data_5QHS # _entry.id 5QHS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.303 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5QHS WWPDB D_1001401965 # _pdbx_database_status.entry_id 5QHS _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.recvd_initial_deposition_date 2018-05-18 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Pinkas, D.M.' 1 ? 'Bufton, J.C.' 2 ? 'Fox, A.E.' 3 ? 'Talon, R.' 4 ? 'Krojer, T.' 5 ? 'Douangamath, A.' 6 ? 'Collins, P.' 7 ? 'Zhang, R.' 8 ? 'von Delft, F.' 9 ? 'Bountra, C.' 10 ? 'Arrowsmith, C.H.' 11 ? 'Edwards, A.' 12 ? 'Bullock, A.N.' 13 ? # _citation.id primary _citation.title 'PanDDA analysis group deposition of models with modelled events (e.g. bound ligands)' _citation.journal_abbrev 'To Be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pinkas, D.M.' 1 ? primary 'Bufton, J.C.' 2 ? primary 'Fox, A.E.' 3 ? primary 'Talon, R.' 4 ? primary 'Krojer, T.' 5 ? primary 'Douangamath, A.' 6 ? primary 'Collins, P.' 7 ? primary 'Zhang, R.' 8 ? primary 'von Delft, F.' 9 ? primary 'Bountra, C.' 10 ? primary 'Arrowsmith, C.H.' 11 ? primary 'Edwards, A.' 12 ? primary 'Bullock, A.N.' 13 ? # _cell.entry_id 5QHS _cell.length_a 50.774 _cell.length_b 50.774 _cell.length_c 154.078 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5QHS _symmetry.Int_Tables_number 91 _symmetry.space_group_name_H-M 'P 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein FAM83B' 20783.109 1 ? ? ? ? 2 non-polymer syn 1,2-ETHANEDIOL 62.068 2 ? ? ? ? 3 non-polymer syn 1-methyl-3-oxidanyl-pyridin-2-one 125.125 1 ? ? ? ? 4 water nat water 18.015 91 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SMGGTHIDLLFHPPRAHLLTIKETIRKMIKEARKVIALVMDIFTDVDIFKEIVEASTRGVSVYILLDESNFNHFLNMTEK QGCSVQRLRNIRVRTVKGQDYLSKTGAKFHGKMEQKFLLVDCQKVMYGSYSYMWSFEKAHLSMVQIITGQLVESFDEEFR TLYARSCVPSSFAQEESARV ; _entity_poly.pdbx_seq_one_letter_code_can ;SMGGTHIDLLFHPPRAHLLTIKETIRKMIKEARKVIALVMDIFTDVDIFKEIVEASTRGVSVYILLDESNFNHFLNMTEK QGCSVQRLRNIRVRTVKGQDYLSKTGAKFHGKMEQKFLLVDCQKVMYGSYSYMWSFEKAHLSMVQIITGQLVESFDEEFR TLYARSCVPSSFAQEESARV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MET n 1 3 GLY n 1 4 GLY n 1 5 THR n 1 6 HIS n 1 7 ILE n 1 8 ASP n 1 9 LEU n 1 10 LEU n 1 11 PHE n 1 12 HIS n 1 13 PRO n 1 14 PRO n 1 15 ARG n 1 16 ALA n 1 17 HIS n 1 18 LEU n 1 19 LEU n 1 20 THR n 1 21 ILE n 1 22 LYS n 1 23 GLU n 1 24 THR n 1 25 ILE n 1 26 ARG n 1 27 LYS n 1 28 MET n 1 29 ILE n 1 30 LYS n 1 31 GLU n 1 32 ALA n 1 33 ARG n 1 34 LYS n 1 35 VAL n 1 36 ILE n 1 37 ALA n 1 38 LEU n 1 39 VAL n 1 40 MET n 1 41 ASP n 1 42 ILE n 1 43 PHE n 1 44 THR n 1 45 ASP n 1 46 VAL n 1 47 ASP n 1 48 ILE n 1 49 PHE n 1 50 LYS n 1 51 GLU n 1 52 ILE n 1 53 VAL n 1 54 GLU n 1 55 ALA n 1 56 SER n 1 57 THR n 1 58 ARG n 1 59 GLY n 1 60 VAL n 1 61 SER n 1 62 VAL n 1 63 TYR n 1 64 ILE n 1 65 LEU n 1 66 LEU n 1 67 ASP n 1 68 GLU n 1 69 SER n 1 70 ASN n 1 71 PHE n 1 72 ASN n 1 73 HIS n 1 74 PHE n 1 75 LEU n 1 76 ASN n 1 77 MET n 1 78 THR n 1 79 GLU n 1 80 LYS n 1 81 GLN n 1 82 GLY n 1 83 CYS n 1 84 SER n 1 85 VAL n 1 86 GLN n 1 87 ARG n 1 88 LEU n 1 89 ARG n 1 90 ASN n 1 91 ILE n 1 92 ARG n 1 93 VAL n 1 94 ARG n 1 95 THR n 1 96 VAL n 1 97 LYS n 1 98 GLY n 1 99 GLN n 1 100 ASP n 1 101 TYR n 1 102 LEU n 1 103 SER n 1 104 LYS n 1 105 THR n 1 106 GLY n 1 107 ALA n 1 108 LYS n 1 109 PHE n 1 110 HIS n 1 111 GLY n 1 112 LYS n 1 113 MET n 1 114 GLU n 1 115 GLN n 1 116 LYS n 1 117 PHE n 1 118 LEU n 1 119 LEU n 1 120 VAL n 1 121 ASP n 1 122 CYS n 1 123 GLN n 1 124 LYS n 1 125 VAL n 1 126 MET n 1 127 TYR n 1 128 GLY n 1 129 SER n 1 130 TYR n 1 131 SER n 1 132 TYR n 1 133 MET n 1 134 TRP n 1 135 SER n 1 136 PHE n 1 137 GLU n 1 138 LYS n 1 139 ALA n 1 140 HIS n 1 141 LEU n 1 142 SER n 1 143 MET n 1 144 VAL n 1 145 GLN n 1 146 ILE n 1 147 ILE n 1 148 THR n 1 149 GLY n 1 150 GLN n 1 151 LEU n 1 152 VAL n 1 153 GLU n 1 154 SER n 1 155 PHE n 1 156 ASP n 1 157 GLU n 1 158 GLU n 1 159 PHE n 1 160 ARG n 1 161 THR n 1 162 LEU n 1 163 TYR n 1 164 ALA n 1 165 ARG n 1 166 SER n 1 167 CYS n 1 168 VAL n 1 169 PRO n 1 170 SER n 1 171 SER n 1 172 PHE n 1 173 ALA n 1 174 GLN n 1 175 GLU n 1 176 GLU n 1 177 SER n 1 178 ALA n 1 179 ARG n 1 180 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 180 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'FAM83B, C6orf143' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FA83B_HUMAN _struct_ref.pdbx_db_accession Q5T0W9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GGTHIDLLFHPPRAHLLTIKETIRKMIKEARKVIALVMDIFTDVDIFKEIVEASTRGVSVYILLDESNFNHFLNMTEKQG CSVQRLRNIRVRTVKGQDYLSKTGAKFHGKMEQKFLLVDCQKVMYGSYSYMWSFEKAHLSMVQIITGQLVESFDEEFRTL YARSCVPSSFAQEESARV ; _struct_ref.pdbx_align_begin 117 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5QHS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 180 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5T0W9 _struct_ref_seq.db_align_beg 117 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 294 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 180 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5QHS SER A 1 ? UNP Q5T0W9 ? ? 'expression tag' 1 1 1 5QHS MET A 2 ? UNP Q5T0W9 ? ? 'expression tag' 2 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GQV non-polymer . 1-methyl-3-oxidanyl-pyridin-2-one ? 'C6 H7 N O2' 125.125 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 5QHS _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.pdbx_mosaicity 0.000 _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.density_Matthews 2.39 _exptl_crystal.density_diffrn ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_percent_sol 48.51 _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.temp 293 _exptl_crystal_grow.pdbx_details '27.3% Tacsimate pH 7.0, 0.15 M NaCl' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.crystal_id 1 _diffrn.ambient_temp_details ? # _diffrn_detector.detector PIXEL _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.pdbx_collection_date 2017-08-03 _diffrn_detector.diffrn_id 1 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_monochromatic_or_laue_m_l ? _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97625 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'DIAMOND BEAMLINE I04-1' _diffrn_source.pdbx_wavelength_list 0.97625 _diffrn_source.pdbx_synchrotron_site Diamond _diffrn_source.pdbx_synchrotron_beamline I04-1 _diffrn_source.pdbx_wavelength ? # _reflns.entry_id 5QHS _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 51.410 _reflns.d_resolution_high 1.950 _reflns.number_obs 15563 _reflns.number_all ? _reflns.percent_possible_obs 100.000 _reflns.pdbx_Rmerge_I_obs 0.111 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 14.000 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 12.100 _reflns.pdbx_Rrim_I_all 0.116 _reflns.pdbx_Rpim_I_all 0.033 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_number_measured_all 188277 _reflns.pdbx_scaling_rejects 82 _reflns.pdbx_chi_squared ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.details ? # loop_ _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_ordinal _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.pdbx_rejects _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.meanI_over_sigI_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_CC_half 1 1 1.950 2.000 ? 12881 ? ? 1.169 ? ? ? 11.600 ? 2.300 ? 1106 ? ? ? ? 100.000 1.223 0.356 0.509 1 2 8.720 51.410 ? 2093 ? ? 0.030 ? ? ? 8.800 ? 43.500 ? 238 ? ? ? ? 99.900 0.032 0.010 0.999 # _refine.entry_id 5QHS _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_d_res_high 1.9500 _refine.ls_d_res_low 50.7700 _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 97.4400 _refine.ls_number_reflns_obs 14351 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.ls_matrix_type ? _refine.pdbx_R_Free_selection_details RANDOM _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2056 _refine.ls_R_factor_R_work 0.2030 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2537 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 5.3000 _refine.ls_number_reflns_R_free 810 _refine.ls_number_reflns_R_work ? _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 34.5510 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] 0.6100 _refine.aniso_B[2][2] 0.6100 _refine.aniso_B[3][3] -1.2300 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][3] -0.0000 _refine.correlation_coeff_Fo_to_Fc 0.9570 _refine.correlation_coeff_Fo_to_Fc_free 0.9270 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R 0.1670 _refine.pdbx_overall_ESU_R_Free 0.1610 _refine.overall_SU_ML 0.1210 _refine.overall_SU_B 4.4860 _refine.solvent_model_details MASK _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model 5LZK _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 94.320 _refine.B_iso_min 7.230 _refine.pdbx_overall_phase_error ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_R_factor_R_free_error_details ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.9500 _refine_hist.d_res_low 50.7700 _refine_hist.pdbx_number_atoms_ligand 17 _refine_hist.number_atoms_solvent 92 _refine_hist.number_atoms_total 1440 _refine_hist.pdbx_number_residues_total 164 _refine_hist.pdbx_B_iso_mean_ligand 45.63 _refine_hist.pdbx_B_iso_mean_solvent 44.43 _refine_hist.pdbx_number_atoms_protein 1331 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' r_bond_refined_d 1382 0.018 0.019 ? ? 'X-RAY DIFFRACTION' r_bond_other_d 1306 0.002 0.020 ? ? 'X-RAY DIFFRACTION' r_angle_refined_deg 1854 1.828 1.953 ? ? 'X-RAY DIFFRACTION' r_angle_other_deg 3018 0.993 3.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 164 6.874 5.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 64 42.441 23.438 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 256 14.958 15.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 9 16.124 15.000 ? ? 'X-RAY DIFFRACTION' r_chiral_restr 206 0.113 0.200 ? ? 'X-RAY DIFFRACTION' r_gen_planes_refined 1532 0.009 0.020 ? ? 'X-RAY DIFFRACTION' r_gen_planes_other 298 0.002 0.020 ? ? 'X-RAY DIFFRACTION' r_mcbond_it 660 2.964 3.149 ? ? 'X-RAY DIFFRACTION' r_mcbond_other 661 2.962 3.150 ? ? 'X-RAY DIFFRACTION' r_mcangle_it 822 4.158 4.683 ? ? # _refine_ls_shell.d_res_high 1.9480 _refine_ls_shell.d_res_low 1.9990 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 91.8600 _refine_ls_shell.number_reflns_R_work 946 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.3530 _refine_ls_shell.R_factor_R_free 0.3800 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 69 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 1015 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_obs ? # _struct.entry_id 5QHS _struct.title ;PanDDA analysis group deposition of models with modelled events (e.g. bound ligands) -- Crystal Structure of human FAM83B in complex with FF000014a ; _struct.pdbx_descriptor 'Protein FAM83B' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 5QHS _struct_keywords.text 'PanDDA, SGC - Diamond I04-1 fragment screening, DUF1669 domain, XChemExplorer, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 20 ? GLU A 31 ? THR A 20 GLU A 31 1 ? 12 HELX_P HELX_P2 AA2 ASP A 45 ? ARG A 58 ? ASP A 45 ARG A 58 1 ? 14 HELX_P HELX_P3 AA3 ASN A 70 ? GLN A 81 ? ASN A 70 GLN A 81 1 ? 12 HELX_P HELX_P4 AA4 SER A 84 ? LEU A 88 ? SER A 84 LEU A 88 5 ? 5 HELX_P HELX_P5 AA5 MET A 133 ? ALA A 139 ? MET A 133 ALA A 139 1 ? 7 HELX_P HELX_P6 AA6 GLN A 150 ? ARG A 165 ? GLN A 150 ARG A 165 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 167 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 167 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 167 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 167 _struct_conn.ptnr2_symmetry 5_556 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.067 _struct_conn.pdbx_value_order ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id HIS _struct_mon_prot_cis.label_seq_id 12 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id HIS _struct_mon_prot_cis.auth_seq_id 12 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 13 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 13 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -3.36 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? parallel AA1 6 7 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 5 ? HIS A 12 ? THR A 5 HIS A 12 AA1 2 SER A 142 ? GLY A 149 ? SER A 142 GLY A 149 AA1 3 LYS A 124 ? GLY A 128 ? LYS A 124 GLY A 128 AA1 4 PHE A 117 ? VAL A 120 ? PHE A 117 VAL A 120 AA1 5 VAL A 35 ? MET A 40 ? VAL A 35 MET A 40 AA1 6 SER A 61 ? ASP A 67 ? SER A 61 ASP A 67 AA1 7 ILE A 91 ? VAL A 96 ? ILE A 91 VAL A 96 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N HIS A 6 ? N HIS A 6 O THR A 148 ? O THR A 148 AA1 2 3 O ILE A 147 ? O ILE A 147 N VAL A 125 ? N VAL A 125 AA1 3 4 O LYS A 124 ? O LYS A 124 N VAL A 120 ? N VAL A 120 AA1 4 5 O LEU A 119 ? O LEU A 119 N ALA A 37 ? N ALA A 37 AA1 5 6 N LEU A 38 ? N LEU A 38 O LEU A 65 ? O LEU A 65 AA1 6 7 N ILE A 64 ? N ILE A 64 O ARG A 92 ? O ARG A 92 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A EDO 201 ? 3 'binding site for residue EDO A 201' AC2 Software A EDO 202 ? 4 'binding site for residue EDO A 202' AC3 Software A GQV 203 ? 14 'binding site for residue GQV A 203' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 ILE A 7 ? ILE A 7 . ? 1_555 ? 2 AC1 3 ASP A 8 ? ASP A 8 . ? 1_555 ? 3 AC1 3 LEU A 9 ? LEU A 9 . ? 1_555 ? 4 AC2 4 LYS A 27 ? LYS A 27 . ? 1_555 ? 5 AC2 4 LYS A 124 ? LYS A 124 . ? 1_555 ? 6 AC2 4 HOH E . ? HOH A 313 . ? 1_555 ? 7 AC2 4 HOH E . ? HOH A 331 . ? 1_555 ? 8 AC3 14 LYS A 116 ? LYS A 116 . ? 7_465 ? 9 AC3 14 LYS A 116 ? LYS A 116 . ? 1_555 ? 10 AC3 14 TYR A 127 ? TYR A 127 . ? 1_555 ? 11 AC3 14 TYR A 127 ? TYR A 127 . ? 7_465 ? 12 AC3 14 GLY A 128 ? GLY A 128 . ? 1_555 ? 13 AC3 14 GLY A 128 ? GLY A 128 . ? 7_465 ? 14 AC3 14 SER A 129 ? SER A 129 . ? 1_555 ? 15 AC3 14 SER A 129 ? SER A 129 . ? 7_465 ? 16 AC3 14 HOH E . ? HOH A 334 . ? 1_555 ? 17 AC3 14 HOH E . ? HOH A 334 . ? 7_465 ? 18 AC3 14 HOH E . ? HOH A 348 . ? 7_465 ? 19 AC3 14 HOH E . ? HOH A 348 . ? 1_555 ? 20 AC3 14 HOH E . ? HOH A 378 . ? 7_465 ? 21 AC3 14 HOH E . ? HOH A 378 . ? 1_555 ? # _atom_sites.entry_id 5QHS _atom_sites.fract_transf_matrix[1][1] 0.019695 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019695 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006490 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 ? ? ? A . n A 1 2 MET 2 2 ? ? ? A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 HIS 12 12 12 HIS HIS A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 MET 28 28 28 MET MET A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 MET 40 40 40 MET MET A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 TYR 63 63 63 TYR TYR A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 MET 77 77 77 MET MET A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 CYS 83 83 83 CYS CYS A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 TYR 101 101 101 TYR TYR A . n A 1 102 LEU 102 102 ? ? ? A . n A 1 103 SER 103 103 ? ? ? A . n A 1 104 LYS 104 104 ? ? ? A . n A 1 105 THR 105 105 ? ? ? A . n A 1 106 GLY 106 106 ? ? ? A . n A 1 107 ALA 107 107 ? ? ? A . n A 1 108 LYS 108 108 ? ? ? A . n A 1 109 PHE 109 109 109 PHE PHE A . n A 1 110 HIS 110 110 110 HIS HIS A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 MET 113 113 113 MET MET A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 GLN 115 115 115 GLN GLN A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 PHE 117 117 117 PHE PHE A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 CYS 122 122 122 CYS CYS A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 MET 126 126 126 MET MET A . n A 1 127 TYR 127 127 127 TYR TYR A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 TYR 130 130 130 TYR TYR A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 TYR 132 132 132 TYR TYR A . n A 1 133 MET 133 133 133 MET MET A . n A 1 134 TRP 134 134 134 TRP TRP A . n A 1 135 SER 135 135 135 SER SER A . n A 1 136 PHE 136 136 136 PHE PHE A . n A 1 137 GLU 137 137 137 GLU GLU A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 HIS 140 140 140 HIS HIS A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 SER 142 142 142 SER SER A . n A 1 143 MET 143 143 143 MET MET A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 GLN 145 145 145 GLN GLN A . n A 1 146 ILE 146 146 146 ILE ILE A . n A 1 147 ILE 147 147 147 ILE ILE A . n A 1 148 THR 148 148 148 THR THR A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 GLN 150 150 150 GLN GLN A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 GLU 153 153 153 GLU GLU A . n A 1 154 SER 154 154 154 SER SER A . n A 1 155 PHE 155 155 155 PHE PHE A . n A 1 156 ASP 156 156 156 ASP ASP A . n A 1 157 GLU 157 157 157 GLU GLU A . n A 1 158 GLU 158 158 158 GLU GLU A . n A 1 159 PHE 159 159 159 PHE PHE A . n A 1 160 ARG 160 160 160 ARG ARG A . n A 1 161 THR 161 161 161 THR THR A . n A 1 162 LEU 162 162 162 LEU LEU A . n A 1 163 TYR 163 163 163 TYR TYR A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 ARG 165 165 165 ARG ARG A . n A 1 166 SER 166 166 166 SER SER A . n A 1 167 CYS 167 167 167 CYS CYS A . n A 1 168 VAL 168 168 168 VAL VAL A . n A 1 169 PRO 169 169 169 PRO PRO A . n A 1 170 SER 170 170 170 SER SER A . n A 1 171 SER 171 171 171 SER SER A . n A 1 172 PHE 172 172 172 PHE PHE A . n A 1 173 ALA 173 173 173 ALA ALA A . n A 1 174 GLN 174 174 ? ? ? A . n A 1 175 GLU 175 175 ? ? ? A . n A 1 176 GLU 176 176 ? ? ? A . n A 1 177 SER 177 177 ? ? ? A . n A 1 178 ALA 178 178 ? ? ? A . n A 1 179 ARG 179 179 ? ? ? A . n A 1 180 VAL 180 180 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EDO 1 201 1 EDO EDO A . C 2 EDO 1 202 2 EDO EDO A . D 3 GQV 1 203 1 GQV LIG A . E 4 HOH 1 301 56 HOH HOH A . E 4 HOH 2 302 83 HOH HOH A . E 4 HOH 3 303 86 HOH HOH A . E 4 HOH 4 304 12 HOH HOH A . E 4 HOH 5 305 79 HOH HOH A . E 4 HOH 6 306 96 HOH HOH A . E 4 HOH 7 307 30 HOH HOH A . E 4 HOH 8 308 19 HOH HOH A . E 4 HOH 9 309 21 HOH HOH A . E 4 HOH 10 310 87 HOH HOH A . E 4 HOH 11 311 42 HOH HOH A . E 4 HOH 12 312 13 HOH HOH A . E 4 HOH 13 313 49 HOH HOH A . E 4 HOH 14 314 88 HOH HOH A . E 4 HOH 15 315 64 HOH HOH A . E 4 HOH 16 316 2 HOH HOH A . E 4 HOH 17 317 46 HOH HOH A . E 4 HOH 18 318 55 HOH HOH A . E 4 HOH 19 319 34 HOH HOH A . E 4 HOH 20 320 37 HOH HOH A . E 4 HOH 21 321 94 HOH HOH A . E 4 HOH 22 322 1 HOH HOH A . E 4 HOH 23 323 61 HOH HOH A . E 4 HOH 24 324 17 HOH HOH A . E 4 HOH 25 325 51 HOH HOH A . E 4 HOH 26 326 68 HOH HOH A . E 4 HOH 27 327 10 HOH HOH A . E 4 HOH 28 328 66 HOH HOH A . E 4 HOH 29 329 26 HOH HOH A . E 4 HOH 30 330 22 HOH HOH A . E 4 HOH 31 331 48 HOH HOH A . E 4 HOH 32 332 36 HOH HOH A . E 4 HOH 33 333 39 HOH HOH A . E 4 HOH 34 334 97 HOH HOH A . E 4 HOH 35 335 3 HOH HOH A . E 4 HOH 36 336 4 HOH HOH A . E 4 HOH 37 337 23 HOH HOH A . E 4 HOH 38 338 44 HOH HOH A . E 4 HOH 39 339 6 HOH HOH A . E 4 HOH 40 340 29 HOH HOH A . E 4 HOH 41 341 7 HOH HOH A . E 4 HOH 42 342 58 HOH HOH A . E 4 HOH 43 343 53 HOH HOH A . E 4 HOH 44 344 67 HOH HOH A . E 4 HOH 45 345 28 HOH HOH A . E 4 HOH 46 346 91 HOH HOH A . E 4 HOH 47 347 95 HOH HOH A . E 4 HOH 48 348 25 HOH HOH A . E 4 HOH 49 349 9 HOH HOH A . E 4 HOH 50 350 82 HOH HOH A . E 4 HOH 51 351 8 HOH HOH A . E 4 HOH 52 352 70 HOH HOH A . E 4 HOH 53 353 93 HOH HOH A . E 4 HOH 54 354 40 HOH HOH A . E 4 HOH 55 355 59 HOH HOH A . E 4 HOH 56 356 11 HOH HOH A . E 4 HOH 57 357 31 HOH HOH A . E 4 HOH 58 358 45 HOH HOH A . E 4 HOH 59 359 77 HOH HOH A . E 4 HOH 60 360 5 HOH HOH A . E 4 HOH 61 361 84 HOH HOH A . E 4 HOH 62 362 15 HOH HOH A . E 4 HOH 63 363 81 HOH HOH A . E 4 HOH 64 364 62 HOH HOH A . E 4 HOH 65 365 73 HOH HOH A . E 4 HOH 66 366 63 HOH HOH A . E 4 HOH 67 367 24 HOH HOH A . E 4 HOH 68 368 72 HOH HOH A . E 4 HOH 69 369 20 HOH HOH A . E 4 HOH 70 370 33 HOH HOH A . E 4 HOH 71 371 90 HOH HOH A . E 4 HOH 72 372 16 HOH HOH A . E 4 HOH 73 373 41 HOH HOH A . E 4 HOH 74 374 14 HOH HOH A . E 4 HOH 75 375 50 HOH HOH A . E 4 HOH 76 376 80 HOH HOH A . E 4 HOH 77 377 18 HOH HOH A . E 4 HOH 78 378 74 HOH HOH A . E 4 HOH 79 379 60 HOH HOH A . E 4 HOH 80 380 78 HOH HOH A . E 4 HOH 81 381 71 HOH HOH A . E 4 HOH 82 382 65 HOH HOH A . E 4 HOH 83 383 35 HOH HOH A . E 4 HOH 84 384 38 HOH HOH A . E 4 HOH 85 385 32 HOH HOH A . E 4 HOH 86 386 52 HOH HOH A . E 4 HOH 87 387 89 HOH HOH A . E 4 HOH 88 388 69 HOH HOH A . E 4 HOH 89 389 85 HOH HOH A . E 4 HOH 90 390 92 HOH HOH A . E 4 HOH 91 391 76 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3860 ? 1 MORE -5 ? 1 'SSA (A^2)' 14870 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_465 y-1,x+1,-z+3/4 0.0000000000 1.0000000000 0.0000000000 -50.7740000000 1.0000000000 0.0000000000 0.0000000000 50.7740000000 0.0000000000 0.0000000000 -1.0000000000 115.5585000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2018-12-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _phasing.method MR # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 REFMAC 5.8.0189 ? program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 2 Aimless 0.5.32 29/03/17 program 'Phil Evans' ? 'data scaling' http://www.mrc-lmb.cam.ac.uk/harry/pre/aimless.html ? ? 3 PDB_EXTRACT 3.23 'SEP. 23, 2016' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 4 XDS . ? program ? ? 'data reduction' ? ? ? 5 REFMAC . ? program ? ? phasing ? ? ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 352 ? ? O A HOH 388 ? ? 2.08 2 1 O A HOH 365 ? ? O A HOH 373 ? ? 2.16 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 NH2 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 ARG _pdbx_validate_symm_contact.auth_seq_id_1 15 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OE1 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 GLU _pdbx_validate_symm_contact.auth_seq_id_2 158 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 7_465 _pdbx_validate_symm_contact.dist 2.17 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 15 ? ? CZ A ARG 15 ? ? NH1 A ARG 15 ? ? 123.84 120.30 3.54 0.50 N 2 1 NE A ARG 15 ? ? CZ A ARG 15 ? ? NH2 A ARG 15 ? ? 117.04 120.30 -3.26 0.50 N 3 1 CB A ASP 41 ? ? CG A ASP 41 ? ? OD1 A ASP 41 ? ? 123.88 118.30 5.58 0.90 N 4 1 NE A ARG 165 ? ? CZ A ARG 165 ? ? NH2 A ARG 165 ? ? 116.52 120.30 -3.78 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 34 ? ? -132.87 -55.10 2 1 CYS A 83 ? ? -159.75 60.53 3 1 GLN A 123 ? ? -132.13 -37.92 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 89 ? CG ? A ARG 89 CG 2 1 Y 1 A ARG 89 ? CD ? A ARG 89 CD 3 1 Y 1 A ARG 89 ? NE ? A ARG 89 NE 4 1 Y 1 A ARG 89 ? CZ ? A ARG 89 CZ 5 1 Y 1 A ARG 89 ? NH1 ? A ARG 89 NH1 6 1 Y 1 A ARG 89 ? NH2 ? A ARG 89 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 1 ? A SER 1 2 1 Y 1 A MET 2 ? A MET 2 3 1 Y 1 A LEU 102 ? A LEU 102 4 1 Y 1 A SER 103 ? A SER 103 5 1 Y 1 A LYS 104 ? A LYS 104 6 1 Y 1 A THR 105 ? A THR 105 7 1 Y 1 A GLY 106 ? A GLY 106 8 1 Y 1 A ALA 107 ? A ALA 107 9 1 Y 1 A LYS 108 ? A LYS 108 10 1 Y 1 A GLN 174 ? A GLN 174 11 1 Y 1 A GLU 175 ? A GLU 175 12 1 Y 1 A GLU 176 ? A GLU 176 13 1 Y 1 A SER 177 ? A SER 177 14 1 Y 1 A ALA 178 ? A ALA 178 15 1 Y 1 A ARG 179 ? A ARG 179 16 1 Y 1 A VAL 180 ? A VAL 180 # _pdbx_deposit_group.group_id G_1002046 _pdbx_deposit_group.group_description ;Human FAM83B DUF1669 domain screened against DSPL and OxXChem Libraries by X-ray Crystallography at the XChem facility of Diamond Light Source beamline I04-1 ; _pdbx_deposit_group.group_title 'PanDDA analysis group deposition of models with modelled events (e.g. bound ligands)' _pdbx_deposit_group.group_type 'changed state' # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 1,2-ETHANEDIOL EDO 3 1-methyl-3-oxidanyl-pyridin-2-one GQV 4 water HOH # _pdbx_related_exp_data_set.ordinal 1 _pdbx_related_exp_data_set.data_reference . _pdbx_related_exp_data_set.metadata_reference 10.5281/zenodo.1247291 _pdbx_related_exp_data_set.data_set_type 'other data' _pdbx_related_exp_data_set.details 'Complete PanDDA analysis' #