data_5OS3 # _entry.id 5OS3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5OS3 WWPDB D_1200006272 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5OS3 _pdbx_database_status.recvd_initial_deposition_date 2017-08-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'McIntyre, P.J.' 1 ? 'Collins, P.M.' 2 ? 'von Delft, F.' 3 ? 'Bayliss, R.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'ACS Chem. Biol.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1554-8937 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 12 _citation.language ? _citation.page_first 2906 _citation.page_last 2914 _citation.title ;Characterization of Three Druggable Hot-Spots in the Aurora-A/TPX2 Interaction Using Biochemical, Biophysical, and Fragment-Based Approaches. ; _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acschembio.7b00537 _citation.pdbx_database_id_PubMed 29045126 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'McIntyre, P.J.' 1 primary 'Collins, P.M.' 2 primary 'Vrzal, L.' 3 primary 'Birchall, K.' 4 primary 'Arnold, L.H.' 5 primary 'Mpamhanga, C.' 6 primary 'Coombs, P.J.' 7 primary 'Burgess, S.G.' 8 primary 'Richards, M.W.' 9 primary 'Winter, A.' 10 primary 'Veverka, V.' 11 primary 'Delft, F.V.' 12 primary 'Merritt, A.' 13 primary 'Bayliss, R.' 14 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 5OS3 _cell.details ? _cell.formula_units_Z ? _cell.length_a 81.860 _cell.length_a_esd ? _cell.length_b 81.860 _cell.length_b_esd ? _cell.length_c 176.450 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5OS3 _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Aurora kinase A' 30798.236 1 2.7.11.1 ? ? ? 2 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE" 427.201 1 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 2 ? ? ? ? 4 non-polymer syn '(1~{R})-1-(4-ethoxyphenyl)ethanamine' 165.232 1 ? ? ? ? 5 water nat water 18.015 150 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Aurora 2,Aurora/IPL1-related kinase 1,hARK1,Breast tumor-amplified kinase,Serine/threonine-protein kinase 15,Serine/threonine-protein kinase 6,Serine/threonine-protein kinase aurora-A ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;QWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRV YLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRR T(TPO)LAGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISR LLKHNPSQRPMLREVLEHPWITANSSKPS ; _entity_poly.pdbx_seq_one_letter_code_can ;QWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRV YLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRR TTLAGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKH NPSQRPMLREVLEHPWITANSSKPS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLN n 1 2 TRP n 1 3 ALA n 1 4 LEU n 1 5 GLU n 1 6 ASP n 1 7 PHE n 1 8 GLU n 1 9 ILE n 1 10 GLY n 1 11 ARG n 1 12 PRO n 1 13 LEU n 1 14 GLY n 1 15 LYS n 1 16 GLY n 1 17 LYS n 1 18 PHE n 1 19 GLY n 1 20 ASN n 1 21 VAL n 1 22 TYR n 1 23 LEU n 1 24 ALA n 1 25 ARG n 1 26 GLU n 1 27 LYS n 1 28 GLN n 1 29 SER n 1 30 LYS n 1 31 PHE n 1 32 ILE n 1 33 LEU n 1 34 ALA n 1 35 LEU n 1 36 LYS n 1 37 VAL n 1 38 LEU n 1 39 PHE n 1 40 LYS n 1 41 ALA n 1 42 GLN n 1 43 LEU n 1 44 GLU n 1 45 LYS n 1 46 ALA n 1 47 GLY n 1 48 VAL n 1 49 GLU n 1 50 HIS n 1 51 GLN n 1 52 LEU n 1 53 ARG n 1 54 ARG n 1 55 GLU n 1 56 VAL n 1 57 GLU n 1 58 ILE n 1 59 GLN n 1 60 SER n 1 61 HIS n 1 62 LEU n 1 63 ARG n 1 64 HIS n 1 65 PRO n 1 66 ASN n 1 67 ILE n 1 68 LEU n 1 69 ARG n 1 70 LEU n 1 71 TYR n 1 72 GLY n 1 73 TYR n 1 74 PHE n 1 75 HIS n 1 76 ASP n 1 77 ALA n 1 78 THR n 1 79 ARG n 1 80 VAL n 1 81 TYR n 1 82 LEU n 1 83 ILE n 1 84 LEU n 1 85 GLU n 1 86 TYR n 1 87 ALA n 1 88 PRO n 1 89 LEU n 1 90 GLY n 1 91 THR n 1 92 VAL n 1 93 TYR n 1 94 ARG n 1 95 GLU n 1 96 LEU n 1 97 GLN n 1 98 LYS n 1 99 LEU n 1 100 SER n 1 101 LYS n 1 102 PHE n 1 103 ASP n 1 104 GLU n 1 105 GLN n 1 106 ARG n 1 107 THR n 1 108 ALA n 1 109 THR n 1 110 TYR n 1 111 ILE n 1 112 THR n 1 113 GLU n 1 114 LEU n 1 115 ALA n 1 116 ASN n 1 117 ALA n 1 118 LEU n 1 119 SER n 1 120 TYR n 1 121 CYS n 1 122 HIS n 1 123 SER n 1 124 LYS n 1 125 ARG n 1 126 VAL n 1 127 ILE n 1 128 HIS n 1 129 ARG n 1 130 ASP n 1 131 ILE n 1 132 LYS n 1 133 PRO n 1 134 GLU n 1 135 ASN n 1 136 LEU n 1 137 LEU n 1 138 LEU n 1 139 GLY n 1 140 SER n 1 141 ALA n 1 142 GLY n 1 143 GLU n 1 144 LEU n 1 145 LYS n 1 146 ILE n 1 147 ALA n 1 148 ASP n 1 149 PHE n 1 150 GLY n 1 151 TRP n 1 152 SER n 1 153 VAL n 1 154 HIS n 1 155 ALA n 1 156 PRO n 1 157 SER n 1 158 SER n 1 159 ARG n 1 160 ARG n 1 161 THR n 1 162 TPO n 1 163 LEU n 1 164 ALA n 1 165 GLY n 1 166 THR n 1 167 LEU n 1 168 ASP n 1 169 TYR n 1 170 LEU n 1 171 PRO n 1 172 PRO n 1 173 GLU n 1 174 MET n 1 175 ILE n 1 176 GLU n 1 177 GLY n 1 178 ARG n 1 179 MET n 1 180 HIS n 1 181 ASP n 1 182 GLU n 1 183 LYS n 1 184 VAL n 1 185 ASP n 1 186 LEU n 1 187 TRP n 1 188 SER n 1 189 LEU n 1 190 GLY n 1 191 VAL n 1 192 LEU n 1 193 CYS n 1 194 TYR n 1 195 GLU n 1 196 PHE n 1 197 LEU n 1 198 VAL n 1 199 GLY n 1 200 LYS n 1 201 PRO n 1 202 PRO n 1 203 PHE n 1 204 GLU n 1 205 ALA n 1 206 ASN n 1 207 THR n 1 208 TYR n 1 209 GLN n 1 210 GLU n 1 211 THR n 1 212 TYR n 1 213 LYS n 1 214 ARG n 1 215 ILE n 1 216 SER n 1 217 ARG n 1 218 VAL n 1 219 GLU n 1 220 PHE n 1 221 THR n 1 222 PHE n 1 223 PRO n 1 224 ASP n 1 225 PHE n 1 226 VAL n 1 227 THR n 1 228 GLU n 1 229 GLY n 1 230 ALA n 1 231 ARG n 1 232 ASP n 1 233 LEU n 1 234 ILE n 1 235 SER n 1 236 ARG n 1 237 LEU n 1 238 LEU n 1 239 LYS n 1 240 HIS n 1 241 ASN n 1 242 PRO n 1 243 SER n 1 244 GLN n 1 245 ARG n 1 246 PRO n 1 247 MET n 1 248 LEU n 1 249 ARG n 1 250 GLU n 1 251 VAL n 1 252 LEU n 1 253 GLU n 1 254 HIS n 1 255 PRO n 1 256 TRP n 1 257 ILE n 1 258 THR n 1 259 ALA n 1 260 ASN n 1 261 SER n 1 262 SER n 1 263 LYS n 1 264 PRO n 1 265 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 265 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'AURKA, AIK, AIRK1, ARK1, AURA, AYK1, BTAK, IAK1, STK15, STK6' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AURKA_HUMAN _struct_ref.pdbx_db_accession O14965 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRV YLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRR TTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKH NPSQRPMLREVLEHPWITANSSKPS ; _struct_ref.pdbx_align_begin 127 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5OS3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 265 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O14965 _struct_ref_seq.db_align_beg 127 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 391 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 127 _struct_ref_seq.pdbx_auth_seq_align_end 391 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 5OS3 _struct_ref_seq_dif.mon_id ALA _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 164 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code O14965 _struct_ref_seq_dif.db_mon_id CYS _struct_ref_seq_dif.pdbx_seq_db_seq_num 290 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 290 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A7N non-polymer . '(1~{R})-1-(4-ethoxyphenyl)ethanamine' ? 'C10 H15 N O' 165.232 ADP non-polymer n "ADENOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O10 P2' 427.201 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TPO 'L-peptide linking' n PHOSPHOTHREONINE PHOSPHONOTHREONINE 'C4 H10 N O6 P' 199.099 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5OS3 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.77 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 55.61 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Tris, pH 8.5: 0.5 M NaCl: 0.2 M MgCl2: 32.5 % v/v PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-02-15 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9282 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9282 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04-1 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 46.571 _reflns.entry_id 5OS3 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.810 _reflns.d_resolution_low 65.782 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 60304 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3.000 _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.198 _reflns.pdbx_Rmerge_I_obs 0.055 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 18.760 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.050 _reflns.pdbx_scaling_rejects 19 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.058 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 615003 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.810 1.860 ? 1.340 ? ? ? ? 4455 99.800 ? ? ? ? 1.550 ? ? ? ? ? ? ? ? 10.764 ? ? ? ? 1.627 ? ? 1 1 0.654 ? 1.860 1.910 ? 1.930 ? ? ? ? 4340 99.900 ? ? ? ? 1.078 ? ? ? ? ? ? ? ? 10.689 ? ? ? ? 1.132 ? ? 2 1 0.815 ? 1.910 1.960 ? 2.670 ? ? ? ? 4220 99.800 ? ? ? ? 0.809 ? ? ? ? ? ? ? ? 10.568 ? ? ? ? 0.850 ? ? 3 1 0.856 ? 1.960 2.020 ? 3.810 ? ? ? ? 4115 100.000 ? ? ? ? 0.571 ? ? ? ? ? ? ? ? 10.455 ? ? ? ? 0.600 ? ? 4 1 0.926 ? 2.020 2.090 ? 5.500 ? ? ? ? 3968 99.900 ? ? ? ? 0.399 ? ? ? ? ? ? ? ? 10.221 ? ? ? ? 0.420 ? ? 5 1 0.961 ? 2.090 2.160 ? 7.550 ? ? ? ? 3847 99.800 ? ? ? ? 0.280 ? ? ? ? ? ? ? ? 9.360 ? ? ? ? 0.297 ? ? 6 1 0.979 ? 2.160 2.250 ? 10.710 ? ? ? ? 3694 100.000 ? ? ? ? 0.209 ? ? ? ? ? ? ? ? 10.592 ? ? ? ? 0.219 ? ? 7 1 0.989 ? 2.250 2.340 ? 14.300 ? ? ? ? 3601 99.900 ? ? ? ? 0.152 ? ? ? ? ? ? ? ? 10.642 ? ? ? ? 0.160 ? ? 8 1 0.993 ? 2.340 2.440 ? 17.090 ? ? ? ? 3417 100.000 ? ? ? ? 0.127 ? ? ? ? ? ? ? ? 10.579 ? ? ? ? 0.133 ? ? 9 1 0.995 ? 2.440 2.560 ? 20.740 ? ? ? ? 3311 100.000 ? ? ? ? 0.103 ? ? ? ? ? ? ? ? 10.479 ? ? ? ? 0.108 ? ? 10 1 0.997 ? 2.560 2.700 ? 24.260 ? ? ? ? 3070 100.000 ? ? ? ? 0.086 ? ? ? ? ? ? ? ? 10.128 ? ? ? ? 0.091 ? ? 11 1 0.998 ? 2.700 2.860 ? 27.980 ? ? ? ? 2971 100.000 ? ? ? ? 0.071 ? ? ? ? ? ? ? ? 9.279 ? ? ? ? 0.075 ? ? 12 1 0.998 ? 2.860 3.060 ? 35.540 ? ? ? ? 2768 100.000 ? ? ? ? 0.060 ? ? ? ? ? ? ? ? 10.460 ? ? ? ? 0.063 ? ? 13 1 0.999 ? 3.060 3.300 ? 39.620 ? ? ? ? 2586 100.000 ? ? ? ? 0.053 ? ? ? ? ? ? ? ? 10.075 ? ? ? ? 0.056 ? ? 14 1 0.999 ? 3.300 3.620 ? 42.920 ? ? ? ? 2373 99.800 ? ? ? ? 0.047 ? ? ? ? ? ? ? ? 9.501 ? ? ? ? 0.050 ? ? 15 1 0.999 ? 3.620 4.050 ? 43.450 ? ? ? ? 2147 99.900 ? ? ? ? 0.044 ? ? ? ? ? ? ? ? 8.570 ? ? ? ? 0.046 ? ? 16 1 0.999 ? 4.050 4.670 ? 48.650 ? ? ? ? 1877 99.700 ? ? ? ? 0.039 ? ? ? ? ? ? ? ? 9.622 ? ? ? ? 0.041 ? ? 17 1 0.999 ? 4.670 5.720 ? 49.900 ? ? ? ? 1616 100.000 ? ? ? ? 0.036 ? ? ? ? ? ? ? ? 10.206 ? ? ? ? 0.038 ? ? 18 1 0.999 ? 5.720 8.090 ? 47.750 ? ? ? ? 1240 99.500 ? ? ? ? 0.034 ? ? ? ? ? ? ? ? 9.472 ? ? ? ? 0.036 ? ? 19 1 0.999 ? 8.090 65.782 ? 52.610 ? ? ? ? 688 98.700 ? ? ? ? 0.027 ? ? ? ? ? ? ? ? 10.576 ? ? ? ? 0.029 ? ? 20 1 0.999 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 121.410 _refine.B_iso_mean 43.9680 _refine.B_iso_min 26.020 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5OS3 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.810 _refine.ls_d_res_low 65.7820 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 34880 _refine.ls_number_reflns_R_free 1757 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9100 _refine.ls_percent_reflns_R_free 5.0400 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2035 _refine.ls_R_factor_R_free 0.2380 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2018 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 25.5200 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2500 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.810 _refine_hist.d_res_low 65.7820 _refine_hist.pdbx_number_atoms_ligand 41 _refine_hist.number_atoms_solvent 150 _refine_hist.number_atoms_total 2328 _refine_hist.pdbx_number_residues_total 265 _refine_hist.pdbx_B_iso_mean_ligand 42.88 _refine_hist.pdbx_B_iso_mean_solvent 50.24 _refine_hist.pdbx_number_atoms_protein 2137 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # _struct.entry_id 5OS3 _struct.title 'Crystal structure of Aurora-A kinase in complex with an allosterically binding fragment' _struct.pdbx_descriptor 'Aurora kinase A (E.C.2.7.11.1)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5OS3 _struct_keywords.text 'kinase, allosteric inhibitor, fragment, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 3 ? GLU A 5 ? ALA A 129 GLU A 131 5 ? 3 HELX_P HELX_P2 AA2 LYS A 40 ? GLY A 47 ? LYS A 166 GLY A 173 1 ? 8 HELX_P HELX_P3 AA3 VAL A 48 ? LEU A 62 ? VAL A 174 LEU A 188 1 ? 15 HELX_P HELX_P4 AA4 THR A 91 ? SER A 100 ? THR A 217 SER A 226 1 ? 10 HELX_P HELX_P5 AA5 ASP A 103 ? SER A 123 ? ASP A 229 SER A 249 1 ? 21 HELX_P HELX_P6 AA6 LYS A 132 ? GLU A 134 ? LYS A 258 GLU A 260 5 ? 3 HELX_P HELX_P7 AA7 ASP A 148 ? SER A 152 ? ASP A 274 SER A 278 5 ? 5 HELX_P HELX_P8 AA8 PRO A 171 ? GLU A 176 ? PRO A 297 GLU A 302 1 ? 6 HELX_P HELX_P9 AA9 GLU A 182 ? GLY A 199 ? GLU A 308 GLY A 325 1 ? 18 HELX_P HELX_P10 AB1 THR A 207 ? VAL A 218 ? THR A 333 VAL A 344 1 ? 12 HELX_P HELX_P11 AB2 THR A 227 ? LEU A 238 ? THR A 353 LEU A 364 1 ? 12 HELX_P HELX_P12 AB3 ASN A 241 ? ARG A 245 ? ASN A 367 ARG A 371 5 ? 5 HELX_P HELX_P13 AB4 MET A 247 ? GLU A 253 ? MET A 373 GLU A 379 1 ? 7 HELX_P HELX_P14 AB5 HIS A 254 ? SER A 261 ? HIS A 380 SER A 387 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A ASN 135 OD1 ? ? ? 1_555 C MG . MG ? ? A ASN 261 A MG 402 1_555 ? ? ? ? ? ? ? 2.237 ? metalc2 metalc ? ? A ASP 148 OD1 ? ? ? 1_555 D MG . MG ? ? A ASP 274 A MG 403 1_555 ? ? ? ? ? ? ? 2.556 ? metalc3 metalc ? ? A ASP 148 OD2 ? ? ? 1_555 C MG . MG ? ? A ASP 274 A MG 402 1_555 ? ? ? ? ? ? ? 2.110 ? covale1 covale both ? A THR 161 C ? ? ? 1_555 A TPO 162 N ? ? A THR 287 A TPO 288 1_555 ? ? ? ? ? ? ? 1.332 ? covale2 covale both ? A TPO 162 C ? ? ? 1_555 A LEU 163 N ? ? A TPO 288 A LEU 289 1_555 ? ? ? ? ? ? ? 1.333 ? metalc4 metalc ? ? B ADP . O1B ? ? ? 1_555 D MG . MG ? ? A ADP 401 A MG 403 1_555 ? ? ? ? ? ? ? 2.123 ? metalc5 metalc ? ? B ADP . O3B ? ? ? 1_555 C MG . MG ? ? A ADP 401 A MG 402 1_555 ? ? ? ? ? ? ? 1.996 ? metalc6 metalc ? ? B ADP . O2A ? ? ? 1_555 C MG . MG ? ? A ADP 401 A MG 402 1_555 ? ? ? ? ? ? ? 2.102 ? metalc7 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 402 A HOH 568 1_555 ? ? ? ? ? ? ? 2.142 ? metalc8 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 402 A HOH 587 1_555 ? ? ? ? ? ? ? 2.257 ? metalc9 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 403 A HOH 507 1_555 ? ? ? ? ? ? ? 1.999 ? metalc10 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 403 A HOH 530 1_555 ? ? ? ? ? ? ? 2.144 ? metalc11 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 403 A HOH 626 1_555 ? ? ? ? ? ? ? 2.224 ? metalc12 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 403 A HOH 628 1_555 ? ? ? ? ? ? ? 2.285 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference metalc ? ? covale ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 155 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 281 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 156 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 282 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -3.19 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 7 ? LYS A 15 ? PHE A 133 LYS A 141 AA1 2 ASN A 20 ? GLU A 26 ? ASN A 146 GLU A 152 AA1 3 ILE A 32 ? PHE A 39 ? ILE A 158 PHE A 165 AA1 4 ARG A 79 ? LEU A 84 ? ARG A 205 LEU A 210 AA1 5 LEU A 70 ? HIS A 75 ? LEU A 196 HIS A 201 AA2 1 VAL A 126 ? ILE A 127 ? VAL A 252 ILE A 253 AA2 2 VAL A 153 ? HIS A 154 ? VAL A 279 HIS A 280 AA3 1 LEU A 136 ? LEU A 138 ? LEU A 262 LEU A 264 AA3 2 LEU A 144 ? ILE A 146 ? LEU A 270 ILE A 272 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 10 ? N GLY A 136 O LEU A 23 ? O LEU A 149 AA1 2 3 N TYR A 22 ? N TYR A 148 O LEU A 35 ? O LEU A 161 AA1 3 4 N ALA A 34 ? N ALA A 160 O LEU A 84 ? O LEU A 210 AA1 4 5 O TYR A 81 ? O TYR A 207 N PHE A 74 ? N PHE A 200 AA2 1 2 N ILE A 127 ? N ILE A 253 O VAL A 153 ? O VAL A 279 AA3 1 2 N LEU A 137 ? N LEU A 263 O LYS A 145 ? O LYS A 271 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ADP 401 ? 26 'binding site for residue ADP A 401' AC2 Software A MG 402 ? 5 'binding site for residue MG A 402' AC3 Software A MG 403 ? 7 'binding site for residue MG A 403' AC4 Software A A7N 404 ? 2 'binding site for residue A7N A 404' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 26 GLY A 14 ? GLY A 140 . ? 1_555 ? 2 AC1 26 GLY A 16 ? GLY A 142 . ? 1_555 ? 3 AC1 26 LYS A 17 ? LYS A 143 . ? 1_555 ? 4 AC1 26 PHE A 18 ? PHE A 144 . ? 1_555 ? 5 AC1 26 GLY A 19 ? GLY A 145 . ? 1_555 ? 6 AC1 26 VAL A 21 ? VAL A 147 . ? 1_555 ? 7 AC1 26 ALA A 34 ? ALA A 160 . ? 1_555 ? 8 AC1 26 LYS A 36 ? LYS A 162 . ? 1_555 ? 9 AC1 26 LEU A 68 ? LEU A 194 . ? 1_555 ? 10 AC1 26 GLU A 85 ? GLU A 211 . ? 1_555 ? 11 AC1 26 ALA A 87 ? ALA A 213 . ? 1_555 ? 12 AC1 26 THR A 91 ? THR A 217 . ? 1_555 ? 13 AC1 26 GLU A 134 ? GLU A 260 . ? 1_555 ? 14 AC1 26 ASN A 135 ? ASN A 261 . ? 1_555 ? 15 AC1 26 LEU A 137 ? LEU A 263 . ? 1_555 ? 16 AC1 26 ASP A 148 ? ASP A 274 . ? 1_555 ? 17 AC1 26 MG C . ? MG A 402 . ? 1_555 ? 18 AC1 26 MG D . ? MG A 403 . ? 1_555 ? 19 AC1 26 HOH F . ? HOH A 528 . ? 1_555 ? 20 AC1 26 HOH F . ? HOH A 530 . ? 1_555 ? 21 AC1 26 HOH F . ? HOH A 548 . ? 1_555 ? 22 AC1 26 HOH F . ? HOH A 568 . ? 1_555 ? 23 AC1 26 HOH F . ? HOH A 587 . ? 1_555 ? 24 AC1 26 HOH F . ? HOH A 596 . ? 1_555 ? 25 AC1 26 HOH F . ? HOH A 600 . ? 1_555 ? 26 AC1 26 HOH F . ? HOH A 603 . ? 1_555 ? 27 AC2 5 ASN A 135 ? ASN A 261 . ? 1_555 ? 28 AC2 5 ASP A 148 ? ASP A 274 . ? 1_555 ? 29 AC2 5 ADP B . ? ADP A 401 . ? 1_555 ? 30 AC2 5 HOH F . ? HOH A 568 . ? 1_555 ? 31 AC2 5 HOH F . ? HOH A 587 . ? 1_555 ? 32 AC3 7 ASP A 148 ? ASP A 274 . ? 1_555 ? 33 AC3 7 ADP B . ? ADP A 401 . ? 1_555 ? 34 AC3 7 HOH F . ? HOH A 507 . ? 1_555 ? 35 AC3 7 HOH F . ? HOH A 530 . ? 1_555 ? 36 AC3 7 HOH F . ? HOH A 626 . ? 1_555 ? 37 AC3 7 HOH F . ? HOH A 628 . ? 1_555 ? 38 AC3 7 HOH F . ? HOH A 630 . ? 1_555 ? 39 AC4 2 ARG A 53 ? ARG A 179 . ? 1_555 ? 40 AC4 2 HOH F . ? HOH A 513 . ? 1_555 ? # _atom_sites.entry_id 5OS3 _atom_sites.fract_transf_matrix[1][1] 0.012216 _atom_sites.fract_transf_matrix[1][2] 0.007053 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014106 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005667 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C MG N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLN 1 127 127 GLN GLN A . n A 1 2 TRP 2 128 128 TRP TRP A . n A 1 3 ALA 3 129 129 ALA ALA A . n A 1 4 LEU 4 130 130 LEU LEU A . n A 1 5 GLU 5 131 131 GLU GLU A . n A 1 6 ASP 6 132 132 ASP ASP A . n A 1 7 PHE 7 133 133 PHE PHE A . n A 1 8 GLU 8 134 134 GLU GLU A . n A 1 9 ILE 9 135 135 ILE ILE A . n A 1 10 GLY 10 136 136 GLY GLY A . n A 1 11 ARG 11 137 137 ARG ARG A . n A 1 12 PRO 12 138 138 PRO PRO A . n A 1 13 LEU 13 139 139 LEU LEU A . n A 1 14 GLY 14 140 140 GLY GLY A . n A 1 15 LYS 15 141 141 LYS LYS A . n A 1 16 GLY 16 142 142 GLY GLY A . n A 1 17 LYS 17 143 143 LYS LYS A . n A 1 18 PHE 18 144 144 PHE PHE A . n A 1 19 GLY 19 145 145 GLY GLY A . n A 1 20 ASN 20 146 146 ASN ASN A . n A 1 21 VAL 21 147 147 VAL VAL A . n A 1 22 TYR 22 148 148 TYR TYR A . n A 1 23 LEU 23 149 149 LEU LEU A . n A 1 24 ALA 24 150 150 ALA ALA A . n A 1 25 ARG 25 151 151 ARG ARG A . n A 1 26 GLU 26 152 152 GLU GLU A . n A 1 27 LYS 27 153 153 LYS LYS A . n A 1 28 GLN 28 154 154 GLN GLN A . n A 1 29 SER 29 155 155 SER SER A . n A 1 30 LYS 30 156 156 LYS LYS A . n A 1 31 PHE 31 157 157 PHE PHE A . n A 1 32 ILE 32 158 158 ILE ILE A . n A 1 33 LEU 33 159 159 LEU LEU A . n A 1 34 ALA 34 160 160 ALA ALA A . n A 1 35 LEU 35 161 161 LEU LEU A . n A 1 36 LYS 36 162 162 LYS LYS A . n A 1 37 VAL 37 163 163 VAL VAL A . n A 1 38 LEU 38 164 164 LEU LEU A . n A 1 39 PHE 39 165 165 PHE PHE A . n A 1 40 LYS 40 166 166 LYS LYS A . n A 1 41 ALA 41 167 167 ALA ALA A . n A 1 42 GLN 42 168 168 GLN GLN A . n A 1 43 LEU 43 169 169 LEU LEU A . n A 1 44 GLU 44 170 170 GLU GLU A . n A 1 45 LYS 45 171 171 LYS LYS A . n A 1 46 ALA 46 172 172 ALA ALA A . n A 1 47 GLY 47 173 173 GLY GLY A . n A 1 48 VAL 48 174 174 VAL VAL A . n A 1 49 GLU 49 175 175 GLU GLU A . n A 1 50 HIS 50 176 176 HIS HIS A . n A 1 51 GLN 51 177 177 GLN GLN A . n A 1 52 LEU 52 178 178 LEU LEU A . n A 1 53 ARG 53 179 179 ARG ARG A . n A 1 54 ARG 54 180 180 ARG ARG A . n A 1 55 GLU 55 181 181 GLU GLU A . n A 1 56 VAL 56 182 182 VAL VAL A . n A 1 57 GLU 57 183 183 GLU GLU A . n A 1 58 ILE 58 184 184 ILE ILE A . n A 1 59 GLN 59 185 185 GLN GLN A . n A 1 60 SER 60 186 186 SER SER A . n A 1 61 HIS 61 187 187 HIS HIS A . n A 1 62 LEU 62 188 188 LEU LEU A . n A 1 63 ARG 63 189 189 ARG ARG A . n A 1 64 HIS 64 190 190 HIS HIS A . n A 1 65 PRO 65 191 191 PRO PRO A . n A 1 66 ASN 66 192 192 ASN ASN A . n A 1 67 ILE 67 193 193 ILE ILE A . n A 1 68 LEU 68 194 194 LEU LEU A . n A 1 69 ARG 69 195 195 ARG ARG A . n A 1 70 LEU 70 196 196 LEU LEU A . n A 1 71 TYR 71 197 197 TYR TYR A . n A 1 72 GLY 72 198 198 GLY GLY A . n A 1 73 TYR 73 199 199 TYR TYR A . n A 1 74 PHE 74 200 200 PHE PHE A . n A 1 75 HIS 75 201 201 HIS HIS A . n A 1 76 ASP 76 202 202 ASP ASP A . n A 1 77 ALA 77 203 203 ALA ALA A . n A 1 78 THR 78 204 204 THR THR A . n A 1 79 ARG 79 205 205 ARG ARG A . n A 1 80 VAL 80 206 206 VAL VAL A . n A 1 81 TYR 81 207 207 TYR TYR A . n A 1 82 LEU 82 208 208 LEU LEU A . n A 1 83 ILE 83 209 209 ILE ILE A . n A 1 84 LEU 84 210 210 LEU LEU A . n A 1 85 GLU 85 211 211 GLU GLU A . n A 1 86 TYR 86 212 212 TYR TYR A . n A 1 87 ALA 87 213 213 ALA ALA A . n A 1 88 PRO 88 214 214 PRO PRO A . n A 1 89 LEU 89 215 215 LEU LEU A . n A 1 90 GLY 90 216 216 GLY GLY A . n A 1 91 THR 91 217 217 THR THR A . n A 1 92 VAL 92 218 218 VAL VAL A . n A 1 93 TYR 93 219 219 TYR TYR A . n A 1 94 ARG 94 220 220 ARG ARG A . n A 1 95 GLU 95 221 221 GLU GLU A . n A 1 96 LEU 96 222 222 LEU LEU A . n A 1 97 GLN 97 223 223 GLN GLN A . n A 1 98 LYS 98 224 224 LYS LYS A . n A 1 99 LEU 99 225 225 LEU LEU A . n A 1 100 SER 100 226 226 SER SER A . n A 1 101 LYS 101 227 227 LYS LYS A . n A 1 102 PHE 102 228 228 PHE PHE A . n A 1 103 ASP 103 229 229 ASP ASP A . n A 1 104 GLU 104 230 230 GLU GLU A . n A 1 105 GLN 105 231 231 GLN GLN A . n A 1 106 ARG 106 232 232 ARG ARG A . n A 1 107 THR 107 233 233 THR THR A . n A 1 108 ALA 108 234 234 ALA ALA A . n A 1 109 THR 109 235 235 THR THR A . n A 1 110 TYR 110 236 236 TYR TYR A . n A 1 111 ILE 111 237 237 ILE ILE A . n A 1 112 THR 112 238 238 THR THR A . n A 1 113 GLU 113 239 239 GLU GLU A . n A 1 114 LEU 114 240 240 LEU LEU A . n A 1 115 ALA 115 241 241 ALA ALA A . n A 1 116 ASN 116 242 242 ASN ASN A . n A 1 117 ALA 117 243 243 ALA ALA A . n A 1 118 LEU 118 244 244 LEU LEU A . n A 1 119 SER 119 245 245 SER SER A . n A 1 120 TYR 120 246 246 TYR TYR A . n A 1 121 CYS 121 247 247 CYS CYS A . n A 1 122 HIS 122 248 248 HIS HIS A . n A 1 123 SER 123 249 249 SER SER A . n A 1 124 LYS 124 250 250 LYS LYS A . n A 1 125 ARG 125 251 251 ARG ARG A . n A 1 126 VAL 126 252 252 VAL VAL A . n A 1 127 ILE 127 253 253 ILE ILE A . n A 1 128 HIS 128 254 254 HIS HIS A . n A 1 129 ARG 129 255 255 ARG ARG A . n A 1 130 ASP 130 256 256 ASP ASP A . n A 1 131 ILE 131 257 257 ILE ILE A . n A 1 132 LYS 132 258 258 LYS LYS A . n A 1 133 PRO 133 259 259 PRO PRO A . n A 1 134 GLU 134 260 260 GLU GLU A . n A 1 135 ASN 135 261 261 ASN ASN A . n A 1 136 LEU 136 262 262 LEU LEU A . n A 1 137 LEU 137 263 263 LEU LEU A . n A 1 138 LEU 138 264 264 LEU LEU A . n A 1 139 GLY 139 265 265 GLY GLY A . n A 1 140 SER 140 266 266 SER SER A . n A 1 141 ALA 141 267 267 ALA ALA A . n A 1 142 GLY 142 268 268 GLY GLY A . n A 1 143 GLU 143 269 269 GLU GLU A . n A 1 144 LEU 144 270 270 LEU LEU A . n A 1 145 LYS 145 271 271 LYS LYS A . n A 1 146 ILE 146 272 272 ILE ILE A . n A 1 147 ALA 147 273 273 ALA ALA A . n A 1 148 ASP 148 274 274 ASP ASP A . n A 1 149 PHE 149 275 275 PHE PHE A . n A 1 150 GLY 150 276 276 GLY GLY A . n A 1 151 TRP 151 277 277 TRP TRP A . n A 1 152 SER 152 278 278 SER SER A . n A 1 153 VAL 153 279 279 VAL VAL A . n A 1 154 HIS 154 280 280 HIS HIS A . n A 1 155 ALA 155 281 281 ALA ALA A . n A 1 156 PRO 156 282 282 PRO PRO A . n A 1 157 SER 157 283 283 SER SER A . n A 1 158 SER 158 284 284 SER SER A . n A 1 159 ARG 159 285 285 ARG ARG A . n A 1 160 ARG 160 286 286 ARG ARG A . n A 1 161 THR 161 287 287 THR THR A . n A 1 162 TPO 162 288 288 TPO TPO A . n A 1 163 LEU 163 289 289 LEU LEU A . n A 1 164 ALA 164 290 290 ALA ALA A . n A 1 165 GLY 165 291 291 GLY GLY A . n A 1 166 THR 166 292 292 THR THR A . n A 1 167 LEU 167 293 293 LEU LEU A . n A 1 168 ASP 168 294 294 ASP ASP A . n A 1 169 TYR 169 295 295 TYR TYR A . n A 1 170 LEU 170 296 296 LEU LEU A . n A 1 171 PRO 171 297 297 PRO PRO A . n A 1 172 PRO 172 298 298 PRO PRO A . n A 1 173 GLU 173 299 299 GLU GLU A . n A 1 174 MET 174 300 300 MET MET A . n A 1 175 ILE 175 301 301 ILE ILE A . n A 1 176 GLU 176 302 302 GLU GLU A . n A 1 177 GLY 177 303 303 GLY GLY A . n A 1 178 ARG 178 304 304 ARG ARG A . n A 1 179 MET 179 305 305 MET MET A . n A 1 180 HIS 180 306 306 HIS HIS A . n A 1 181 ASP 181 307 307 ASP ASP A . n A 1 182 GLU 182 308 308 GLU GLU A . n A 1 183 LYS 183 309 309 LYS LYS A . n A 1 184 VAL 184 310 310 VAL VAL A . n A 1 185 ASP 185 311 311 ASP ASP A . n A 1 186 LEU 186 312 312 LEU LEU A . n A 1 187 TRP 187 313 313 TRP TRP A . n A 1 188 SER 188 314 314 SER SER A . n A 1 189 LEU 189 315 315 LEU LEU A . n A 1 190 GLY 190 316 316 GLY GLY A . n A 1 191 VAL 191 317 317 VAL VAL A . n A 1 192 LEU 192 318 318 LEU LEU A . n A 1 193 CYS 193 319 319 CYS CYS A . n A 1 194 TYR 194 320 320 TYR TYR A . n A 1 195 GLU 195 321 321 GLU GLU A . n A 1 196 PHE 196 322 322 PHE PHE A . n A 1 197 LEU 197 323 323 LEU LEU A . n A 1 198 VAL 198 324 324 VAL VAL A . n A 1 199 GLY 199 325 325 GLY GLY A . n A 1 200 LYS 200 326 326 LYS LYS A . n A 1 201 PRO 201 327 327 PRO PRO A . n A 1 202 PRO 202 328 328 PRO PRO A . n A 1 203 PHE 203 329 329 PHE PHE A . n A 1 204 GLU 204 330 330 GLU GLU A . n A 1 205 ALA 205 331 331 ALA ALA A . n A 1 206 ASN 206 332 332 ASN ASN A . n A 1 207 THR 207 333 333 THR THR A . n A 1 208 TYR 208 334 334 TYR TYR A . n A 1 209 GLN 209 335 335 GLN GLN A . n A 1 210 GLU 210 336 336 GLU GLU A . n A 1 211 THR 211 337 337 THR THR A . n A 1 212 TYR 212 338 338 TYR TYR A . n A 1 213 LYS 213 339 339 LYS LYS A . n A 1 214 ARG 214 340 340 ARG ARG A . n A 1 215 ILE 215 341 341 ILE ILE A . n A 1 216 SER 216 342 342 SER SER A . n A 1 217 ARG 217 343 343 ARG ARG A . n A 1 218 VAL 218 344 344 VAL VAL A . n A 1 219 GLU 219 345 345 GLU GLU A . n A 1 220 PHE 220 346 346 PHE PHE A . n A 1 221 THR 221 347 347 THR THR A . n A 1 222 PHE 222 348 348 PHE PHE A . n A 1 223 PRO 223 349 349 PRO PRO A . n A 1 224 ASP 224 350 350 ASP ASP A . n A 1 225 PHE 225 351 351 PHE PHE A . n A 1 226 VAL 226 352 352 VAL VAL A . n A 1 227 THR 227 353 353 THR THR A . n A 1 228 GLU 228 354 354 GLU GLU A . n A 1 229 GLY 229 355 355 GLY GLY A . n A 1 230 ALA 230 356 356 ALA ALA A . n A 1 231 ARG 231 357 357 ARG ARG A . n A 1 232 ASP 232 358 358 ASP ASP A . n A 1 233 LEU 233 359 359 LEU LEU A . n A 1 234 ILE 234 360 360 ILE ILE A . n A 1 235 SER 235 361 361 SER SER A . n A 1 236 ARG 236 362 362 ARG ARG A . n A 1 237 LEU 237 363 363 LEU LEU A . n A 1 238 LEU 238 364 364 LEU LEU A . n A 1 239 LYS 239 365 365 LYS LYS A . n A 1 240 HIS 240 366 366 HIS HIS A . n A 1 241 ASN 241 367 367 ASN ASN A . n A 1 242 PRO 242 368 368 PRO PRO A . n A 1 243 SER 243 369 369 SER SER A . n A 1 244 GLN 244 370 370 GLN GLN A . n A 1 245 ARG 245 371 371 ARG ARG A . n A 1 246 PRO 246 372 372 PRO PRO A . n A 1 247 MET 247 373 373 MET MET A . n A 1 248 LEU 248 374 374 LEU LEU A . n A 1 249 ARG 249 375 375 ARG ARG A . n A 1 250 GLU 250 376 376 GLU GLU A . n A 1 251 VAL 251 377 377 VAL VAL A . n A 1 252 LEU 252 378 378 LEU LEU A . n A 1 253 GLU 253 379 379 GLU GLU A . n A 1 254 HIS 254 380 380 HIS HIS A . n A 1 255 PRO 255 381 381 PRO PRO A . n A 1 256 TRP 256 382 382 TRP TRP A . n A 1 257 ILE 257 383 383 ILE ILE A . n A 1 258 THR 258 384 384 THR THR A . n A 1 259 ALA 259 385 385 ALA ALA A . n A 1 260 ASN 260 386 386 ASN ASN A . n A 1 261 SER 261 387 387 SER SER A . n A 1 262 SER 262 388 388 SER SER A . n A 1 263 LYS 263 389 389 LYS LYS A . n A 1 264 PRO 264 390 390 PRO PRO A . n A 1 265 SER 265 391 391 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ADP 1 401 1392 ADP ADP A . C 3 MG 1 402 1395 MG MG A . D 3 MG 1 403 1396 MG MG A . E 4 A7N 1 404 1 A7N FRG A . F 5 HOH 1 501 82 HOH HOH A . F 5 HOH 2 502 88 HOH HOH A . F 5 HOH 3 503 122 HOH HOH A . F 5 HOH 4 504 119 HOH HOH A . F 5 HOH 5 505 48 HOH HOH A . F 5 HOH 6 506 131 HOH HOH A . F 5 HOH 7 507 6 HOH HOH A . F 5 HOH 8 508 81 HOH HOH A . F 5 HOH 9 509 114 HOH HOH A . F 5 HOH 10 510 105 HOH HOH A . F 5 HOH 11 511 107 HOH HOH A . F 5 HOH 12 512 136 HOH HOH A . F 5 HOH 13 513 96 HOH HOH A . F 5 HOH 14 514 51 HOH HOH A . F 5 HOH 15 515 137 HOH HOH A . F 5 HOH 16 516 79 HOH HOH A . F 5 HOH 17 517 20 HOH HOH A . F 5 HOH 18 518 92 HOH HOH A . F 5 HOH 19 519 108 HOH HOH A . F 5 HOH 20 520 72 HOH HOH A . F 5 HOH 21 521 83 HOH HOH A . F 5 HOH 22 522 61 HOH HOH A . F 5 HOH 23 523 139 HOH HOH A . F 5 HOH 24 524 121 HOH HOH A . F 5 HOH 25 525 68 HOH HOH A . F 5 HOH 26 526 24 HOH HOH A . F 5 HOH 27 527 26 HOH HOH A . F 5 HOH 28 528 54 HOH HOH A . F 5 HOH 29 529 2 HOH HOH A . F 5 HOH 30 530 143 HOH HOH A . F 5 HOH 31 531 41 HOH HOH A . F 5 HOH 32 532 42 HOH HOH A . F 5 HOH 33 533 1 HOH HOH A . F 5 HOH 34 534 19 HOH HOH A . F 5 HOH 35 535 31 HOH HOH A . F 5 HOH 36 536 30 HOH HOH A . F 5 HOH 37 537 73 HOH HOH A . F 5 HOH 38 538 87 HOH HOH A . F 5 HOH 39 539 85 HOH HOH A . F 5 HOH 40 540 39 HOH HOH A . F 5 HOH 41 541 140 HOH HOH A . F 5 HOH 42 542 115 HOH HOH A . F 5 HOH 43 543 100 HOH HOH A . F 5 HOH 44 544 102 HOH HOH A . F 5 HOH 45 545 98 HOH HOH A . F 5 HOH 46 546 99 HOH HOH A . F 5 HOH 47 547 17 HOH HOH A . F 5 HOH 48 548 97 HOH HOH A . F 5 HOH 49 549 25 HOH HOH A . F 5 HOH 50 550 116 HOH HOH A . F 5 HOH 51 551 95 HOH HOH A . F 5 HOH 52 552 57 HOH HOH A . F 5 HOH 53 553 27 HOH HOH A . F 5 HOH 54 554 16 HOH HOH A . F 5 HOH 55 555 110 HOH HOH A . F 5 HOH 56 556 38 HOH HOH A . F 5 HOH 57 557 59 HOH HOH A . F 5 HOH 58 558 49 HOH HOH A . F 5 HOH 59 559 15 HOH HOH A . F 5 HOH 60 560 103 HOH HOH A . F 5 HOH 61 561 18 HOH HOH A . F 5 HOH 62 562 63 HOH HOH A . F 5 HOH 63 563 23 HOH HOH A . F 5 HOH 64 564 13 HOH HOH A . F 5 HOH 65 565 7 HOH HOH A . F 5 HOH 66 566 28 HOH HOH A . F 5 HOH 67 567 5 HOH HOH A . F 5 HOH 68 568 33 HOH HOH A . F 5 HOH 69 569 43 HOH HOH A . F 5 HOH 70 570 47 HOH HOH A . F 5 HOH 71 571 10 HOH HOH A . F 5 HOH 72 572 46 HOH HOH A . F 5 HOH 73 573 71 HOH HOH A . F 5 HOH 74 574 32 HOH HOH A . F 5 HOH 75 575 12 HOH HOH A . F 5 HOH 76 576 44 HOH HOH A . F 5 HOH 77 577 94 HOH HOH A . F 5 HOH 78 578 123 HOH HOH A . F 5 HOH 79 579 78 HOH HOH A . F 5 HOH 80 580 29 HOH HOH A . F 5 HOH 81 581 112 HOH HOH A . F 5 HOH 82 582 64 HOH HOH A . F 5 HOH 83 583 77 HOH HOH A . F 5 HOH 84 584 45 HOH HOH A . F 5 HOH 85 585 8 HOH HOH A . F 5 HOH 86 586 11 HOH HOH A . F 5 HOH 87 587 34 HOH HOH A . F 5 HOH 88 588 74 HOH HOH A . F 5 HOH 89 589 67 HOH HOH A . F 5 HOH 90 590 40 HOH HOH A . F 5 HOH 91 591 4 HOH HOH A . F 5 HOH 92 592 35 HOH HOH A . F 5 HOH 93 593 117 HOH HOH A . F 5 HOH 94 594 129 HOH HOH A . F 5 HOH 95 595 126 HOH HOH A . F 5 HOH 96 596 76 HOH HOH A . F 5 HOH 97 597 127 HOH HOH A . F 5 HOH 98 598 154 HOH HOH A . F 5 HOH 99 599 124 HOH HOH A . F 5 HOH 100 600 3 HOH HOH A . F 5 HOH 101 601 138 HOH HOH A . F 5 HOH 102 602 91 HOH HOH A . F 5 HOH 103 603 55 HOH HOH A . F 5 HOH 104 604 106 HOH HOH A . F 5 HOH 105 605 56 HOH HOH A . F 5 HOH 106 606 104 HOH HOH A . F 5 HOH 107 607 62 HOH HOH A . F 5 HOH 108 608 65 HOH HOH A . F 5 HOH 109 609 69 HOH HOH A . F 5 HOH 110 610 58 HOH HOH A . F 5 HOH 111 611 52 HOH HOH A . F 5 HOH 112 612 84 HOH HOH A . F 5 HOH 113 613 37 HOH HOH A . F 5 HOH 114 614 80 HOH HOH A . F 5 HOH 115 615 14 HOH HOH A . F 5 HOH 116 616 75 HOH HOH A . F 5 HOH 117 617 135 HOH HOH A . F 5 HOH 118 618 21 HOH HOH A . F 5 HOH 119 619 149 HOH HOH A . F 5 HOH 120 620 130 HOH HOH A . F 5 HOH 121 621 22 HOH HOH A . F 5 HOH 122 622 152 HOH HOH A . F 5 HOH 123 623 70 HOH HOH A . F 5 HOH 124 624 145 HOH HOH A . F 5 HOH 125 625 134 HOH HOH A . F 5 HOH 126 626 9 HOH HOH A . F 5 HOH 127 627 36 HOH HOH A . F 5 HOH 128 628 53 HOH HOH A . F 5 HOH 129 629 86 HOH HOH A . F 5 HOH 130 630 125 HOH HOH A . F 5 HOH 131 631 128 HOH HOH A . F 5 HOH 132 632 113 HOH HOH A . F 5 HOH 133 633 109 HOH HOH A . F 5 HOH 134 634 151 HOH HOH A . F 5 HOH 135 635 141 HOH HOH A . F 5 HOH 136 636 144 HOH HOH A . F 5 HOH 137 637 50 HOH HOH A . F 5 HOH 138 638 148 HOH HOH A . F 5 HOH 139 639 150 HOH HOH A . F 5 HOH 140 640 89 HOH HOH A . F 5 HOH 141 641 147 HOH HOH A . F 5 HOH 142 642 146 HOH HOH A . F 5 HOH 143 643 101 HOH HOH A . F 5 HOH 144 644 120 HOH HOH A . F 5 HOH 145 645 155 HOH HOH A . F 5 HOH 146 646 90 HOH HOH A . F 5 HOH 147 647 133 HOH HOH A . F 5 HOH 148 648 132 HOH HOH A . F 5 HOH 149 649 153 HOH HOH A . F 5 HOH 150 650 156 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id TPO _pdbx_struct_mod_residue.label_seq_id 162 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id TPO _pdbx_struct_mod_residue.auth_seq_id 288 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id THR _pdbx_struct_mod_residue.details 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1100 ? 1 MORE -28 ? 1 'SSA (A^2)' 12550 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASN 135 ? A ASN 261 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 OD2 ? A ASP 148 ? A ASP 274 ? 1_555 86.1 ? 2 OD1 ? A ASN 135 ? A ASN 261 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O3B ? B ADP . ? A ADP 401 ? 1_555 178.3 ? 3 OD2 ? A ASP 148 ? A ASP 274 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O3B ? B ADP . ? A ADP 401 ? 1_555 94.7 ? 4 OD1 ? A ASN 135 ? A ASN 261 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O2A ? B ADP . ? A ADP 401 ? 1_555 90.6 ? 5 OD2 ? A ASP 148 ? A ASP 274 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O2A ? B ADP . ? A ADP 401 ? 1_555 97.6 ? 6 O3B ? B ADP . ? A ADP 401 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O2A ? B ADP . ? A ADP 401 ? 1_555 87.8 ? 7 OD1 ? A ASN 135 ? A ASN 261 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 568 ? 1_555 88.5 ? 8 OD2 ? A ASP 148 ? A ASP 274 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 568 ? 1_555 93.8 ? 9 O3B ? B ADP . ? A ADP 401 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 568 ? 1_555 92.9 ? 10 O2A ? B ADP . ? A ADP 401 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 568 ? 1_555 168.4 ? 11 OD1 ? A ASN 135 ? A ASN 261 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 587 ? 1_555 84.4 ? 12 OD2 ? A ASP 148 ? A ASP 274 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 587 ? 1_555 170.3 ? 13 O3B ? B ADP . ? A ADP 401 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 587 ? 1_555 94.9 ? 14 O2A ? B ADP . ? A ADP 401 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 587 ? 1_555 84.3 ? 15 O ? F HOH . ? A HOH 568 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 587 ? 1_555 84.1 ? 16 OD1 ? A ASP 148 ? A ASP 274 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O1B ? B ADP . ? A ADP 401 ? 1_555 84.6 ? 17 OD1 ? A ASP 148 ? A ASP 274 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? F HOH . ? A HOH 507 ? 1_555 91.2 ? 18 O1B ? B ADP . ? A ADP 401 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? F HOH . ? A HOH 507 ? 1_555 98.5 ? 19 OD1 ? A ASP 148 ? A ASP 274 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? F HOH . ? A HOH 530 ? 1_555 88.0 ? 20 O1B ? B ADP . ? A ADP 401 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? F HOH . ? A HOH 530 ? 1_555 83.3 ? 21 O ? F HOH . ? A HOH 507 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? F HOH . ? A HOH 530 ? 1_555 178.0 ? 22 OD1 ? A ASP 148 ? A ASP 274 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? F HOH . ? A HOH 626 ? 1_555 89.1 ? 23 O1B ? B ADP . ? A ADP 401 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? F HOH . ? A HOH 626 ? 1_555 162.8 ? 24 O ? F HOH . ? A HOH 507 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? F HOH . ? A HOH 626 ? 1_555 97.6 ? 25 O ? F HOH . ? A HOH 530 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? F HOH . ? A HOH 626 ? 1_555 80.5 ? 26 OD1 ? A ASP 148 ? A ASP 274 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? F HOH . ? A HOH 628 ? 1_555 167.9 ? 27 O1B ? B ADP . ? A ADP 401 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? F HOH . ? A HOH 628 ? 1_555 106.7 ? 28 O ? F HOH . ? A HOH 507 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? F HOH . ? A HOH 628 ? 1_555 82.9 ? 29 O ? F HOH . ? A HOH 530 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? F HOH . ? A HOH 628 ? 1_555 97.6 ? 30 O ? F HOH . ? A HOH 626 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? F HOH . ? A HOH 628 ? 1_555 81.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-11-01 2 'Structure model' 1 1 2017-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_citation_author.name' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A PHE 144 ? ? O A HOH 501 ? ? 2.11 2 1 O A HOH 603 ? ? O A HOH 634 ? ? 2.12 3 1 O A HOH 579 ? ? O A HOH 608 ? ? 2.16 4 1 O A HOH 501 ? ? O A HOH 537 ? ? 2.18 5 1 O A HOH 628 ? ? O A HOH 630 ? ? 2.19 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 LEU _pdbx_validate_rmsd_angle.auth_seq_id_1 312 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CB _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 LEU _pdbx_validate_rmsd_angle.auth_seq_id_2 312 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CG _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 LEU _pdbx_validate_rmsd_angle.auth_seq_id_3 312 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 100.35 _pdbx_validate_rmsd_angle.angle_target_value 115.30 _pdbx_validate_rmsd_angle.angle_deviation -14.95 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.30 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 202 ? ? -145.30 25.96 2 1 ALA A 203 ? ? 83.03 -11.69 3 1 SER A 226 ? ? 72.81 -51.15 4 1 ARG A 255 ? ? 69.82 -0.73 5 1 ASP A 274 ? ? 63.71 72.30 6 1 ALA A 290 ? ? -97.05 -71.52 7 1 ASP A 307 ? ? -142.85 -154.63 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 141 ? CG ? A LYS 15 CG 2 1 Y 1 A LYS 141 ? CD ? A LYS 15 CD 3 1 Y 1 A LYS 141 ? CE ? A LYS 15 CE 4 1 Y 1 A LYS 141 ? NZ ? A LYS 15 NZ 5 1 Y 1 A LYS 143 ? CG ? A LYS 17 CG 6 1 Y 1 A LYS 143 ? CD ? A LYS 17 CD 7 1 Y 1 A LYS 143 ? CE ? A LYS 17 CE 8 1 Y 1 A LYS 143 ? NZ ? A LYS 17 NZ 9 1 Y 1 A GLU 170 ? CG ? A GLU 44 CG 10 1 Y 1 A GLU 170 ? CD ? A GLU 44 CD 11 1 Y 1 A GLU 170 ? OE1 ? A GLU 44 OE1 12 1 Y 1 A GLU 170 ? OE2 ? A GLU 44 OE2 13 1 Y 1 A LYS 171 ? CG ? A LYS 45 CG 14 1 Y 1 A LYS 171 ? CD ? A LYS 45 CD 15 1 Y 1 A LYS 171 ? CE ? A LYS 45 CE 16 1 Y 1 A LYS 171 ? NZ ? A LYS 45 NZ 17 1 Y 1 A ARG 220 ? CG ? A ARG 94 CG 18 1 Y 1 A ARG 220 ? CD ? A ARG 94 CD 19 1 Y 1 A ARG 220 ? NE ? A ARG 94 NE 20 1 Y 1 A ARG 220 ? CZ ? A ARG 94 CZ 21 1 Y 1 A ARG 220 ? NH1 ? A ARG 94 NH1 22 1 Y 1 A ARG 220 ? NH2 ? A ARG 94 NH2 23 1 Y 1 A LYS 339 ? CG ? A LYS 213 CG 24 1 Y 1 A LYS 339 ? CD ? A LYS 213 CD 25 1 Y 1 A LYS 339 ? CE ? A LYS 213 CE 26 1 Y 1 A LYS 339 ? NZ ? A LYS 213 NZ 27 1 Y 1 A GLU 354 ? CG ? A GLU 228 CG 28 1 Y 1 A GLU 354 ? CD ? A GLU 228 CD 29 1 Y 1 A GLU 354 ? OE1 ? A GLU 228 OE1 30 1 Y 1 A GLU 354 ? OE2 ? A GLU 228 OE2 31 1 Y 1 A ARG 375 ? CG ? A ARG 249 CG 32 1 Y 1 A ARG 375 ? CD ? A ARG 249 CD 33 1 Y 1 A ARG 375 ? NE ? A ARG 249 NE 34 1 Y 1 A ARG 375 ? CZ ? A ARG 249 CZ 35 1 Y 1 A ARG 375 ? NH1 ? A ARG 249 NH1 36 1 Y 1 A ARG 375 ? NH2 ? A ARG 249 NH2 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Cancer Research UK' 'United Kingdom' C24461/A12772 1 'Cancer Research UK' 'United Kingdom' C24461/A23302 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "ADENOSINE-5'-DIPHOSPHATE" ADP 3 'MAGNESIUM ION' MG 4 '(1~{R})-1-(4-ethoxyphenyl)ethanamine' A7N 5 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #