 _pdbx_refine_tls.S[1][1] -0.0921 _pdbx_refine_tls.S[2][2] 0.0669 _pdbx_refine_tls.S[3][3] -0.0017 _pdbx_refine_tls.S[1][2] -0.1769 _pdbx_refine_tls.S[1][3] -0.0072 _pdbx_refine_tls.S[2][3] -0.0255 _pdbx_refine_tls.S[2][1] 0.1693 _pdbx_refine_tls.S[3][1] 0.2482 _pdbx_refine_tls.S[3][2] -0.2858 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 1 A 181 all ? ? ? ? ? 'X-RAY DIFFRACTION' 2 1 B 25 B 48 all ? ? ? ? ? 'X-RAY DIFFRACTION' 3 1 C 1 C 1 all ? ? ? ? ? 'X-RAY DIFFRACTION' 4 1 D 1 D 3 all ? ? ? ? ? 'X-RAY DIFFRACTION' 5 1 W 1 W 33 all ? ? ? ? ? # _phasing.method SAD # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.11.1_2575 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? SHELXDE ? ? ? . 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 5 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 324 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 325 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 4 ? ? -118.33 68.27 2 1 ASN A 13 ? ? -161.79 -169.13 3 1 ARG A 74 ? ? 68.68 -135.51 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 B MET 17 ? B MET 1 2 1 Y 1 B HIS 18 ? B HIS 2 3 1 Y 1 B HIS 19 ? B HIS 3 4 1 Y 1 B HIS 20 ? B HIS 4 5 1 Y 1 B HIS 21 ? B HIS 5 6 1 Y 1 B HIS 22 ? B HIS 6 7 1 Y 1 B HIS 23 ? B HIS 7 8 1 Y 1 B ASP 24 ? B ASP 8 9 1 Y 1 B ASP 49 ? B ASP 33 10 1 Y 1 B VAL 50 ? B VAL 34 11 1 Y 1 B ALA 51 ? B ALA 35 # _pdbx_audit_support.funding_organization 'German Research Foundation' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id ZN _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id ZN _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 GLYCEROL GOL 4 'ZINC ION' ZN 5 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #