data_5QEN # _entry.id 5QEN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.303 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5QEN WWPDB D_1001401852 # _pdbx_database_status.entry_id 5QEN _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.recvd_initial_deposition_date 2018-08-30 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.pdbx_ordinal _audit_author.name 1 'Keedy, D.A.' 2 'Hill, Z.B.' 3 'Biel, J.T.' 4 'Kang, E.' 5 'Rettenmaier, T.J.' 6 'Brandao-Neto, J.' 7 'von Delft, F.' 8 'Wells, J.A.' 9 'Fraser, J.S.' # _citation.id primary _citation.journal_abbrev Elife _citation.title 'An expanded allosteric network in PTP1B by multitemperature crystallography, fragment screening, and covalent tethering.' _citation.year 2018 _citation.journal_volume 7 _citation.page_first ? _citation.page_last ? _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 2050-084X _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 29877794 _citation.pdbx_database_id_DOI 10.7554/eLife.36307 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Keedy, D.A.' 1 0000-0002-9184-7586 primary 'Hill, Z.B.' 2 ? primary 'Biel, J.T.' 3 0000-0002-0935-8362 primary 'Kang, E.' 4 ? primary 'Rettenmaier, T.J.' 5 ? primary 'Brandao-Neto, J.' 6 0000-0001-6015-320X primary 'Pearce, N.M.' 7 0000-0002-6693-8603 primary 'von Delft, F.' 8 0000-0003-0378-0017 primary 'Wells, J.A.' 9 0000-0001-8267-5519 primary 'Fraser, J.S.' 10 0000-0002-5080-2859 # _cell.entry_id 5QEN _cell.length_a 90.050 _cell.length_b 90.050 _cell.length_c 106.788 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5QEN _symmetry.Int_Tables_number 152 _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Tyrosine-protein phosphatase non-receptor type 1' 37345.562 1 3.1.3.48 'C32S, C92V' 'catalytic domain' ? 2 non-polymer syn '[(3S,4R)-4-(4-fluorophenyl)-1-methylpiperidin-3-yl]methanol' 223.287 1 ? ? ? ? 3 non-polymer syn 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 122.143 1 ? ? ? ? 4 water nat water 18.015 262 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Protein-tyrosine phosphatase 1B,PTP-1B' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPSRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRS YILTQGPLPNTVGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLEL ENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPH N ; _entity_poly.pdbx_seq_one_letter_code_can ;MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPSRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRS YILTQGPLPNTVGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLEL ENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPH N ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 MET n 1 4 GLU n 1 5 LYS n 1 6 GLU n 1 7 PHE n 1 8 GLU n 1 9 GLN n 1 10 ILE n 1 11 ASP n 1 12 LYS n 1 13 SER n 1 14 GLY n 1 15 SER n 1 16 TRP n 1 17 ALA n 1 18 ALA n 1 19 ILE n 1 20 TYR n 1 21 GLN n 1 22 ASP n 1 23 ILE n 1 24 ARG n 1 25 HIS n 1 26 GLU n 1 27 ALA n 1 28 SER n 1 29 ASP n 1 30 PHE n 1 31 PRO n 1 32 SER n 1 33 ARG n 1 34 VAL n 1 35 ALA n 1 36 LYS n 1 37 LEU n 1 38 PRO n 1 39 LYS n 1 40 ASN n 1 41 LYS n 1 42 ASN n 1 43 ARG n 1 44 ASN n 1 45 ARG n 1 46 TYR n 1 47 ARG n 1 48 ASP n 1 49 VAL n 1 50 SER n 1 51 PRO n 1 52 PHE n 1 53 ASP n 1 54 HIS n 1 55 SER n 1 56 ARG n 1 57 ILE n 1 58 LYS n 1 59 LEU n 1 60 HIS n 1 61 GLN n 1 62 GLU n 1 63 ASP n 1 64 ASN n 1 65 ASP n 1 66 TYR n 1 67 ILE n 1 68 ASN n 1 69 ALA n 1 70 SER n 1 71 LEU n 1 72 ILE n 1 73 LYS n 1 74 MET n 1 75 GLU n 1 76 GLU n 1 77 ALA n 1 78 GLN n 1 79 ARG n 1 80 SER n 1 81 TYR n 1 82 ILE n 1 83 LEU n 1 84 THR n 1 85 GLN n 1 86 GLY n 1 87 PRO n 1 88 LEU n 1 89 PRO n 1 90 ASN n 1 91 THR n 1 92 VAL n 1 93 GLY n 1 94 HIS n 1 95 PHE n 1 96 TRP n 1 97 GLU n 1 98 MET n 1 99 VAL n 1 100 TRP n 1 101 GLU n 1 102 GLN n 1 103 LYS n 1 104 SER n 1 105 ARG n 1 106 GLY n 1 107 VAL n 1 108 VAL n 1 109 MET n 1 110 LEU n 1 111 ASN n 1 112 ARG n 1 113 VAL n 1 114 MET n 1 115 GLU n 1 116 LYS n 1 117 GLY n 1 118 SER n 1 119 LEU n 1 120 LYS n 1 121 CYS n 1 122 ALA n 1 123 GLN n 1 124 TYR n 1 125 TRP n 1 126 PRO n 1 127 GLN n 1 128 LYS n 1 129 GLU n 1 130 GLU n 1 131 LYS n 1 132 GLU n 1 133 MET n 1 134 ILE n 1 135 PHE n 1 136 GLU n 1 137 ASP n 1 138 THR n 1 139 ASN n 1 140 LEU n 1 141 LYS n 1 142 LEU n 1 143 THR n 1 144 LEU n 1 145 ILE n 1 146 SER n 1 147 GLU n 1 148 ASP n 1 149 ILE n 1 150 LYS n 1 151 SER n 1 152 TYR n 1 153 TYR n 1 154 THR n 1 155 VAL n 1 156 ARG n 1 157 GLN n 1 158 LEU n 1 159 GLU n 1 160 LEU n 1 161 GLU n 1 162 ASN n 1 163 LEU n 1 164 THR n 1 165 THR n 1 166 GLN n 1 167 GLU n 1 168 THR n 1 169 ARG n 1 170 GLU n 1 171 ILE n 1 172 LEU n 1 173 HIS n 1 174 PHE n 1 175 HIS n 1 176 TYR n 1 177 THR n 1 178 THR n 1 179 TRP n 1 180 PRO n 1 181 ASP n 1 182 PHE n 1 183 GLY n 1 184 VAL n 1 185 PRO n 1 186 GLU n 1 187 SER n 1 188 PRO n 1 189 ALA n 1 190 SER n 1 191 PHE n 1 192 LEU n 1 193 ASN n 1 194 PHE n 1 195 LEU n 1 196 PHE n 1 197 LYS n 1 198 VAL n 1 199 ARG n 1 200 GLU n 1 201 SER n 1 202 GLY n 1 203 SER n 1 204 LEU n 1 205 SER n 1 206 PRO n 1 207 GLU n 1 208 HIS n 1 209 GLY n 1 210 PRO n 1 211 VAL n 1 212 VAL n 1 213 VAL n 1 214 HIS n 1 215 CYS n 1 216 SER n 1 217 ALA n 1 218 GLY n 1 219 ILE n 1 220 GLY n 1 221 ARG n 1 222 SER n 1 223 GLY n 1 224 THR n 1 225 PHE n 1 226 CYS n 1 227 LEU n 1 228 ALA n 1 229 ASP n 1 230 THR n 1 231 CYS n 1 232 LEU n 1 233 LEU n 1 234 LEU n 1 235 MET n 1 236 ASP n 1 237 LYS n 1 238 ARG n 1 239 LYS n 1 240 ASP n 1 241 PRO n 1 242 SER n 1 243 SER n 1 244 VAL n 1 245 ASP n 1 246 ILE n 1 247 LYS n 1 248 LYS n 1 249 VAL n 1 250 LEU n 1 251 LEU n 1 252 GLU n 1 253 MET n 1 254 ARG n 1 255 LYS n 1 256 PHE n 1 257 ARG n 1 258 MET n 1 259 GLY n 1 260 LEU n 1 261 ILE n 1 262 GLN n 1 263 THR n 1 264 ALA n 1 265 ASP n 1 266 GLN n 1 267 LEU n 1 268 ARG n 1 269 PHE n 1 270 SER n 1 271 TYR n 1 272 LEU n 1 273 ALA n 1 274 VAL n 1 275 ILE n 1 276 GLU n 1 277 GLY n 1 278 ALA n 1 279 LYS n 1 280 PHE n 1 281 ILE n 1 282 MET n 1 283 GLY n 1 284 ASP n 1 285 SER n 1 286 SER n 1 287 VAL n 1 288 GLN n 1 289 ASP n 1 290 GLN n 1 291 TRP n 1 292 LYS n 1 293 GLU n 1 294 LEU n 1 295 SER n 1 296 HIS n 1 297 GLU n 1 298 ASP n 1 299 LEU n 1 300 GLU n 1 301 PRO n 1 302 PRO n 1 303 PRO n 1 304 GLU n 1 305 HIS n 1 306 ILE n 1 307 PRO n 1 308 PRO n 1 309 PRO n 1 310 PRO n 1 311 ARG n 1 312 PRO n 1 313 PRO n 1 314 LYS n 1 315 ARG n 1 316 ILE n 1 317 LEU n 1 318 GLU n 1 319 PRO n 1 320 HIS n 1 321 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 321 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PTPN1, PTP1B' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET24b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PTN1_HUMAN _struct_ref.pdbx_db_accession P18031 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRS YILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLEL ENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPH N ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5QEN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 321 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P18031 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 321 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 321 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5QEN SER A 32 ? UNP P18031 CYS 32 'engineered mutation' 32 1 1 5QEN VAL A 92 ? UNP P18031 CYS 92 'engineered mutation' 92 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 JLD non-polymer . '[(3S,4R)-4-(4-fluorophenyl)-1-methylpiperidin-3-yl]methanol' ? 'C13 H18 F N O' 223.287 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TRS non-polymer . 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 'TRIS BUFFER' 'C4 H12 N O3 1' 122.143 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 5QEN _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.density_Matthews 3.35 _exptl_crystal.density_diffrn ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_percent_sol 63.25 _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.temp 277 _exptl_crystal_grow.pdbx_details 'well solution: 0.3 M magnesium acetate, 0.1 M HEPES pH 7.5, 0.1% beta-mercaptoethanol, 13-14% PEG 8000, 2% ethanol' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.crystal_id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector PIXEL _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.pdbx_collection_date 2016-09-25 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.92819 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'DIAMOND BEAMLINE I04-1' _diffrn_source.pdbx_wavelength_list 0.92819 _diffrn_source.pdbx_synchrotron_site Diamond _diffrn_source.pdbx_synchrotron_beamline I04-1 _diffrn_source.pdbx_wavelength ? # _reflns.d_resolution_high 1.780 _reflns.d_resolution_low 62.979 _reflns.pdbx_number_measured_all 475284 _reflns.number_obs 93532 _reflns.pdbx_Rmerge_I_obs 0.060 _reflns.pdbx_netI_over_sigmaI 14.330 _reflns.pdbx_chi_squared 1.197 _reflns.percent_possible_obs 99.900 _reflns.observed_criterion_sigma_I -3.000 _reflns.pdbx_Rrim_I_all 0.067 _reflns.pdbx_CC_half 0.999 _reflns.B_iso_Wilson_estimate 31.090 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 5QEN _reflns.observed_criterion_sigma_F ? _reflns.number_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_redundancy ? # loop_ _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_ordinal _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.pdbx_rejects _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.meanI_over_sigI_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_CC_half 1 1 1.780 1.880 67330 ? 15103 0 0.950 1.290 ? ? ? ? ? 15164 ? ? ? ? ? 99.600 1.078 ? 0.516 1 2 1.880 2.010 73643 ? 14242 0 0.533 2.630 ? ? ? ? ? 14244 ? ? ? ? ? 100.000 0.594 ? 0.821 1 3 2.010 2.170 70048 ? 13222 0 0.292 4.990 ? ? ? ? ? 13226 ? ? ? ? ? 100.000 0.325 ? 0.941 1 4 2.170 2.380 61526 ? 12186 0 0.176 8.280 ? ? ? ? ? 12195 ? ? ? ? ? 99.900 0.196 ? 0.979 1 5 2.380 2.660 59637 ? 11062 0 0.105 13.850 ? ? ? ? ? 11062 ? ? ? ? ? 100.000 0.116 ? 0.992 1 6 2.660 3.070 49420 ? 9663 0 0.067 21.380 ? ? ? ? ? 9682 ? ? ? ? ? 99.800 0.074 ? 0.997 1 7 3.070 3.760 43788 ? 8226 0 0.042 35.360 ? ? ? ? ? 8231 ? ? ? ? ? 99.900 0.046 ? 0.998 1 8 3.760 5.310 31604 ? 6323 0 0.031 45.980 ? ? ? ? ? 6341 ? ? ? ? ? 99.700 0.035 ? 0.999 1 9 5.310 62.979 18288 ? 3505 0 0.026 49.890 ? ? ? ? ? 3514 ? ? ? ? ? 99.700 0.029 ? 0.999 # _refine.entry_id 5QEN _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_d_res_high 1.7750 _refine.ls_d_res_low 45.0250 _refine.pdbx_ls_sigma_F 1.370 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 99.9500 _refine.ls_number_reflns_obs 48858 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.ls_matrix_type ? _refine.pdbx_R_Free_selection_details ? _refine.details ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1813 _refine.ls_R_factor_R_work 0.1802 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2090 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 3.9300 _refine.ls_number_reflns_R_free 1921 _refine.ls_number_reflns_R_work 46937 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 41.4624 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.2000 _refine.overall_SU_B ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.pdbx_solvent_vdw_probe_radii 1.3000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 1.2000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 128.840 _refine.B_iso_min 14.560 _refine.pdbx_overall_phase_error 20.4400 _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_R_factor_R_free_error_details ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.7750 _refine_hist.d_res_low 45.0250 _refine_hist.pdbx_number_atoms_ligand 88 _refine_hist.number_atoms_solvent 262 _refine_hist.number_atoms_total 2655 _refine_hist.pdbx_number_residues_total 282 _refine_hist.pdbx_B_iso_mean_ligand 63.07 _refine_hist.pdbx_B_iso_mean_solvent 47.74 _refine_hist.pdbx_number_atoms_protein 2305 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' f_bond_d 8595 0.020 ? ? ? 'X-RAY DIFFRACTION' f_angle_d 11728 2.020 ? ? ? 'X-RAY DIFFRACTION' f_chiral_restr 1215 0.161 ? ? ? 'X-RAY DIFFRACTION' f_plane_restr 1554 0.013 ? ? ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 3371 19.020 ? ? ? # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.pdbx_refine_id 1.7750 1.8194 14 100.0000 3298 . 0.3083 0.3197 . 135 . 3433 . 'X-RAY DIFFRACTION' 1.8194 1.8686 14 100.0000 3325 . 0.2627 0.2689 . 134 . 3459 . 'X-RAY DIFFRACTION' 1.8686 1.9236 14 100.0000 3300 . 0.2380 0.2808 . 135 . 3435 . 'X-RAY DIFFRACTION' 1.9236 1.9857 14 100.0000 3315 . 0.2158 0.2420 . 135 . 3450 . 'X-RAY DIFFRACTION' 1.9857 2.0566 14 100.0000 3337 . 0.2132 0.2842 . 139 . 3476 . 'X-RAY DIFFRACTION' 2.0566 2.1390 14 100.0000 3316 . 0.2023 0.2353 . 133 . 3449 . 'X-RAY DIFFRACTION' 2.1390 2.2363 14 100.0000 3325 . 0.1830 0.2387 . 139 . 3464 . 'X-RAY DIFFRACTION' 2.2363 2.3542 14 100.0000 3332 . 0.1793 0.1891 . 138 . 3470 . 'X-RAY DIFFRACTION' 2.3542 2.5017 14 100.0000 3346 . 0.1747 0.2227 . 136 . 3482 . 'X-RAY DIFFRACTION' 2.5017 2.6949 14 100.0000 3342 . 0.1696 0.1874 . 143 . 3485 . 'X-RAY DIFFRACTION' 2.6949 2.9660 14 100.0000 3363 . 0.1772 0.2132 . 138 . 3501 . 'X-RAY DIFFRACTION' 2.9660 3.3951 14 100.0000 3380 . 0.1739 0.1754 . 135 . 3515 . 'X-RAY DIFFRACTION' 3.3951 4.2769 14 100.0000 3420 . 0.1620 0.1889 . 140 . 3560 . 'X-RAY DIFFRACTION' 4.2769 45.0395 14 100.0000 3538 . 0.1728 0.2088 . 141 . 3679 . 'X-RAY DIFFRACTION' # _struct.entry_id 5QEN _struct.title 'PanDDA analysis group deposition -- Crystal structure of PTP1B in complex with compound_FMSOA000955b' _struct.pdbx_descriptor 'Tyrosine-protein phosphatase non-receptor type 1 (E.C.3.1.3.48)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 5QEN _struct_keywords.text ;PanDDA, SGC - Diamond I04-1 fragment screening, protein tyrosine phosphatase, PTP, protein tyrosine phosphatase 1B, PTP1B, enzyme, allostery, multiconformer, HYDROLASE ; _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 2 ? GLY A 14 ? GLU A 2 GLY A 14 1 ? 13 HELX_P HELX_P2 AA2 SER A 15 ? ALA A 27 ? SER A 15 ALA A 27 1 ? 13 HELX_P HELX_P3 AA3 LEU A 37 ? ASN A 44 ? LEU A 37 ASN A 44 5 ? 8 HELX_P HELX_P4 AA4 PHE A 52 ? HIS A 54 ? PHE A 52 HIS A 54 5 ? 3 HELX_P HELX_P5 AA5 THR A 91 ? LYS A 103 ? THR A 91 LYS A 103 1 ? 13 HELX_P HELX_P6 AA6 PRO A 188 ? SER A 201 ? PRO A 188 SER A 201 1 ? 14 HELX_P HELX_P7 AA7 GLY A 220 ? ARG A 238 ? GLY A 220 ARG A 238 1 ? 19 HELX_P HELX_P8 AA8 ASP A 240 ? VAL A 244 ? ASP A 240 VAL A 244 5 ? 5 HELX_P HELX_P9 AA9 ASP A 245 ? ARG A 254 ? ASP A 245 ARG A 254 1 ? 10 HELX_P HELX_P10 AB1 THR A 263 ? MET A 282 ? THR A 263 MET A 282 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale one ? A GLU 2 C C ? ? 1_555 A LYS 5 CG C ? A GLU 2 A LYS 5 1_555 ? ? ? ? ? ? ? 1.524 ? covale2 covale one ? A GLU 2 C C ? ? 1_555 A LYS 5 CD C ? A GLU 2 A LYS 5 1_555 ? ? ? ? ? ? ? 1.632 ? covale3 covale one ? A GLU 2 C D ? ? 1_555 A LYS 5 CG D ? A GLU 2 A LYS 5 1_555 ? ? ? ? ? ? ? 1.524 ? covale4 covale one ? A GLU 2 C D ? ? 1_555 A LYS 5 CD D ? A GLU 2 A LYS 5 1_555 ? ? ? ? ? ? ? 1.632 ? covale5 covale none ? A GLU 2 O C ? ? 1_555 A LYS 5 CB C ? A GLU 2 A LYS 5 1_555 ? ? ? ? ? ? ? 1.332 ? covale6 covale none ? A GLU 2 O C ? ? 1_555 A LYS 5 CD C ? A GLU 2 A LYS 5 1_555 ? ? ? ? ? ? ? 1.264 ? covale7 covale none ? A GLU 2 O D ? ? 1_555 A LYS 5 CB D ? A GLU 2 A LYS 5 1_555 ? ? ? ? ? ? ? 1.332 ? covale8 covale none ? A GLU 2 O D ? ? 1_555 A LYS 5 CD D ? A GLU 2 A LYS 5 1_555 ? ? ? ? ? ? ? 1.264 ? covale9 covale none ? A GLU 2 CG C ? ? 1_555 A LYS 5 CD C ? A GLU 2 A LYS 5 1_555 ? ? ? ? ? ? ? 1.637 ? covale10 covale none ? A GLU 2 CG C ? ? 1_555 A LYS 5 NZ C ? A GLU 2 A LYS 5 1_555 ? ? ? ? ? ? ? 1.463 ? covale11 covale none ? A GLU 2 CG D ? ? 1_555 A LYS 5 CD D ? A GLU 2 A LYS 5 1_555 ? ? ? ? ? ? ? 1.637 ? covale12 covale none ? A GLU 2 CG D ? ? 1_555 A LYS 5 NZ D ? A GLU 2 A LYS 5 1_555 ? ? ? ? ? ? ? 1.463 ? covale13 covale none ? A GLU 2 CD C ? ? 1_555 A LYS 5 CE C ? A GLU 2 A LYS 5 1_555 ? ? ? ? ? ? ? 1.520 ? covale14 covale none ? A GLU 2 CD D ? ? 1_555 A LYS 5 CE D ? A GLU 2 A LYS 5 1_555 ? ? ? ? ? ? ? 1.520 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 9 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 56 ? LYS A 58 ? ARG A 56 LYS A 58 AA1 2 TYR A 66 ? MET A 74 ? TYR A 66 MET A 74 AA1 3 ARG A 79 ? THR A 84 ? ARG A 79 THR A 84 AA1 4 VAL A 211 ? HIS A 214 ? VAL A 211 HIS A 214 AA1 5 GLY A 106 ? MET A 109 ? GLY A 106 MET A 109 AA1 6 THR A 168 ? TYR A 176 ? THR A 168 TYR A 176 AA1 7 TYR A 153 ? ASN A 162 ? TYR A 153 ASN A 162 AA1 8 LEU A 140 ? ILE A 149 ? LEU A 140 ILE A 149 AA1 9 MET A 133 ? PHE A 135 ? MET A 133 PHE A 135 AA2 1 MET A 114 ? GLU A 115 ? MET A 114 GLU A 115 AA2 2 SER A 118 ? LEU A 119 ? SER A 118 LEU A 119 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 57 ? N ILE A 57 O ALA A 69 ? O ALA A 69 AA1 2 3 N ILE A 72 ? N ILE A 72 O TYR A 81 ? O TYR A 81 AA1 3 4 N ILE A 82 ? N ILE A 82 O VAL A 213 ? O VAL A 213 AA1 4 5 O VAL A 212 ? O VAL A 212 N VAL A 108 ? N VAL A 108 AA1 5 6 N VAL A 107 ? N VAL A 107 O PHE A 174 ? O PHE A 174 AA1 6 7 O HIS A 173 ? O HIS A 173 N ARG A 156 ? N ARG A 156 AA1 7 8 O GLN A 157 ? O GLN A 157 N ILE A 145 ? N ILE A 145 AA1 8 9 O LEU A 140 ? O LEU A 140 N PHE A 135 ? N PHE A 135 AA2 1 2 N GLU A 115 ? N GLU A 115 O SER A 118 ? O SER A 118 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A JLD 401 ? 6 'binding site for residue JLD A 401' AC2 Software A TRS 402 ? 6 'binding site for residue TRS A 402' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ASP A 29 ? ASP A 29 . ? 1_555 ? 2 AC1 6 PRO A 31 ? PRO A 31 . ? 1_555 ? 3 AC1 6 ARG A 33 ? ARG A 33 . ? 1_555 ? 4 AC1 6 ILE A 145 ? ILE A 145 . ? 4_455 ? 5 AC1 6 LEU A 158 ? LEU A 158 . ? 4_455 ? 6 AC1 6 GLU A 170 ? GLU A 170 . ? 4_455 ? 7 AC2 6 HIS A 54 ? HIS A 54 . ? 1_555 ? 8 AC2 6 LYS A 128 ? LYS A 128 . ? 4_455 ? 9 AC2 6 GLU A 129 ? GLU A 129 . ? 4_455 ? 10 AC2 6 GLU A 130 ? GLU A 130 . ? 4_455 ? 11 AC2 6 HOH D . ? HOH A 542 . ? 1_555 ? 12 AC2 6 HOH D . ? HOH A 598 . ? 1_555 ? # _atom_sites.entry_id 5QEN _atom_sites.fract_transf_matrix[1][1] 0.011105 _atom_sites.fract_transf_matrix[1][2] 0.006411 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012823 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009364 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C F H N O S # loop_ _database_PDB_caveat.text 'Several residues are not properly linked with short C-N bond distance for certain conformers.' # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 TRP 16 16 16 TRP TRP A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 HIS 54 54 54 HIS HIS A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 HIS 60 60 60 HIS HIS A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 TYR 66 66 66 TYR TYR A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 MET 74 74 74 MET MET A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 TYR 81 81 81 TYR TYR A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 HIS 94 94 94 HIS HIS A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 TRP 96 96 96 TRP TRP A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 MET 98 98 98 MET MET A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 TRP 100 100 100 TRP TRP A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 GLN 102 102 102 GLN GLN A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 MET 109 109 109 MET MET A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 MET 114 114 114 MET MET A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 CYS 121 121 121 CYS CYS A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 TYR 124 124 124 TYR TYR A . n A 1 125 TRP 125 125 125 TRP TRP A . n A 1 126 PRO 126 126 126 PRO PRO A . n A 1 127 GLN 127 127 127 GLN GLN A . n A 1 128 LYS 128 128 128 LYS LYS A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 LYS 131 131 131 LYS LYS A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 MET 133 133 133 MET MET A . n A 1 134 ILE 134 134 134 ILE ILE A . n A 1 135 PHE 135 135 135 PHE PHE A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 THR 138 138 138 THR THR A . n A 1 139 ASN 139 139 139 ASN ASN A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 THR 143 143 143 THR THR A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 ASP 148 148 148 ASP ASP A . n A 1 149 ILE 149 149 149 ILE ILE A . n A 1 150 LYS 150 150 150 LYS LYS A . n A 1 151 SER 151 151 151 SER SER A . n A 1 152 TYR 152 152 152 TYR TYR A . n A 1 153 TYR 153 153 153 TYR TYR A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 GLN 157 157 157 GLN GLN A . n A 1 158 LEU 158 158 158 LEU LEU A . n A 1 159 GLU 159 159 159 GLU GLU A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 GLU 161 161 161 GLU GLU A . n A 1 162 ASN 162 162 162 ASN ASN A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 THR 164 164 164 THR THR A . n A 1 165 THR 165 165 165 THR THR A . n A 1 166 GLN 166 166 166 GLN GLN A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 THR 168 168 168 THR THR A . n A 1 169 ARG 169 169 169 ARG ARG A . n A 1 170 GLU 170 170 170 GLU GLU A . n A 1 171 ILE 171 171 171 ILE ILE A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 HIS 173 173 173 HIS HIS A . n A 1 174 PHE 174 174 174 PHE PHE A . n A 1 175 HIS 175 175 175 HIS HIS A . n A 1 176 TYR 176 176 176 TYR TYR A . n A 1 177 THR 177 177 177 THR THR A . n A 1 178 THR 178 178 178 THR THR A . n A 1 179 TRP 179 179 179 TRP TRP A . n A 1 180 PRO 180 180 180 PRO PRO A . n A 1 181 ASP 181 181 181 ASP ASP A . n A 1 182 PHE 182 182 182 PHE PHE A . n A 1 183 GLY 183 183 183 GLY GLY A . n A 1 184 VAL 184 184 184 VAL VAL A . n A 1 185 PRO 185 185 185 PRO PRO A . n A 1 186 GLU 186 186 186 GLU GLU A . n A 1 187 SER 187 187 187 SER SER A . n A 1 188 PRO 188 188 188 PRO PRO A . n A 1 189 ALA 189 189 189 ALA ALA A . n A 1 190 SER 190 190 190 SER SER A . n A 1 191 PHE 191 191 191 PHE PHE A . n A 1 192 LEU 192 192 192 LEU LEU A . n A 1 193 ASN 193 193 193 ASN ASN A . n A 1 194 PHE 194 194 194 PHE PHE A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 PHE 196 196 196 PHE PHE A . n A 1 197 LYS 197 197 197 LYS LYS A . n A 1 198 VAL 198 198 198 VAL VAL A . n A 1 199 ARG 199 199 199 ARG ARG A . n A 1 200 GLU 200 200 200 GLU GLU A . n A 1 201 SER 201 201 201 SER SER A . n A 1 202 GLY 202 202 202 GLY GLY A . n A 1 203 SER 203 203 203 SER SER A . n A 1 204 LEU 204 204 204 LEU LEU A . n A 1 205 SER 205 205 205 SER SER A . n A 1 206 PRO 206 206 206 PRO PRO A . n A 1 207 GLU 207 207 207 GLU GLU A . n A 1 208 HIS 208 208 208 HIS HIS A . n A 1 209 GLY 209 209 209 GLY GLY A . n A 1 210 PRO 210 210 210 PRO PRO A . n A 1 211 VAL 211 211 211 VAL VAL A . n A 1 212 VAL 212 212 212 VAL VAL A . n A 1 213 VAL 213 213 213 VAL VAL A . n A 1 214 HIS 214 214 214 HIS HIS A . n A 1 215 CYS 215 215 215 CYS CYS A . n A 1 216 SER 216 216 216 SER SER A . n A 1 217 ALA 217 217 217 ALA ALA A . n A 1 218 GLY 218 218 218 GLY GLY A . n A 1 219 ILE 219 219 219 ILE ILE A . n A 1 220 GLY 220 220 220 GLY GLY A . n A 1 221 ARG 221 221 221 ARG ARG A . n A 1 222 SER 222 222 222 SER SER A . n A 1 223 GLY 223 223 223 GLY GLY A . n A 1 224 THR 224 224 224 THR THR A . n A 1 225 PHE 225 225 225 PHE PHE A . n A 1 226 CYS 226 226 226 CYS CYS A . n A 1 227 LEU 227 227 227 LEU LEU A . n A 1 228 ALA 228 228 228 ALA ALA A . n A 1 229 ASP 229 229 229 ASP ASP A . n A 1 230 THR 230 230 230 THR THR A . n A 1 231 CYS 231 231 231 CYS CYS A . n A 1 232 LEU 232 232 232 LEU LEU A . n A 1 233 LEU 233 233 233 LEU LEU A . n A 1 234 LEU 234 234 234 LEU LEU A . n A 1 235 MET 235 235 235 MET MET A . n A 1 236 ASP 236 236 236 ASP ASP A . n A 1 237 LYS 237 237 237 LYS LYS A . n A 1 238 ARG 238 238 238 ARG ARG A . n A 1 239 LYS 239 239 239 LYS LYS A . n A 1 240 ASP 240 240 240 ASP ASP A . n A 1 241 PRO 241 241 241 PRO PRO A . n A 1 242 SER 242 242 242 SER SER A . n A 1 243 SER 243 243 243 SER SER A . n A 1 244 VAL 244 244 244 VAL VAL A . n A 1 245 ASP 245 245 245 ASP ASP A . n A 1 246 ILE 246 246 246 ILE ILE A . n A 1 247 LYS 247 247 247 LYS LYS A . n A 1 248 LYS 248 248 248 LYS LYS A . n A 1 249 VAL 249 249 249 VAL VAL A . n A 1 250 LEU 250 250 250 LEU LEU A . n A 1 251 LEU 251 251 251 LEU LEU A . n A 1 252 GLU 252 252 252 GLU GLU A . n A 1 253 MET 253 253 253 MET MET A . n A 1 254 ARG 254 254 254 ARG ARG A . n A 1 255 LYS 255 255 255 LYS LYS A . n A 1 256 PHE 256 256 256 PHE PHE A . n A 1 257 ARG 257 257 257 ARG ARG A . n A 1 258 MET 258 258 258 MET MET A . n A 1 259 GLY 259 259 259 GLY GLY A . n A 1 260 LEU 260 260 260 LEU LEU A . n A 1 261 ILE 261 261 261 ILE ILE A . n A 1 262 GLN 262 262 262 GLN GLN A . n A 1 263 THR 263 263 263 THR THR A . n A 1 264 ALA 264 264 264 ALA ALA A . n A 1 265 ASP 265 265 265 ASP ASP A . n A 1 266 GLN 266 266 266 GLN GLN A . n A 1 267 LEU 267 267 267 LEU LEU A . n A 1 268 ARG 268 268 268 ARG ARG A . n A 1 269 PHE 269 269 269 PHE PHE A . n A 1 270 SER 270 270 270 SER SER A . n A 1 271 TYR 271 271 271 TYR TYR A . n A 1 272 LEU 272 272 272 LEU LEU A . n A 1 273 ALA 273 273 273 ALA ALA A . n A 1 274 VAL 274 274 274 VAL VAL A . n A 1 275 ILE 275 275 275 ILE ILE A . n A 1 276 GLU 276 276 276 GLU GLU A . n A 1 277 GLY 277 277 277 GLY GLY A . n A 1 278 ALA 278 278 278 ALA ALA A . n A 1 279 LYS 279 279 279 LYS LYS A . n A 1 280 PHE 280 280 280 PHE PHE A . n A 1 281 ILE 281 281 281 ILE ILE A . n A 1 282 MET 282 282 282 MET MET A . n A 1 283 GLY 283 283 ? ? ? A . n A 1 284 ASP 284 284 ? ? ? A . n A 1 285 SER 285 285 ? ? ? A . n A 1 286 SER 286 286 ? ? ? A . n A 1 287 VAL 287 287 ? ? ? A . n A 1 288 GLN 288 288 ? ? ? A . n A 1 289 ASP 289 289 ? ? ? A . n A 1 290 GLN 290 290 ? ? ? A . n A 1 291 TRP 291 291 ? ? ? A . n A 1 292 LYS 292 292 ? ? ? A . n A 1 293 GLU 293 293 ? ? ? A . n A 1 294 LEU 294 294 ? ? ? A . n A 1 295 SER 295 295 ? ? ? A . n A 1 296 HIS 296 296 ? ? ? A . n A 1 297 GLU 297 297 ? ? ? A . n A 1 298 ASP 298 298 ? ? ? A . n A 1 299 LEU 299 299 ? ? ? A . n A 1 300 GLU 300 300 ? ? ? A . n A 1 301 PRO 301 301 ? ? ? A . n A 1 302 PRO 302 302 ? ? ? A . n A 1 303 PRO 303 303 ? ? ? A . n A 1 304 GLU 304 304 ? ? ? A . n A 1 305 HIS 305 305 ? ? ? A . n A 1 306 ILE 306 306 ? ? ? A . n A 1 307 PRO 307 307 ? ? ? A . n A 1 308 PRO 308 308 ? ? ? A . n A 1 309 PRO 309 309 ? ? ? A . n A 1 310 PRO 310 310 ? ? ? A . n A 1 311 ARG 311 311 ? ? ? A . n A 1 312 PRO 312 312 ? ? ? A . n A 1 313 PRO 313 313 ? ? ? A . n A 1 314 LYS 314 314 ? ? ? A . n A 1 315 ARG 315 315 ? ? ? A . n A 1 316 ILE 316 316 ? ? ? A . n A 1 317 LEU 317 317 ? ? ? A . n A 1 318 GLU 318 318 ? ? ? A . n A 1 319 PRO 319 319 ? ? ? A . n A 1 320 HIS 320 320 ? ? ? A . n A 1 321 ASN 321 321 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 JLD 1 401 1 JLD LIG A . C 3 TRS 1 402 500 TRS TRS A . D 4 HOH 1 501 39 HOH HOH A . D 4 HOH 2 502 239 HOH HOH A . D 4 HOH 3 503 144 HOH HOH A . D 4 HOH 4 504 222 HOH HOH A . D 4 HOH 5 505 119 HOH HOH A . D 4 HOH 6 506 161 HOH HOH A . D 4 HOH 7 507 248 HOH HOH A . D 4 HOH 8 508 209 HOH HOH A . D 4 HOH 9 509 167 HOH HOH A . D 4 HOH 10 510 60 HOH HOH A . D 4 HOH 11 511 21 HOH HOH A . D 4 HOH 12 512 127 HOH HOH A . D 4 HOH 13 513 176 HOH HOH A . D 4 HOH 14 514 148 HOH HOH A . D 4 HOH 15 515 211 HOH HOH A . D 4 HOH 16 516 146 HOH HOH A . D 4 HOH 17 517 89 HOH HOH A . D 4 HOH 18 518 59 HOH HOH A . D 4 HOH 19 519 223 HOH HOH A . D 4 HOH 20 520 236 HOH HOH A . D 4 HOH 21 521 147 HOH HOH A . D 4 HOH 22 522 141 HOH HOH A . D 4 HOH 23 523 11 HOH HOH A . D 4 HOH 24 524 165 HOH HOH A . D 4 HOH 25 525 3 HOH HOH A . D 4 HOH 26 526 182 HOH HOH A . D 4 HOH 27 527 6 HOH HOH A . D 4 HOH 28 528 70 HOH HOH A . D 4 HOH 29 529 149 HOH HOH A . D 4 HOH 30 530 24 HOH HOH A . D 4 HOH 31 531 195 HOH HOH A . D 4 HOH 32 532 83 HOH HOH A . D 4 HOH 33 533 220 HOH HOH A . D 4 HOH 34 534 58 HOH HOH A . D 4 HOH 35 535 44 HOH HOH A . D 4 HOH 36 536 17 HOH HOH A . D 4 HOH 37 537 43 HOH HOH A . D 4 HOH 38 538 212 HOH HOH A . D 4 HOH 39 539 19 HOH HOH A . D 4 HOH 40 540 158 HOH HOH A . D 4 HOH 41 541 40 HOH HOH A . D 4 HOH 42 542 150 HOH HOH A . D 4 HOH 43 543 26 HOH HOH A . D 4 HOH 44 544 118 HOH HOH A . D 4 HOH 45 545 94 HOH HOH A . D 4 HOH 46 546 36 HOH HOH A . D 4 HOH 47 547 30 HOH HOH A . D 4 HOH 48 548 62 HOH HOH A . D 4 HOH 49 549 4 HOH HOH A . D 4 HOH 50 550 25 HOH HOH A . D 4 HOH 51 551 42 HOH HOH A . D 4 HOH 52 552 154 HOH HOH A . D 4 HOH 53 553 1 HOH HOH A . D 4 HOH 54 554 232 HOH HOH A . D 4 HOH 55 555 101 HOH HOH A . D 4 HOH 56 556 261 HOH HOH A . D 4 HOH 57 557 77 HOH HOH A . D 4 HOH 58 558 37 HOH HOH A . D 4 HOH 59 559 41 HOH HOH A . D 4 HOH 60 560 152 HOH HOH A . D 4 HOH 61 561 84 HOH HOH A . D 4 HOH 62 562 45 HOH HOH A . D 4 HOH 63 563 13 HOH HOH A . D 4 HOH 64 564 47 HOH HOH A . D 4 HOH 65 565 126 HOH HOH A . D 4 HOH 66 566 55 HOH HOH A . D 4 HOH 67 567 133 HOH HOH A . D 4 HOH 68 568 125 HOH HOH A . D 4 HOH 69 569 53 HOH HOH A . D 4 HOH 70 570 121 HOH HOH A . D 4 HOH 71 571 23 HOH HOH A . D 4 HOH 72 572 31 HOH HOH A . D 4 HOH 73 573 194 HOH HOH A . D 4 HOH 74 574 69 HOH HOH A . D 4 HOH 75 575 64 HOH HOH A . D 4 HOH 76 576 210 HOH HOH A . D 4 HOH 77 577 5 HOH HOH A . D 4 HOH 78 578 117 HOH HOH A . D 4 HOH 79 579 237 HOH HOH A . D 4 HOH 80 580 81 HOH HOH A . D 4 HOH 81 581 76 HOH HOH A . D 4 HOH 82 582 111 HOH HOH A . D 4 HOH 83 583 12 HOH HOH A . D 4 HOH 84 584 32 HOH HOH A . D 4 HOH 85 585 97 HOH HOH A . D 4 HOH 86 586 33 HOH HOH A . D 4 HOH 87 587 8 HOH HOH A . D 4 HOH 88 588 10 HOH HOH A . D 4 HOH 89 589 115 HOH HOH A . D 4 HOH 90 590 9 HOH HOH A . D 4 HOH 91 591 181 HOH HOH A . D 4 HOH 92 592 7 HOH HOH A . D 4 HOH 93 593 18 HOH HOH A . D 4 HOH 94 594 54 HOH HOH A . D 4 HOH 95 595 174 HOH HOH A . D 4 HOH 96 596 14 HOH HOH A . D 4 HOH 97 597 138 HOH HOH A . D 4 HOH 98 598 95 HOH HOH A . D 4 HOH 99 599 78 HOH HOH A . D 4 HOH 100 600 218 HOH HOH A . D 4 HOH 101 601 246 HOH HOH A . D 4 HOH 102 602 136 HOH HOH A . D 4 HOH 103 603 143 HOH HOH A . D 4 HOH 104 604 183 HOH HOH A . D 4 HOH 105 605 100 HOH HOH A . D 4 HOH 106 606 80 HOH HOH A . D 4 HOH 107 607 50 HOH HOH A . D 4 HOH 108 608 107 HOH HOH A . D 4 HOH 109 609 27 HOH HOH A . D 4 HOH 110 610 137 HOH HOH A . D 4 HOH 111 611 112 HOH HOH A . D 4 HOH 112 612 16 HOH HOH A . D 4 HOH 113 613 15 HOH HOH A . D 4 HOH 114 614 215 HOH HOH A . D 4 HOH 115 615 102 HOH HOH A . D 4 HOH 116 616 99 HOH HOH A . D 4 HOH 117 617 134 HOH HOH A . D 4 HOH 118 618 199 HOH HOH A . D 4 HOH 119 619 175 HOH HOH A . D 4 HOH 120 620 230 HOH HOH A . D 4 HOH 121 621 130 HOH HOH A . D 4 HOH 122 622 250 HOH HOH A . D 4 HOH 123 623 2 HOH HOH A . D 4 HOH 124 624 178 HOH HOH A . D 4 HOH 125 625 257 HOH HOH A . D 4 HOH 126 626 110 HOH HOH A . D 4 HOH 127 627 128 HOH HOH A . D 4 HOH 128 628 140 HOH HOH A . D 4 HOH 129 629 57 HOH HOH A . D 4 HOH 130 630 155 HOH HOH A . D 4 HOH 131 631 192 HOH HOH A . D 4 HOH 132 632 198 HOH HOH A . D 4 HOH 133 633 109 HOH HOH A . D 4 HOH 134 634 123 HOH HOH A . D 4 HOH 135 635 73 HOH HOH A . D 4 HOH 136 636 91 HOH HOH A . D 4 HOH 137 637 241 HOH HOH A . D 4 HOH 138 638 214 HOH HOH A . D 4 HOH 139 639 61 HOH HOH A . D 4 HOH 140 640 46 HOH HOH A . D 4 HOH 141 641 22 HOH HOH A . D 4 HOH 142 642 186 HOH HOH A . D 4 HOH 143 643 196 HOH HOH A . D 4 HOH 144 644 20 HOH HOH A . D 4 HOH 145 645 34 HOH HOH A . D 4 HOH 146 646 243 HOH HOH A . D 4 HOH 147 647 87 HOH HOH A . D 4 HOH 148 648 82 HOH HOH A . D 4 HOH 149 649 208 HOH HOH A . D 4 HOH 150 650 92 HOH HOH A . D 4 HOH 151 651 204 HOH HOH A . D 4 HOH 152 652 35 HOH HOH A . D 4 HOH 153 653 201 HOH HOH A . D 4 HOH 154 654 151 HOH HOH A . D 4 HOH 155 655 113 HOH HOH A . D 4 HOH 156 656 129 HOH HOH A . D 4 HOH 157 657 66 HOH HOH A . D 4 HOH 158 658 244 HOH HOH A . D 4 HOH 159 659 153 HOH HOH A . D 4 HOH 160 660 205 HOH HOH A . D 4 HOH 161 661 79 HOH HOH A . D 4 HOH 162 662 51 HOH HOH A . D 4 HOH 163 663 49 HOH HOH A . D 4 HOH 164 664 224 HOH HOH A . D 4 HOH 165 665 72 HOH HOH A . D 4 HOH 166 666 93 HOH HOH A . D 4 HOH 167 667 156 HOH HOH A . D 4 HOH 168 668 96 HOH HOH A . D 4 HOH 169 669 108 HOH HOH A . D 4 HOH 170 670 226 HOH HOH A . D 4 HOH 171 671 206 HOH HOH A . D 4 HOH 172 672 85 HOH HOH A . D 4 HOH 173 673 116 HOH HOH A . D 4 HOH 174 674 122 HOH HOH A . D 4 HOH 175 675 169 HOH HOH A . D 4 HOH 176 676 114 HOH HOH A . D 4 HOH 177 677 38 HOH HOH A . D 4 HOH 178 678 242 HOH HOH A . D 4 HOH 179 679 105 HOH HOH A . D 4 HOH 180 680 52 HOH HOH A . D 4 HOH 181 681 258 HOH HOH A . D 4 HOH 182 682 249 HOH HOH A . D 4 HOH 183 683 255 HOH HOH A . D 4 HOH 184 684 48 HOH HOH A . D 4 HOH 185 685 157 HOH HOH A . D 4 HOH 186 686 124 HOH HOH A . D 4 HOH 187 687 68 HOH HOH A . D 4 HOH 188 688 28 HOH HOH A . D 4 HOH 189 689 75 HOH HOH A . D 4 HOH 190 690 160 HOH HOH A . D 4 HOH 191 691 88 HOH HOH A . D 4 HOH 192 692 163 HOH HOH A . D 4 HOH 193 693 187 HOH HOH A . D 4 HOH 194 694 63 HOH HOH A . D 4 HOH 195 695 231 HOH HOH A . D 4 HOH 196 696 67 HOH HOH A . D 4 HOH 197 697 180 HOH HOH A . D 4 HOH 198 698 233 HOH HOH A . D 4 HOH 199 699 164 HOH HOH A . D 4 HOH 200 700 56 HOH HOH A . D 4 HOH 201 701 247 HOH HOH A . D 4 HOH 202 702 177 HOH HOH A . D 4 HOH 203 703 173 HOH HOH A . D 4 HOH 204 704 131 HOH HOH A . D 4 HOH 205 705 104 HOH HOH A . D 4 HOH 206 706 217 HOH HOH A . D 4 HOH 207 707 225 HOH HOH A . D 4 HOH 208 708 254 HOH HOH A . D 4 HOH 209 709 29 HOH HOH A . D 4 HOH 210 710 245 HOH HOH A . D 4 HOH 211 711 98 HOH HOH A . D 4 HOH 212 712 213 HOH HOH A . D 4 HOH 213 713 74 HOH HOH A . D 4 HOH 214 714 234 HOH HOH A . D 4 HOH 215 715 203 HOH HOH A . D 4 HOH 216 716 253 HOH HOH A . D 4 HOH 217 717 103 HOH HOH A . D 4 HOH 218 718 71 HOH HOH A . D 4 HOH 219 719 262 HOH HOH A . D 4 HOH 220 720 238 HOH HOH A . D 4 HOH 221 721 185 HOH HOH A . D 4 HOH 222 722 252 HOH HOH A . D 4 HOH 223 723 216 HOH HOH A . D 4 HOH 224 724 221 HOH HOH A . D 4 HOH 225 725 106 HOH HOH A . D 4 HOH 226 726 191 HOH HOH A . D 4 HOH 227 727 219 HOH HOH A . D 4 HOH 228 728 235 HOH HOH A . D 4 HOH 229 729 142 HOH HOH A . D 4 HOH 230 730 86 HOH HOH A . D 4 HOH 231 731 251 HOH HOH A . D 4 HOH 232 732 65 HOH HOH A . D 4 HOH 233 733 228 HOH HOH A . D 4 HOH 234 734 193 HOH HOH A . D 4 HOH 235 735 166 HOH HOH A . D 4 HOH 236 736 207 HOH HOH A . D 4 HOH 237 737 197 HOH HOH A . D 4 HOH 238 738 260 HOH HOH A . D 4 HOH 239 739 240 HOH HOH A . D 4 HOH 240 740 190 HOH HOH A . D 4 HOH 241 741 120 HOH HOH A . D 4 HOH 242 742 145 HOH HOH A . D 4 HOH 243 743 135 HOH HOH A . D 4 HOH 244 744 139 HOH HOH A . D 4 HOH 245 745 256 HOH HOH A . D 4 HOH 246 746 132 HOH HOH A . D 4 HOH 247 747 202 HOH HOH A . D 4 HOH 248 748 90 HOH HOH A . D 4 HOH 249 749 162 HOH HOH A . D 4 HOH 250 750 227 HOH HOH A . D 4 HOH 251 751 189 HOH HOH A . D 4 HOH 252 752 229 HOH HOH A . D 4 HOH 253 753 168 HOH HOH A . D 4 HOH 254 754 179 HOH HOH A . D 4 HOH 255 755 159 HOH HOH A . D 4 HOH 256 756 171 HOH HOH A . D 4 HOH 257 757 188 HOH HOH A . D 4 HOH 258 758 170 HOH HOH A . D 4 HOH 259 759 184 HOH HOH A . D 4 HOH 260 760 259 HOH HOH A . D 4 HOH 261 761 200 HOH HOH A . D 4 HOH 262 762 172 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 130 ? 1 MORE 2 ? 1 'SSA (A^2)' 13820 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-10-10 2 'Structure model' 1 1 2019-02-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' entity # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 2 'Structure model' '_entity.formula_weight' # _phasing.method MR # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 PHENIX 1.10.1_2155 ? package 'Paul D. Adams' PDAdams@lbl.gov refinement http://www.phenix-online.org/ C++ ? 2 XSCALE . ? package 'Wolfgang Kabsch' ? 'data scaling' http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/html_doc/xscale_program.html ? ? 3 PHASER . ? program 'Randy J. Read' cimr-phaser@lists.cam.ac.uk phasing http://www-structmed.cimr.cam.ac.uk/phaser/ ? ? 4 PDB_EXTRACT 3.22 'July. 13, 2016' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 5 XDS . ? package 'Wolfgang Kabsch' ? 'data reduction' http://homes.mpimf-heidelberg.mpg.de/~kabsch/xds/html_doc/xds_program.html ? ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HZ1 A LYS 73 ? C O A HOH 501 ? ? 0.67 2 1 HZ1 A LYS 73 ? D O A HOH 501 ? ? 0.67 3 1 NZ A LYS 73 ? C O A HOH 501 ? ? 1.06 4 1 NZ A LYS 73 ? D O A HOH 501 ? ? 1.06 5 1 HZ3 A LYS 73 ? C O A HOH 501 ? ? 1.37 6 1 HZ3 A LYS 73 ? D O A HOH 501 ? ? 1.37 7 1 HZ2 A LYS 73 ? C O A HOH 501 ? ? 1.42 8 1 HZ2 A LYS 73 ? D O A HOH 501 ? ? 1.42 9 1 HZ1 A LYS 36 ? C O A HOH 503 ? ? 1.50 10 1 HZ1 A LYS 36 ? D O A HOH 503 ? ? 1.50 11 1 OE1 A GLN 262 ? A O A HOH 502 ? ? 1.78 12 1 OE1 A GLN 262 ? B O A HOH 502 ? ? 1.78 13 1 O A HOH 708 ? ? O A HOH 719 ? ? 1.88 14 1 NZ A LYS 36 ? C O A HOH 503 ? ? 1.97 15 1 NZ A LYS 36 ? D O A HOH 503 ? ? 1.97 16 1 OD2 A ASP 63 ? A O A HOH 504 ? ? 1.97 17 1 OD2 A ASP 63 ? B O A HOH 504 ? ? 1.97 18 1 OG A SER 151 ? C O A HOH 505 ? ? 1.98 19 1 OG A SER 151 ? D O A HOH 505 ? ? 1.98 20 1 O A HOH 612 ? ? O A HOH 620 ? ? 1.98 21 1 OE1 A GLN 262 ? C O A HOH 502 ? ? 1.98 22 1 OE1 A GLN 262 ? D O A HOH 502 ? ? 1.98 23 1 O A HOH 670 ? ? O A HOH 750 ? ? 1.99 24 1 O A HOH 502 ? ? O A HOH 667 ? ? 1.99 25 1 OD2 A ASP 236 ? A O A HOH 506 ? ? 2.03 26 1 OD2 A ASP 236 ? B O A HOH 506 ? ? 2.03 27 1 OE2 A GLU 207 ? A O A HOH 507 ? ? 2.06 28 1 OD1 A ASP 29 ? C O A HOH 508 ? ? 2.09 29 1 OD1 A ASP 29 ? D O A HOH 508 ? ? 2.09 30 1 O A HOH 733 ? ? O A HOH 752 ? ? 2.10 31 1 O A HOH 712 ? ? O A HOH 717 ? ? 2.15 32 1 OE1 A GLU 159 ? C O A HOH 509 ? ? 2.16 33 1 OE1 A GLU 159 ? D O A HOH 509 ? ? 2.16 34 1 O A HOH 716 ? ? O A HOH 760 ? ? 2.17 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 C A PHE 30 ? ? N A PRO 31 ? C 1.475 1.338 0.137 0.019 Y 2 1 C A PHE 30 ? ? N A PRO 31 ? D 1.475 1.338 0.137 0.019 Y 3 1 C A VAL 92 ? C N A GLY 93 ? ? 1.179 1.336 -0.157 0.023 Y 4 1 C A VAL 92 ? D N A GLY 93 ? ? 1.179 1.336 -0.157 0.023 Y 5 1 C A LYS 116 ? C N A GLY 117 ? ? 1.165 1.336 -0.171 0.023 Y 6 1 C A LYS 116 ? D N A GLY 117 ? ? 1.165 1.336 -0.171 0.023 Y 7 1 C A CYS 121 ? C N A ALA 122 ? ? 1.524 1.336 0.188 0.023 Y 8 1 C A CYS 121 ? D N A ALA 122 ? ? 1.524 1.336 0.188 0.023 Y 9 1 C A GLY 209 ? ? N A PRO 210 ? C 1.208 1.338 -0.130 0.019 Y 10 1 C A GLY 209 ? ? N A PRO 210 ? D 1.208 1.338 -0.130 0.019 Y 11 1 C A ILE 219 ? C N A GLY 220 ? ? 1.196 1.336 -0.140 0.023 Y 12 1 C A ILE 219 ? D N A GLY 220 ? ? 1.196 1.336 -0.140 0.023 Y 13 1 C A VAL 244 ? ? N A ASP 245 ? C 1.493 1.336 0.157 0.023 Y 14 1 C A VAL 244 ? ? N A ASP 245 ? D 1.493 1.336 0.157 0.023 Y # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A GLU 4 ? C C A GLU 4 ? C N A LYS 5 ? C 100.87 117.20 -16.33 2.20 Y 2 1 CA A GLU 4 ? D C A GLU 4 ? D N A LYS 5 ? D 100.87 117.20 -16.33 2.20 Y 3 1 CA A CYS 121 ? A CB A CYS 121 ? A SG A CYS 121 ? A 124.08 114.20 9.88 1.10 N 4 1 CA A CYS 121 ? B CB A CYS 121 ? B SG A CYS 121 ? B 124.08 114.20 9.88 1.10 N 5 1 O A TYR 176 ? C C A TYR 176 ? C N A THR 177 ? ? 112.12 122.70 -10.58 1.60 Y 6 1 O A TYR 176 ? D C A TYR 176 ? D N A THR 177 ? ? 112.12 122.70 -10.58 1.60 Y 7 1 CA A CYS 226 ? C CB A CYS 226 ? C SG A CYS 226 ? C 128.82 114.20 14.62 1.10 N 8 1 CA A CYS 226 ? D CB A CYS 226 ? D SG A CYS 226 ? D 128.82 114.20 14.62 1.10 N 9 1 CB A ASP 229 ? C CG A ASP 229 ? C OD1 A ASP 229 ? C 127.25 118.30 8.95 0.90 N 10 1 CB A ASP 229 ? D CG A ASP 229 ? D OD1 A ASP 229 ? D 127.25 118.30 8.95 0.90 N 11 1 N A GLY 259 ? C CA A GLY 259 ? C C A GLY 259 ? C 130.45 113.10 17.35 2.50 N 12 1 N A GLY 259 ? D CA A GLY 259 ? D C A GLY 259 ? D 130.45 113.10 17.35 2.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 3 ? C -39.21 -29.52 2 1 MET A 3 ? D -39.21 -29.52 3 1 GLU A 4 ? C -68.20 7.67 4 1 GLU A 4 ? D -68.20 7.67 5 1 LYS A 5 ? C -85.50 -92.46 6 1 LYS A 5 ? D -85.50 -92.46 7 1 LYS A 12 ? C -21.18 -66.89 8 1 LYS A 12 ? D -21.18 -66.89 9 1 ALA A 189 ? C -39.00 -71.84 10 1 ALA A 189 ? D -39.00 -71.84 11 1 CYS A 215 ? ? -132.37 -136.82 12 1 CYS A 215 ? ? -132.37 -136.82 13 1 CYS A 215 ? ? -132.37 -128.42 14 1 CYS A 215 ? ? -132.37 -128.42 15 1 ILE A 219 ? C -148.27 -30.26 16 1 ILE A 219 ? D -148.27 -30.26 17 1 ILE A 261 ? A 71.36 109.11 18 1 ILE A 261 ? B 71.36 109.11 19 1 ILE A 261 ? C 87.05 91.35 20 1 ILE A 261 ? D 87.05 91.35 21 1 PHE A 280 ? C -21.95 -40.56 22 1 PHE A 280 ? D -21.95 -40.56 23 1 ILE A 281 ? C -144.75 -51.56 24 1 ILE A 281 ? D -144.75 -51.56 # loop_ _pdbx_validate_main_chain_plane.id _pdbx_validate_main_chain_plane.PDB_model_num _pdbx_validate_main_chain_plane.auth_comp_id _pdbx_validate_main_chain_plane.auth_asym_id _pdbx_validate_main_chain_plane.auth_seq_id _pdbx_validate_main_chain_plane.PDB_ins_code _pdbx_validate_main_chain_plane.label_alt_id _pdbx_validate_main_chain_plane.improper_torsion_angle 1 1 GLU A 4 ? C 15.23 2 1 GLU A 4 ? D 15.23 # loop_ _pdbx_validate_polymer_linkage.id _pdbx_validate_polymer_linkage.PDB_model_num _pdbx_validate_polymer_linkage.auth_atom_id_1 _pdbx_validate_polymer_linkage.auth_asym_id_1 _pdbx_validate_polymer_linkage.auth_comp_id_1 _pdbx_validate_polymer_linkage.auth_seq_id_1 _pdbx_validate_polymer_linkage.PDB_ins_code_1 _pdbx_validate_polymer_linkage.label_alt_id_1 _pdbx_validate_polymer_linkage.auth_atom_id_2 _pdbx_validate_polymer_linkage.auth_asym_id_2 _pdbx_validate_polymer_linkage.auth_comp_id_2 _pdbx_validate_polymer_linkage.auth_seq_id_2 _pdbx_validate_polymer_linkage.PDB_ins_code_2 _pdbx_validate_polymer_linkage.label_alt_id_2 _pdbx_validate_polymer_linkage.dist 1 1 C A VAL 92 ? C N A GLY 93 ? ? 1.18 2 1 C A VAL 92 ? D N A GLY 93 ? ? 1.18 3 1 C A LYS 116 ? C N A GLY 117 ? ? 1.16 4 1 C A LYS 116 ? D N A GLY 117 ? ? 1.16 5 1 C A ILE 219 ? C N A GLY 220 ? ? 1.20 6 1 C A ILE 219 ? D N A GLY 220 ? ? 1.20 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 283 ? A GLY 283 2 1 Y 1 A ASP 284 ? A ASP 284 3 1 Y 1 A SER 285 ? A SER 285 4 1 Y 1 A SER 286 ? A SER 286 5 1 Y 1 A VAL 287 ? A VAL 287 6 1 Y 1 A GLN 288 ? A GLN 288 7 1 Y 1 A ASP 289 ? A ASP 289 8 1 Y 1 A GLN 290 ? A GLN 290 9 1 Y 1 A TRP 291 ? A TRP 291 10 1 Y 1 A LYS 292 ? A LYS 292 11 1 Y 1 A GLU 293 ? A GLU 293 12 1 Y 1 A LEU 294 ? A LEU 294 13 1 Y 1 A SER 295 ? A SER 295 14 1 Y 1 A HIS 296 ? A HIS 296 15 1 Y 1 A GLU 297 ? A GLU 297 16 1 Y 1 A ASP 298 ? A ASP 298 17 1 Y 1 A LEU 299 ? A LEU 299 18 1 Y 1 A GLU 300 ? A GLU 300 19 1 Y 1 A PRO 301 ? A PRO 301 20 1 Y 1 A PRO 302 ? A PRO 302 21 1 Y 1 A PRO 303 ? A PRO 303 22 1 Y 1 A GLU 304 ? A GLU 304 23 1 Y 1 A HIS 305 ? A HIS 305 24 1 Y 1 A ILE 306 ? A ILE 306 25 1 Y 1 A PRO 307 ? A PRO 307 26 1 Y 1 A PRO 308 ? A PRO 308 27 1 Y 1 A PRO 309 ? A PRO 309 28 1 Y 1 A PRO 310 ? A PRO 310 29 1 Y 1 A ARG 311 ? A ARG 311 30 1 Y 1 A PRO 312 ? A PRO 312 31 1 Y 1 A PRO 313 ? A PRO 313 32 1 Y 1 A LYS 314 ? A LYS 314 33 1 Y 1 A ARG 315 ? A ARG 315 34 1 Y 1 A ILE 316 ? A ILE 316 35 1 Y 1 A LEU 317 ? A LEU 317 36 1 Y 1 A GLU 318 ? A GLU 318 37 1 Y 1 A PRO 319 ? A PRO 319 38 1 Y 1 A HIS 320 ? A HIS 320 39 1 Y 1 A ASN 321 ? A ASN 321 # _pdbx_deposit_group.group_id G_1002043 _pdbx_deposit_group.group_description 'PTP1B screened against fragment libraries by X-ray crystallography at the XChem facility of Diamond Light Source beamline I04-1' _pdbx_deposit_group.group_title 'PanDDA analysis group deposition of models with modelled events (e.g. bound ligands)' _pdbx_deposit_group.group_type 'changed state' # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '[(3S,4R)-4-(4-fluorophenyl)-1-methylpiperidin-3-yl]methanol' JLD 3 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL TRS 4 water HOH #