data_5QTU # _entry.id 5QTU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.342 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5QTU WWPDB D_1001402399 # _pdbx_database_status.entry_id 5QTU _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.recvd_initial_deposition_date 2019-10-16 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _audit_author.name 'Sheriff, S.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID ? # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.unpublished_flag ? ? ? ? ? ? ? US ? ? primary J.Med.Chem. JMCMAR 0151 0022-2623 ? ? 63 ? 784 803 ;Potent, Orally Bioavailable and Efficacious Macrocyclic Inhibitors of Factor XIa. Discovery of Pyridine-Based Macrocycles Possessing Phenylazole Carboxamide P1 Groups. ; 2019 ? 10.1021/acs.jmedchem.9b01768 31833761 ? ? ? ? ? ? ? ? US ? ? 1 'J. Med. Chem.' JMCMAR 0151 1520-4804 ? ? 57 ? 955 969 'Tetrahydroquinoline derivatives as potent and selective factor XIa inhibitors.' 2014 ? 10.1021/jm401670x 24405333 ? ? ? ? ? ? ? ? US ? ? 2 'J. Med. Chem.' JMCMAR 0151 1520-4804 ? ? 57 ? 9915 9932 'Phenylimidazoles as potent and selective inhibitors of coagulation factor XIa with in vivo antithrombotic activity.' 2014 ? 10.1021/jm5010607 25405503 ? ? ? ? ? ? ? ? UK ? ? 3 'Bioorg. Med. Chem. Lett.' BMCLE8 1127 1464-3405 ? ? 25 ? 925 930 'Pyridine and pyridinone-based factor XIa inhibitors.' 2015 ? 10.1016/j.bmcl.2014.12.050 25592713 ? ? ? ? ? ? ? ? UK ? ? 4 'Bioorg. Med. Chem. Lett.' BMCLE8 1127 1464-3405 ? ? 25 ? 1635 1642 'Structure-based design of inhibitors of coagulation factor XIa with novel P1 moieties.' 2015 ? 10.1016/j.bmcl.2015.01.028 25728130 ? ? ? ? ? ? ? ? US ? ? 5 'ACS Med Chem Lett' ? ? 1948-5875 ? ? 6 ? 590 595 ;Discovery of a Potent Parenterally Administered Factor XIa Inhibitor with Hydroxyquinolin-2(1H)-one as the P2' Moiety. ; 2015 ? 10.1021/acsmedchemlett.5b00066 26005539 ? ? ? ? ? ? ? ? UK ? ? 6 'Bioorg. Med. Chem. Lett.' BMCLE8 1127 1464-3405 ? ? 26 ? 472 478 'Novel phenylalanine derived diamides as Factor XIa inhibitors.' 2016 ? 10.1016/j.bmcl.2015.11.089 26704266 ? ? ? ? ? ? ? ? UK ? ? 7 'Bioorg. Med. Chem.' BMECEP 1200 1464-3391 ? ? 24 ? 2257 2272 'Orally bioavailable pyridine and pyrimidine-based Factor XIa inhibitors: Discovery of the methyl N-phenyl carbamate P2 prime group.' 2016 ? 10.1016/j.bmc.2016.03.062 27073051 ? ? ? ? ? ? ? ? US ? ? 8 'J. Med. Chem.' JMCMAR 0151 1520-4804 ? ? 60 ? 1060 1075 'Structure-Based Design of Macrocyclic Factor XIa Inhibitors: Discovery of the Macrocyclic Amide Linker.' 2017 ? 10.1021/acs.jmedchem.6b01460 28085275 ? ? ? ? ? ? ? ? UK ? ? 9 'Bioorg. Med. Chem. Lett.' BMCLE8 1127 1464-3405 ? ? 27 ? 3833 3839 'Macrocyclic inhibitors of Factor XIa: Discovery of alkyl-substituted macrocyclic amide linkers with improved potency.' 2017 ? 10.1016/j.bmcl.2017.06.058 28687203 ? ? ? ? ? ? ? ? UK ? ? 10 'Bioorg. Med. Chem. Lett.' BMCLE8 1127 1464-3405 ? ? 27 ? 4056 4060 'Macrocyclic factor XIa inhibitors.' 2017 ? 10.1016/j.bmcl.2017.07.048 28780160 ? ? ? ? ? ? ? ? US ? ? 11 'J. Med. Chem.' JMCMAR 0151 1520-4804 ? ? 60 ? 9703 9723 'Discovery of a Parenteral Small Molecule Coagulation Factor XIa Inhibitor Clinical Candidate (BMS-962212).' 2017 ? 10.1021/acs.jmedchem.7b01171 29077405 ? ? ? ? ? ? ? ? UK ? ? 12 Bioorg.Med.Chem.Lett. BMCLE8 1127 1464-3405 ? ? 29 ? 126604 126604 ;Structure based design of macrocyclic factor XIa inhibitors: Discovery of cyclic P1 linker moieties with improved oral bioavailability. ; 2019 ? 10.1016/j.bmcl.2019.08.008 31445854 ? ? ? ? ? ? ? ? UK ? ? 13 Bioorg.Med.Chem.Lett. BMCLE8 1127 1464-3405 ? ? 30 ? 126949 126949 'Orally bioavailable amine-linked macrocyclic inhibitors of factor XIa.' 2020 ? 10.1016/j.bmcl.2020.126949 31932224 ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Corte, J.R.' 1 ? primary 'Pinto, D.J.P.' 2 ? primary 'Fang, T.' 3 ? primary 'Osuna, H.' 4 ? primary 'Yang, W.' 5 ? primary 'Wang, Y.' 6 ? primary 'Lai, A.' 7 ? primary 'Clark, C.' 8 ? primary 'Sun, J.H.' 9 ? primary 'Rampulla, R.A.' 10 ? primary 'Mathur, A.' 11 ? primary 'Kaspady, M.' 12 ? primary 'Neithnadka, P.R.' 13 ? primary 'Li, Y.X.' 14 ? primary 'Rossi, K.A.' 15 ? primary 'Myers, J.E.' 16 ? primary 'Sheriff, S.' 17 ? primary 'Lou, Z.' 18 ? primary 'Harper, T.W.' 19 ? primary 'Huang, C.S.' 20 ? primary 'Zheng, J.J.' 21 ? primary 'Bozarth, J.M.' 22 ? primary 'Wu, Y.' 23 ? primary 'Wong, P.C.' 24 ? primary 'Crain, E.' 25 ? primary 'Seiffert, D.A.' 26 ? primary 'Luettgen, J.M.' 27 ? primary 'Lam, P.' 28 ? primary 'Wexler, R.R.' 29 ? primary 'Ewing, W.R.' 30 ? 1 'Quan, M.L.' 31 ? 1 'Wong, P.C.' 32 ? 1 'Wang, C.' 33 ? 1 'Woerner, F.' 34 ? 1 'Smallheer, J.M.' 35 ? 1 'Barbera, F.A.' 36 ? 1 'Bozarth, J.M.' 37 ? 1 'Brown, R.L.' 38 ? 1 'Harpel, M.R.' 39 ? 1 'Luettgen, J.M.' 40 ? 1 'Morin, P.E.' 41 ? 1 'Peterson, T.' 42 ? 1 'Ramamurthy, V.' 43 ? 1 'Rendina, A.R.' 44 ? 1 'Rossi, K.A.' 45 ? 1 'Watson, C.A.' 46 ? 1 'Wei, A.' 47 ? 1 'Zhang, G.' 48 ? 1 'Seiffert, D.' 49 ? 1 'Wexler, R.R.' 50 ? 2 'Hangeland, J.J.' 51 ? 2 'Friends, T.J.' 52 ? 2 'Rossi, K.A.' 53 ? 2 'Smallheer, J.M.' 54 ? 2 'Wang, C.' 55 ? 2 'Sun, Z.' 56 ? 2 'Corte, J.R.' 57 0000-0002-4790-597X 2 'Fang, T.' 58 ? 2 'Wong, P.C.' 59 ? 2 'Rendina, A.R.' 60 ? 2 'Barbera, F.A.' 61 ? 2 'Bozarth, J.M.' 62 ? 2 'Luettgen, J.M.' 63 ? 2 'Watson, C.A.' 64 ? 2 'Zhang, G.' 65 ? 2 'Wei, A.' 66 ? 2 'Ramamurthy, V.' 67 ? 2 'Morin, P.E.' 68 ? 2 'Bisacchi, G.S.' 69 ? 2 'Subramaniam, S.' 70 ? 2 'Arunachalam, P.' 71 ? 2 'Mathur, A.' 72 ? 2 'Seiffert, D.A.' 73 ? 2 'Wexler, R.R.' 74 ? 2 'Quan, M.L.' 75 ? 3 'Corte, J.R.' 76 0000-0002-4790-597X 3 'Fang, T.' 77 ? 3 'Hangeland, J.J.' 78 ? 3 'Friends, T.J.' 79 ? 3 'Rendina, A.R.' 80 ? 3 'Luettgen, J.M.' 81 ? 3 'Bozarth, J.M.' 82 ? 3 'Barbera, F.A.' 83 ? 3 'Rossi, K.A.' 84 ? 3 'Wei, A.' 85 ? 3 'Ramamurthy, V.' 86 ? 3 'Morin, P.E.' 87 ? 3 'Seiffert, D.A.' 88 ? 3 'Wexler, R.R.' 89 ? 3 'Quan, M.L.' 90 ? 4 'Pinto, D.J.' 91 0000-0003-4356-5979 4 'Smallheer, J.M.' 92 ? 4 'Corte, J.R.' 93 0000-0002-4790-597X 4 'Austin, E.J.' 94 ? 4 'Wang, C.' 95 ? 4 'Fang, T.' 96 ? 4 'Smith 2nd., L.M.' 97 ? 4 'Rossi, K.A.' 98 ? 4 'Rendina, A.R.' 99 ? 4 'Bozarth, J.M.' 100 ? 4 'Zhang, G.' 101 ? 4 'Wei, A.' 102 ? 4 'Ramamurthy, V.' 103 ? 4 'Sheriff, S.' 104 0000-0001-6010-6534 4 'Myers Jr., J.E.' 105 ? 4 'Morin, P.E.' 106 ? 4 'Luettgen, J.M.' 107 ? 4 'Seiffert, D.A.' 108 ? 4 'Quan, M.L.' 109 ? 4 'Wexler, R.R.' 110 ? 5 'Hu, Z.' 111 ? 5 'Wong, P.C.' 112 ? 5 'Gilligan, P.J.' 113 ? 5 'Han, W.' 114 ? 5 'Pabbisetty, K.B.' 115 ? 5 'Bozarth, J.M.' 116 ? 5 'Crain, E.J.' 117 ? 5 'Harper, T.' 118 ? 5 'Luettgen, J.M.' 119 ? 5 'Myers Jr., J.E.' 120 ? 5 'Ramamurthy, V.' 121 ? 5 'Rossi, K.A.' 122 ? 5 'Sheriff, S.' 123 0000-0001-6010-6534 5 'Watson, C.A.' 124 ? 5 'Wei, A.' 125 ? 5 'Zheng, J.J.' 126 ? 5 'Seiffert, D.A.' 127 ? 5 'Wexler, R.R.' 128 ? 5 'Quan, M.L.' 129 ? 6 'Smith 2nd., L.M.' 130 ? 6 'Orwat, M.J.' 131 ? 6 'Hu, Z.' 132 ? 6 'Han, W.' 133 ? 6 'Wang, C.' 134 ? 6 'Rossi, K.A.' 135 ? 6 'Gilligan, P.J.' 136 ? 6 'Pabbisetty, K.B.' 137 ? 6 'Osuna, H.' 138 ? 6 'Corte, J.R.' 139 0000-0002-4790-597X 6 'Rendina, A.R.' 140 ? 6 'Luettgen, J.M.' 141 ? 6 'Wong, P.C.' 142 ? 6 'Narayanan, R.' 143 ? 6 'Harper, T.W.' 144 ? 6 'Bozarth, J.M.' 145 ? 6 'Crain, E.J.' 146 ? 6 'Wei, A.' 147 ? 6 'Ramamurthy, V.' 148 ? 6 'Morin, P.E.' 149 ? 6 'Xin, B.' 150 ? 6 'Zheng, J.' 151 ? 6 'Seiffert, D.A.' 152 ? 6 'Quan, M.L.' 153 ? 6 'Lam, P.Y.S.' 154 ? 6 'Wexler, R.R.' 155 ? 6 'Pinto, D.J.P.' 156 0000-0003-4356-5979 7 'Corte, J.R.' 157 0000-0002-4790-597X 7 'Fang, T.' 158 ? 7 'Pinto, D.J.' 159 0000-0003-4356-5979 7 'Orwat, M.J.' 160 ? 7 'Rendina, A.R.' 161 ? 7 'Luettgen, J.M.' 162 ? 7 'Rossi, K.A.' 163 ? 7 'Wei, A.' 164 ? 7 'Ramamurthy, V.' 165 ? 7 'Myers Jr., J.E.' 166 ? 7 'Sheriff, S.' 167 0000-0001-6010-6534 7 'Narayanan, R.' 168 ? 7 'Harper, T.W.' 169 ? 7 'Zheng, J.J.' 170 ? 7 'Li, Y.X.' 171 ? 7 'Seiffert, D.A.' 172 ? 7 'Wexler, R.R.' 173 ? 7 'Quan, M.L.' 174 ? 8 'Corte, J.R.' 175 0000-0002-4790-597X 8 'Fang, T.' 176 ? 8 'Osuna, H.' 177 ? 8 'Pinto, D.J.' 178 0000-0003-4356-5979 8 'Rossi, K.A.' 179 ? 8 'Myers Jr., J.E.' 180 ? 8 'Sheriff, S.' 181 0000-0001-6010-6534 8 'Lou, Z.' 182 ? 8 'Zheng, J.J.' 183 ? 8 'Harper, T.W.' 184 ? 8 'Bozarth, J.M.' 185 ? 8 'Wu, Y.' 186 ? 8 'Luettgen, J.M.' 187 ? 8 'Seiffert, D.A.' 188 ? 8 'Decicco, C.P.' 189 ? 8 'Wexler, R.R.' 190 ? 8 'Quan, M.L.' 191 ? 9 'Corte, J.R.' 192 0000-0002-4790-597X 9 'Yang, W.' 193 ? 9 'Fang, T.' 194 ? 9 'Wang, Y.' 195 ? 9 'Osuna, H.' 196 ? 9 'Lai, A.' 197 ? 9 'Ewing, W.R.' 198 ? 9 'Rossi, K.A.' 199 ? 9 'Myers Jr., J.E.' 200 ? 9 'Sheriff, S.' 201 0000-0001-6010-6534 9 'Lou, Z.' 202 ? 9 'Zheng, J.J.' 203 ? 9 'Harper, T.W.' 204 ? 9 'Bozarth, J.M.' 205 ? 9 'Wu, Y.' 206 ? 9 'Luettgen, J.M.' 207 ? 9 'Seiffert, D.A.' 208 ? 9 'Quan, M.L.' 209 ? 9 'Wexler, R.R.' 210 ? 9 'Lam, P.Y.S.' 211 ? 10 'Wang, C.' 212 ? 10 'Corte, J.R.' 213 0000-0002-4790-597X 10 'Rossi, K.A.' 214 ? 10 'Bozarth, J.M.' 215 ? 10 'Wu, Y.' 216 ? 10 'Sheriff, S.' 217 0000-0001-6010-6534 10 'Myers Jr., J.E.' 218 ? 10 'Luettgen, J.M.' 219 ? 10 'Seiffert, D.A.' 220 ? 10 'Wexler, R.R.' 221 ? 10 'Quan, M.L.' 222 ? 11 'Pinto, D.J.P.' 223 0000-0003-4356-5979 11 'Orwat, M.J.' 224 ? 11 'Smith 2nd., L.M.' 225 ? 11 'Quan, M.L.' 226 ? 11 'Lam, P.Y.S.' 227 ? 11 'Rossi, K.A.' 228 ? 11 'Apedo, A.' 229 ? 11 'Bozarth, J.M.' 230 ? 11 'Wu, Y.' 231 ? 11 'Zheng, J.J.' 232 ? 11 'Xin, B.' 233 ? 11 'Toussaint, N.' 234 ? 11 'Stetsko, P.' 235 ? 11 'Gudmundsson, O.' 236 ? 11 'Maxwell, B.' 237 0000-0001-8507-2078 11 'Crain, E.J.' 238 ? 11 'Wong, P.C.' 239 ? 11 'Lou, Z.' 240 ? 11 'Harper, T.W.' 241 ? 11 'Chacko, S.A.' 242 ? 11 'Myers Jr., J.E.' 243 ? 11 'Sheriff, S.' 244 0000-0001-6010-6534 11 'Zhang, H.' 245 ? 11 'Hou, X.' 246 0000-0001-6169-3443 11 'Mathur, A.' 247 ? 11 'Seiffert, D.A.' 248 ? 11 'Wexler, R.R.' 249 ? 11 'Luettgen, J.M.' 250 ? 11 'Ewing, W.R.' 251 ? 12 'Clark, C.G.' 252 ? 12 'Rossi, K.A.' 253 ? 12 'Corte, J.R.' 254 ? 12 'Fang, T.' 255 ? 12 'Smallheer, J.M.' 256 ? 12 'De Lucca, I.' 257 ? 12 'Nirschl, D.S.' 258 ? 12 'Orwat, M.J.' 259 ? 12 'Pinto, D.J.P.' 260 ? 12 'Hu, Z.' 261 ? 12 'Wang, Y.' 262 ? 12 'Yang, W.' 263 ? 12 'Jeon, Y.' 264 ? 12 'Ewing, W.R.' 265 ? 12 'Myers Jr., J.E.' 266 ? 12 'Sheriff, S.' 267 ? 12 'Lou, Z.' 268 ? 12 'Bozarth, J.M.' 269 ? 12 'Wu, Y.' 270 ? 12 'Rendina, A.' 271 ? 12 'Harper, T.' 272 ? 12 'Zheng, J.' 273 ? 12 'Xin, B.' 274 ? 12 'Xiang, Q.' 275 ? 12 'Luettgen, J.M.' 276 ? 12 'Seiffert, D.A.' 277 ? 12 'Wexler, R.R.' 278 ? 12 'Lam, P.Y.S.' 279 ? 13 'Fang, T.' 280 ? 13 'Corte, J.R.' 281 ? 13 'Gilligan, P.J.' 282 ? 13 'Jeon, Y.' 283 ? 13 'Osuna, H.' 284 ? 13 'Rossi, K.A.' 285 ? 13 'Myers Jr., J.E.' 286 ? 13 'Sheriff, S.' 287 ? 13 'Lou, Z.' 288 ? 13 'Zheng, J.J.' 289 ? 13 'Harper, T.W.' 290 ? 13 'Bozarth, J.M.' 291 ? 13 'Wu, Y.' 292 ? 13 'Luettgen, J.M.' 293 ? 13 'Seiffert, D.A.' 294 ? 13 'Wexler, R.R.' 295 ? 13 'Lam, P.Y.S.' 296 ? # _cell.entry_id 5QTU _cell.length_a 79.390 _cell.length_b 79.390 _cell.length_c 105.660 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5QTU _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Coagulation factor XI' 27600.342 1 3.4.21.27 ? 'COAGULATION FACTOR XI, HEAVY CHAIN' ? 2 polymer man 'Coagulation factor XI' 2159.419 1 3.4.21.27 ? ? ? 3 non-polymer syn ;methyl [(3R,7S)-7-{[1-(3-chloro-2-fluorophenyl)-5-methyl-1H-imidazole-4-carbonyl]amino}-3-methyl-2-oxo-2,3,4,5,6,7-hexahydro-1H-12,8-(metheno)-1,9-benzodiazacyclotetradecin-15-yl]carbamate ; 605.059 1 ? ? ? ? 4 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 5 non-polymer syn 1,2-ETHANEDIOL 62.068 9 ? ? ? ? 6 water nat water 18.015 103 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'FXI,Plasma thromboplastin antecedent,PTA' 2 'FXI,Plasma thromboplastin antecedent,PTA' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;IVGGTASVRGEWPWQVTLHTTSPTQRHLCGGSIIGNQWILTAAHCFYGVESPKILRVYSGILNQSEIKEDTSFFGVQEII IHDQYKMAESGYDIALLKLETTVGYGDSQRPICLPSKGDRNVIYTDCWVTGWGYRKLRDKIQNTLQKAKIPLVTNEECQK RYRGHKITHKMICAGYREGGKDACKGDSGGPLSCKHNEVWHLVGITSWGEGCAQRERPGVYTNVVEYVDWILEKTQAVHH HHHH ; ;IVGGTASVRGEWPWQVTLHTTSPTQRHLCGGSIIGNQWILTAAHCFYGVESPKILRVYSGILNQSEIKEDTSFFGVQEII IHDQYKMAESGYDIALLKLETTVGYGDSQRPICLPSKGDRNVIYTDCWVTGWGYRKLRDKIQNTLQKAKIPLVTNEECQK RYRGHKITHKMICAGYREGGKDACKGDSGGPLSCKHNEVWHLVGITSWGEGCAQRERPGVYTNVVEYVDWILEKTQAVHH HHHH ; A ? 2 'polypeptide(L)' no no MDDDDKMDNECTTKIKPR MDDDDKMDNECTTKIKPR H ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 VAL n 1 3 GLY n 1 4 GLY n 1 5 THR n 1 6 ALA n 1 7 SER n 1 8 VAL n 1 9 ARG n 1 10 GLY n 1 11 GLU n 1 12 TRP n 1 13 PRO n 1 14 TRP n 1 15 GLN n 1 16 VAL n 1 17 THR n 1 18 LEU n 1 19 HIS n 1 20 THR n 1 21 THR n 1 22 SER n 1 23 PRO n 1 24 THR n 1 25 GLN n 1 26 ARG n 1 27 HIS n 1 28 LEU n 1 29 CYS n 1 30 GLY n 1 31 GLY n 1 32 SER n 1 33 ILE n 1 34 ILE n 1 35 GLY n 1 36 ASN n 1 37 GLN n 1 38 TRP n 1 39 ILE n 1 40 LEU n 1 41 THR n 1 42 ALA n 1 43 ALA n 1 44 HIS n 1 45 CYS n 1 46 PHE n 1 47 TYR n 1 48 GLY n 1 49 VAL n 1 50 GLU n 1 51 SER n 1 52 PRO n 1 53 LYS n 1 54 ILE n 1 55 LEU n 1 56 ARG n 1 57 VAL n 1 58 TYR n 1 59 SER n 1 60 GLY n 1 61 ILE n 1 62 LEU n 1 63 ASN n 1 64 GLN n 1 65 SER n 1 66 GLU n 1 67 ILE n 1 68 LYS n 1 69 GLU n 1 70 ASP n 1 71 THR n 1 72 SER n 1 73 PHE n 1 74 PHE n 1 75 GLY n 1 76 VAL n 1 77 GLN n 1 78 GLU n 1 79 ILE n 1 80 ILE n 1 81 ILE n 1 82 HIS n 1 83 ASP n 1 84 GLN n 1 85 TYR n 1 86 LYS n 1 87 MET n 1 88 ALA n 1 89 GLU n 1 90 SER n 1 91 GLY n 1 92 TYR n 1 93 ASP n 1 94 ILE n 1 95 ALA n 1 96 LEU n 1 97 LEU n 1 98 LYS n 1 99 LEU n 1 100 GLU n 1 101 THR n 1 102 THR n 1 103 VAL n 1 104 GLY n 1 105 TYR n 1 106 GLY n 1 107 ASP n 1 108 SER n 1 109 GLN n 1 110 ARG n 1 111 PRO n 1 112 ILE n 1 113 CYS n 1 114 LEU n 1 115 PRO n 1 116 SER n 1 117 LYS n 1 118 GLY n 1 119 ASP n 1 120 ARG n 1 121 ASN n 1 122 VAL n 1 123 ILE n 1 124 TYR n 1 125 THR n 1 126 ASP n 1 127 CYS n 1 128 TRP n 1 129 VAL n 1 130 THR n 1 131 GLY n 1 132 TRP n 1 133 GLY n 1 134 TYR n 1 135 ARG n 1 136 LYS n 1 137 LEU n 1 138 ARG n 1 139 ASP n 1 140 LYS n 1 141 ILE n 1 142 GLN n 1 143 ASN n 1 144 THR n 1 145 LEU n 1 146 GLN n 1 147 LYS n 1 148 ALA n 1 149 LYS n 1 150 ILE n 1 151 PRO n 1 152 LEU n 1 153 VAL n 1 154 THR n 1 155 ASN n 1 156 GLU n 1 157 GLU n 1 158 CYS n 1 159 GLN n 1 160 LYS n 1 161 ARG n 1 162 TYR n 1 163 ARG n 1 164 GLY n 1 165 HIS n 1 166 LYS n 1 167 ILE n 1 168 THR n 1 169 HIS n 1 170 LYS n 1 171 MET n 1 172 ILE n 1 173 CYS n 1 174 ALA n 1 175 GLY n 1 176 TYR n 1 177 ARG n 1 178 GLU n 1 179 GLY n 1 180 GLY n 1 181 LYS n 1 182 ASP n 1 183 ALA n 1 184 CYS n 1 185 LYS n 1 186 GLY n 1 187 ASP n 1 188 SER n 1 189 GLY n 1 190 GLY n 1 191 PRO n 1 192 LEU n 1 193 SER n 1 194 CYS n 1 195 LYS n 1 196 HIS n 1 197 ASN n 1 198 GLU n 1 199 VAL n 1 200 TRP n 1 201 HIS n 1 202 LEU n 1 203 VAL n 1 204 GLY n 1 205 ILE n 1 206 THR n 1 207 SER n 1 208 TRP n 1 209 GLY n 1 210 GLU n 1 211 GLY n 1 212 CYS n 1 213 ALA n 1 214 GLN n 1 215 ARG n 1 216 GLU n 1 217 ARG n 1 218 PRO n 1 219 GLY n 1 220 VAL n 1 221 TYR n 1 222 THR n 1 223 ASN n 1 224 VAL n 1 225 VAL n 1 226 GLU n 1 227 TYR n 1 228 VAL n 1 229 ASP n 1 230 TRP n 1 231 ILE n 1 232 LEU n 1 233 GLU n 1 234 LYS n 1 235 THR n 1 236 GLN n 1 237 ALA n 1 238 VAL n 1 239 HIS n 1 240 HIS n 1 241 HIS n 1 242 HIS n 1 243 HIS n 1 244 HIS n 2 1 MET n 2 2 ASP n 2 3 ASP n 2 4 ASP n 2 5 ASP n 2 6 LYS n 2 7 MET n 2 8 ASP n 2 9 ASN n 2 10 GLU n 2 11 CYS n 2 12 THR n 2 13 THR n 2 14 LYS n 2 15 ILE n 2 16 LYS n 2 17 PRO n 2 18 ARG n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 244 Human ? F11 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? PET14B ? ? 2 1 sample 'Biological sequence' 1 18 Human ? F11 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? PET14B ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP FA11_HUMAN P03951 ? 1 ;IVGGTASVRGEWPWQVTLHTTSPTQRHLCGGSIIGNQWILTAAHCFYGVESPKILRVYSGILNQSEIKEDTSFFGVQEII IHDQYKMAESGYDIALLKLETTVNYTDSQRPICLPSKGDRNVIYTDCWVTGWGYRKLRDKIQNTLQKAKIPLVTNEECQK RYRGHKITHKMICAGYREGGKDACKGDSGGPLSCKHNEVWHLVGITSWGEGCAQRERPGVYTNVVEYVDWILEKTQAV ; 388 2 UNP FA11_HUMAN P03951 ? 2 KMDNECTTKIKPR 375 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5QTU A 1 ? 238 ? P03951 388 ? 625 ? 16 245 2 2 5QTU H 6 ? 18 ? P03951 375 ? 387 ? 357 369 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5QTU GLY A 104 ? UNP P03951 ASN 491 conflict 113 1 1 5QTU GLY A 106 ? UNP P03951 THR 493 conflict 115 2 1 5QTU HIS A 239 ? UNP P03951 ? ? 'expression tag' 246 3 1 5QTU HIS A 240 ? UNP P03951 ? ? 'expression tag' 247 4 1 5QTU HIS A 241 ? UNP P03951 ? ? 'expression tag' 248 5 1 5QTU HIS A 242 ? UNP P03951 ? ? 'expression tag' 249 6 1 5QTU HIS A 243 ? UNP P03951 ? ? 'expression tag' 250 7 1 5QTU HIS A 244 ? UNP P03951 ? ? 'expression tag' 251 8 2 5QTU MET H 1 ? UNP P03951 ? ? 'initiating methionine' 352 9 2 5QTU ASP H 2 ? UNP P03951 ? ? 'expression tag' 353 10 2 5QTU ASP H 3 ? UNP P03951 ? ? 'expression tag' 354 11 2 5QTU ASP H 4 ? UNP P03951 ? ? 'expression tag' 355 12 2 5QTU ASP H 5 ? UNP P03951 ? ? 'expression tag' 356 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 QEV non-polymer . ;methyl [(3R,7S)-7-{[1-(3-chloro-2-fluorophenyl)-5-methyl-1H-imidazole-4-carbonyl]amino}-3-methyl-2-oxo-2,3,4,5,6,7-hexahydro-1H-12,8-(metheno)-1,9-benzodiazacyclotetradecin-15-yl]carbamate ; ? 'C31 H30 Cl F N6 O4' 605.059 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 _exptl.entry_id 5QTU # _exptl_crystal.id 1 _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.density_Matthews 3.23 _exptl_crystal.density_diffrn ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_percent_sol 61.92 _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.description ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.temp 277 _exptl_crystal_grow.pdbx_details ;100 mM sodium acetate, pH 4.6, 25% (w/v) MePEG2000, 200 mM ammonium sulfate, then transferred to 100 mM Tris-HCl, pH 7.0, 25% (w/v) MePEG2000, 200 MM ammonium sulfate ; _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.crystal_id 1 _diffrn.ambient_temp_details ? _diffrn.pdbx_serial_crystal_experiment ? # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'RIGAKU SATURN 92' _diffrn_detector.pdbx_collection_date 2011-09-08 _diffrn_detector.details 'MICROMAX CONFOCAL' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54178 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU FR-E SUPERBRIGHT' _diffrn_source.pdbx_wavelength_list 1.54178 _diffrn_source.pdbx_wavelength 1.54178 _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? # _reflns.d_resolution_high 2.530 _reflns.d_resolution_low 105.660 _reflns.number_obs 11923 _reflns.pdbx_netI_over_sigmaI 23.500 _reflns.pdbx_Rsym_value 0.104 _reflns.pdbx_redundancy 10.400 _reflns.percent_possible_obs 89.700 _reflns.observed_criterion_sigma_I 0.000 _reflns.B_iso_Wilson_estimate 39.870 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 5QTU _reflns.observed_criterion_sigma_F ? _reflns.number_all ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_CC_half ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_Rrim_I_all ? # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.530 _reflns_shell.d_res_low 2.670 _reflns_shell.number_measured_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_rejects 0 _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_obs 7.500 _reflns_shell.pdbx_Rsym_value 0.368 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_redundancy 10.500 _reflns_shell.percent_possible_obs ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.percent_possible_all 80.900 _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_CC_half ? # _refine.entry_id 5QTU _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_d_res_high 2.5300 _refine.ls_d_res_low 68.7500 _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 89.0000 _refine.ls_number_reflns_obs 11860 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.ls_matrix_type ? _refine.pdbx_R_Free_selection_details RANDOM _refine.details ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1770 _refine.ls_R_factor_R_work 0.1760 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2360 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 2.5000 _refine.ls_number_reflns_R_free 297 _refine.ls_number_reflns_R_work ? _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 22.9900 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] -4.6053 _refine.aniso_B[2][2] -4.6053 _refine.aniso_B[3][3] 9.2107 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.correlation_coeff_Fo_to_Fc 0.9240 _refine.correlation_coeff_Fo_to_Fc_free 0.8760 _refine.overall_SU_R_Cruickshank_DPI 0.3610 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.2590 _refine.pdbx_overall_SU_R_Blow_DPI 0.3910 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.2630 _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.solvent_model_details ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model 4TY7 _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 107.710 _refine.B_iso_min 3.000 _refine.pdbx_overall_phase_error ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_R_factor_R_free_error_details ? # _refine_analyze.entry_id 5QTU _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_obs 0.330 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.5300 _refine_hist.d_res_low 68.7500 _refine_hist.pdbx_number_atoms_ligand 84 _refine_hist.number_atoms_solvent 103 _refine_hist.number_atoms_total 2084 _refine_hist.pdbx_number_residues_total 245 _refine_hist.pdbx_B_iso_mean_ligand 24.90 _refine_hist.pdbx_B_iso_mean_solvent 22.27 _refine_hist.pdbx_number_atoms_protein 1897 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' t_dihedral_angle_d 686 ? ? 2.000 SINUSOIDAL 'X-RAY DIFFRACTION' t_trig_c_planes 40 ? ? 2.000 HARMONIC 'X-RAY DIFFRACTION' t_gen_planes 335 ? ? 5.000 HARMONIC 'X-RAY DIFFRACTION' t_it 2055 ? ? 20.000 HARMONIC 'X-RAY DIFFRACTION' t_nbd ? ? ? ? ? 'X-RAY DIFFRACTION' t_improper_torsion ? ? ? ? ? 'X-RAY DIFFRACTION' t_pseud_angle ? ? ? ? ? 'X-RAY DIFFRACTION' t_chiral_improper_torsion 260 ? ? 5.000 SEMIHARMONIC 'X-RAY DIFFRACTION' t_sum_occupancies ? ? ? ? ? 'X-RAY DIFFRACTION' t_utility_distance ? ? ? ? ? 'X-RAY DIFFRACTION' t_utility_angle ? ? ? ? ? 'X-RAY DIFFRACTION' t_utility_torsion ? ? ? ? ? 'X-RAY DIFFRACTION' t_ideal_dist_contact 2363 ? ? 4.000 SEMIHARMONIC 'X-RAY DIFFRACTION' t_bond_d 2055 0.010 ? 2.000 HARMONIC 'X-RAY DIFFRACTION' t_angle_deg 2802 1.130 ? 2.000 HARMONIC 'X-RAY DIFFRACTION' t_omega_torsion ? 3.580 ? ? ? 'X-RAY DIFFRACTION' t_other_torsion ? 17.480 ? ? ? # _refine_ls_shell.d_res_high 2.5300 _refine_ls_shell.d_res_low 2.7700 _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.percent_reflns_obs 78.7800 _refine_ls_shell.number_reflns_R_work 2409 _refine_ls_shell.R_factor_all 0.1738 _refine_ls_shell.R_factor_R_work 0.1725 _refine_ls_shell.R_factor_R_free 0.2313 _refine_ls_shell.percent_reflns_R_free 2.1100 _refine_ls_shell.number_reflns_R_free 52 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 2461 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_obs ? # _struct.entry_id 5QTU _struct.title ;FACTOR XIA IN COMPLEX WITH THE INHIBITOR methyl [(3R,7S)-7-{[1-(3-chloro-2-fluorophenyl)-5-methyl-1H-imidazole-4-carbonyl]amino}-3-methyl-2-oxo-2,3,4,5,6,7-hexahydro-1H-12,8-(metheno)-1,9-benzodiazacyclotetradecin-15-yl]carbamate ; _struct.pdbx_descriptor 'Coagulation factor XI (E.C.3.4.21.27)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 5QTU _struct_keywords.text 'HYDROLASE, SERINE PROTEASE, BLOOD COAGULATION FACTOR, PROTEIN INHIBITOR COMPLEX, HYDROLASE-HYDROLASE inhibitor complex' _struct_keywords.pdbx_keywords 'HYDROLASE/HYDROLASE inhibitor' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 5 ? G N N 5 ? H N N 5 ? I N N 5 ? J N N 5 ? K N N 5 ? L N N 5 ? M N N 5 ? N N N 6 ? O N N 6 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 42 ? TYR A 47 B ALA A 55 TYR A 58 5 ? 6 HELX_P HELX_P2 AA2 SER A 51 ? LYS A 53 ? SER A 62 LYS A 64 5 ? 3 HELX_P HELX_P3 AA3 ASN A 63 ? ILE A 67 ? ASN A 72 ILE A 76 5 ? 5 HELX_P HELX_P4 AA4 MET A 87 ? GLY A 91 ? MET A 96 GLY A 100 5 ? 5 HELX_P HELX_P5 AA5 SER A 116 ? ASN A 121 ? SER A 125 ASN A 130 5 ? 6 HELX_P HELX_P6 AA6 THR A 154 ? TYR A 162 ? THR A 164 TYR A 171 1 ? 9 HELX_P HELX_P7 AA7 TYR A 227 ? GLN A 236 ? TYR A 234 GLN A 243 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 29 SG ? ? ? 1_555 A CYS 45 SG ? ? A CYS 42 A CYS 58 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf2 disulf ? ? A CYS 113 SG ? ? ? 1_555 B CYS 11 SG ? ? A CYS 122 H CYS 362 1_555 ? ? ? ? ? ? ? 2.039 ? ? disulf3 disulf ? ? A CYS 127 SG ? ? ? 1_555 A CYS 194 SG ? ? A CYS 136 A CYS 201 1_555 ? ? ? ? ? ? ? 2.054 ? ? disulf4 disulf ? ? A CYS 158 SG ? ? ? 1_555 A CYS 173 SG ? ? A CYS 168 A CYS 182 1_555 ? ? ? ? ? ? ? 2.028 ? ? disulf5 disulf ? ? A CYS 184 SG ? ? ? 1_555 A CYS 212 SG ? ? A CYS 191 A CYS 219 1_555 ? ? ? ? ? ? ? 2.027 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 22 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code A _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 36 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 23 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 B _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 36 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -1.36 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 8 ? AA2 ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 5 ? ALA A 6 ? THR A 20 ALA A 21 AA1 2 GLN A 146 ? LYS A 149 ? GLN A 156 LYS A 159 AA1 3 CYS A 127 ? GLY A 131 ? CYS A 136 GLY A 140 AA1 4 PRO A 191 ? HIS A 196 ? PRO A 198 HIS A 203 AA1 5 VAL A 199 ? TRP A 208 ? VAL A 206 TRP A 215 AA1 6 GLY A 219 ? ASN A 223 ? GLY A 226 ASN A 230 AA1 7 MET A 171 ? ALA A 174 ? MET A 180 ALA A 183 AA1 8 LEU A 152 ? VAL A 153 ? LEU A 162 VAL A 163 AA2 1 GLN A 15 ? THR A 20 ? GLN A 30 THR A 35 AA2 2 ARG A 26 ? GLY A 35 ? ARG A 39 GLY A 48 AA2 3 TRP A 38 ? THR A 41 ? TRP A 51 THR A 54 AA2 4 ALA A 95 ? LEU A 99 ? ALA A 104 LEU A 108 AA2 5 PHE A 74 ? ILE A 81 ? PHE A 83 ILE A 90 AA2 6 LEU A 55 A TYR A 58 ? LEU A 65 TYR A 67 AA2 7 GLN A 15 ? THR A 20 ? GLN A 30 THR A 35 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 5 ? N THR A 20 O LYS A 147 ? O LYS A 157 AA1 2 3 O GLN A 146 ? O GLN A 156 N GLY A 131 ? N GLY A 140 AA1 3 4 N TRP A 128 ? N TRP A 137 O SER A 193 ? O SER A 200 AA1 4 5 N CYS A 194 ? N CYS A 201 O HIS A 201 ? O HIS A 208 AA1 5 6 N TRP A 208 ? N TRP A 215 O VAL A 220 ? O VAL A 227 AA1 6 7 O GLY A 219 ? O GLY A 226 N ALA A 174 ? N ALA A 183 AA1 7 8 O CYS A 173 ? O CYS A 182 N VAL A 153 ? N VAL A 163 AA2 1 2 N LEU A 18 ? N LEU A 33 O LEU A 28 ? O LEU A 41 AA2 2 3 N SER A 32 ? N SER A 45 O LEU A 40 ? O LEU A 53 AA2 3 4 N THR A 41 ? N THR A 54 O ALA A 95 ? O ALA A 104 AA2 4 5 O LEU A 96 ? O LEU A 105 N ILE A 80 ? N ILE A 89 AA2 5 6 O PHE A 74 ? O PHE A 83 N VAL A 57 ? N VAL A 66 AA2 6 7 O ARG A 56 B O ARG A 65 N HIS A 19 ? N HIS A 34 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A QEV 301 ? 21 'binding site for residue QEV A 301' AC2 Software A SO4 302 ? 4 'binding site for residue SO4 A 302' AC3 Software A EDO 303 ? 4 'binding site for residue EDO A 303' AC4 Software A EDO 304 ? 2 'binding site for residue EDO A 304' AC5 Software A EDO 305 ? 9 'binding site for residue EDO A 305' AC6 Software A EDO 306 ? 4 'binding site for residue EDO A 306' AC7 Software A EDO 307 ? 1 'binding site for residue EDO A 307' AC8 Software A EDO 308 ? 5 'binding site for residue EDO A 308' AC9 Software A EDO 309 ? 6 'binding site for residue EDO A 309' AD1 Software A EDO 310 ? 3 'binding site for residue EDO A 310' AD2 Software A EDO 311 ? 6 'binding site for residue EDO A 311' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 21 ARG A 26 ? ARG A 39 . ? 1_555 ? 2 AC1 21 HIS A 27 ? HIS A 40 . ? 1_555 ? 3 AC1 21 LEU A 28 ? LEU A 41 . ? 1_555 ? 4 AC1 21 TYR A 134 ? TYR A 143 . ? 1_555 ? 5 AC1 21 ILE A 141 ? ILE A 151 . ? 1_555 ? 6 AC1 21 ASP A 182 ? ASP A 189 . ? 1_555 ? 7 AC1 21 ALA A 183 ? ALA A 190 . ? 1_555 ? 8 AC1 21 CYS A 184 ? CYS A 191 . ? 1_555 ? 9 AC1 21 LYS A 185 ? LYS A 192 . ? 1_555 ? 10 AC1 21 GLY A 186 ? GLY A 193 . ? 1_555 ? 11 AC1 21 SER A 188 ? SER A 195 . ? 1_555 ? 12 AC1 21 THR A 206 ? THR A 213 . ? 1_555 ? 13 AC1 21 SER A 207 ? SER A 214 . ? 1_555 ? 14 AC1 21 TRP A 208 ? TRP A 215 . ? 1_555 ? 15 AC1 21 GLY A 211 ? GLY A 218 . ? 1_555 ? 16 AC1 21 GLY A 219 ? GLY A 226 . ? 1_555 ? 17 AC1 21 VAL A 220 ? VAL A 227 . ? 1_555 ? 18 AC1 21 TYR A 221 ? TYR A 228 . ? 1_555 ? 19 AC1 21 EDO K . ? EDO A 309 . ? 1_555 ? 20 AC1 21 EDO L . ? EDO A 310 . ? 1_555 ? 21 AC1 21 HOH N . ? HOH A 413 . ? 1_555 ? 22 AC2 4 ARG A 161 ? ARG A 170 . ? 5_555 ? 23 AC2 4 ARG A 161 ? ARG A 170 . ? 1_555 ? 24 AC2 4 ARG A 177 B ARG A 184 . ? 1_555 ? 25 AC2 4 ARG A 177 B ARG A 184 . ? 5_555 ? 26 AC3 4 ASN A 36 ? ASN A 49 . ? 1_555 ? 27 AC3 4 THR A 102 ? THR A 111 . ? 1_555 ? 28 AC3 4 VAL A 103 ? VAL A 112 . ? 1_555 ? 29 AC3 4 TYR A 105 ? TYR A 114 . ? 1_555 ? 30 AC4 2 ARG A 9 ? ARG A 24 . ? 1_555 ? 31 AC4 2 SER A 90 ? SER A 99 . ? 3_655 ? 32 AC5 9 ARG A 9 ? ARG A 24 . ? 1_555 ? 33 AC5 9 GLY A 10 ? GLY A 25 . ? 1_555 ? 34 AC5 9 GLU A 11 ? GLU A 26 . ? 1_555 ? 35 AC5 9 TRP A 12 ? TRP A 27 . ? 1_555 ? 36 AC5 9 PRO A 13 ? PRO A 28 . ? 1_555 ? 37 AC5 9 ILE A 61 ? ILE A 70 . ? 1_555 ? 38 AC5 9 LEU A 62 ? LEU A 71 . ? 1_555 ? 39 AC5 9 LEU A 145 ? LEU A 155 . ? 1_555 ? 40 AC5 9 HOH N . ? HOH A 437 . ? 1_555 ? 41 AC6 4 SER A 72 ? SER A 81 . ? 2_544 ? 42 AC6 4 LYS A 185 ? LYS A 192 . ? 1_555 ? 43 AC6 4 GLU A 210 ? GLU A 217 . ? 1_555 ? 44 AC6 4 GLY A 211 ? GLY A 218 . ? 1_555 ? 45 AC7 1 HIS A 169 ? HIS A 178 . ? 1_555 ? 46 AC8 5 SER A 90 ? SER A 99 . ? 1_555 ? 47 AC8 5 GLY A 91 ? GLY A 100 . ? 1_555 ? 48 AC8 5 TYR A 92 ? TYR A 101 . ? 1_555 ? 49 AC8 5 THR A 168 ? THR A 177 . ? 1_555 ? 50 AC8 5 LYS A 170 ? LYS A 179 . ? 1_555 ? 51 AC9 6 HIS A 44 ? HIS A 57 . ? 1_555 ? 52 AC9 6 ALA A 88 ? ALA A 97 . ? 1_555 ? 53 AC9 6 SER A 207 ? SER A 214 . ? 1_555 ? 54 AC9 6 TRP A 208 ? TRP A 215 . ? 1_555 ? 55 AC9 6 QEV C . ? QEV A 301 . ? 1_555 ? 56 AC9 6 HOH N . ? HOH A 413 . ? 1_555 ? 57 AD1 3 GLY A 104 ? GLY A 113 . ? 2_544 ? 58 AD1 3 TYR A 105 ? TYR A 114 . ? 2_544 ? 59 AD1 3 QEV C . ? QEV A 301 . ? 1_555 ? 60 AD2 6 TYR A 85 ? TYR A 94 . ? 1_555 ? 61 AD2 6 MET A 87 ? MET A 96 . ? 1_555 ? 62 AD2 6 ALA A 88 ? ALA A 97 . ? 1_555 ? 63 AD2 6 GLU A 89 ? GLU A 98 . ? 1_555 ? 64 AD2 6 SER A 108 ? SER A 117 . ? 2_544 ? 65 AD2 6 HOH N . ? HOH A 423 . ? 1_555 ? # _atom_sites.entry_id 5QTU _atom_sites.fract_transf_matrix[1][1] 0.012596 _atom_sites.fract_transf_matrix[1][2] 0.007272 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014545 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009464 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL F H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 16 16 ILE ILE A . n A 1 2 VAL 2 17 17 VAL VAL A . n A 1 3 GLY 3 18 18 GLY GLY A . n A 1 4 GLY 4 19 19 GLY GLY A . n A 1 5 THR 5 20 20 THR THR A . n A 1 6 ALA 6 21 21 ALA ALA A . n A 1 7 SER 7 22 22 SER SER A . n A 1 8 VAL 8 23 23 VAL VAL A . n A 1 9 ARG 9 24 24 ARG ARG A . n A 1 10 GLY 10 25 25 GLY GLY A . n A 1 11 GLU 11 26 26 GLU GLU A . n A 1 12 TRP 12 27 27 TRP TRP A . n A 1 13 PRO 13 28 28 PRO PRO A . n A 1 14 TRP 14 29 29 TRP TRP A . n A 1 15 GLN 15 30 30 GLN GLN A . n A 1 16 VAL 16 31 31 VAL VAL A . n A 1 17 THR 17 32 32 THR THR A . n A 1 18 LEU 18 33 33 LEU LEU A . n A 1 19 HIS 19 34 34 HIS HIS A . n A 1 20 THR 20 35 35 THR THR A . n A 1 21 THR 21 36 36 THR THR A . n A 1 22 SER 22 36 36 SER SER A A n A 1 23 PRO 23 36 36 PRO PRO A B n A 1 24 THR 24 37 37 THR THR A . n A 1 25 GLN 25 38 38 GLN GLN A . n A 1 26 ARG 26 39 39 ARG ARG A . n A 1 27 HIS 27 40 40 HIS HIS A . n A 1 28 LEU 28 41 41 LEU LEU A . n A 1 29 CYS 29 42 42 CYS CYS A . n A 1 30 GLY 30 43 43 GLY GLY A . n A 1 31 GLY 31 44 44 GLY GLY A . n A 1 32 SER 32 45 45 SER SER A . n A 1 33 ILE 33 46 46 ILE ILE A . n A 1 34 ILE 34 47 47 ILE ILE A . n A 1 35 GLY 35 48 48 GLY GLY A . n A 1 36 ASN 36 49 49 ASN ASN A . n A 1 37 GLN 37 50 50 GLN GLN A . n A 1 38 TRP 38 51 51 TRP TRP A . n A 1 39 ILE 39 52 52 ILE ILE A . n A 1 40 LEU 40 53 53 LEU LEU A . n A 1 41 THR 41 54 54 THR THR A . n A 1 42 ALA 42 55 55 ALA ALA A . n A 1 43 ALA 43 56 56 ALA ALA A . n A 1 44 HIS 44 57 57 HIS HIS A . n A 1 45 CYS 45 58 58 CYS CYS A . n A 1 46 PHE 46 58 58 PHE PHE A A n A 1 47 TYR 47 58 58 TYR TYR A B n A 1 48 GLY 48 59 59 GLY GLY A . n A 1 49 VAL 49 60 60 VAL VAL A . n A 1 50 GLU 50 61 61 GLU GLU A . n A 1 51 SER 51 62 62 SER SER A . n A 1 52 PRO 52 63 63 PRO PRO A . n A 1 53 LYS 53 64 64 LYS LYS A . n A 1 54 ILE 54 65 65 ILE ILE A . n A 1 55 LEU 55 65 65 LEU LEU A A n A 1 56 ARG 56 65 65 ARG ARG A B n A 1 57 VAL 57 66 66 VAL VAL A . n A 1 58 TYR 58 67 67 TYR TYR A . n A 1 59 SER 59 68 68 SER SER A . n A 1 60 GLY 60 69 69 GLY GLY A . n A 1 61 ILE 61 70 70 ILE ILE A . n A 1 62 LEU 62 71 71 LEU LEU A . n A 1 63 ASN 63 72 72 ASN ASN A . n A 1 64 GLN 64 73 73 GLN GLN A . n A 1 65 SER 65 74 74 SER SER A . n A 1 66 GLU 66 75 75 GLU GLU A . n A 1 67 ILE 67 76 76 ILE ILE A . n A 1 68 LYS 68 77 77 LYS LYS A . n A 1 69 GLU 69 78 78 GLU GLU A . n A 1 70 ASP 70 79 79 ASP ASP A . n A 1 71 THR 71 80 80 THR THR A . n A 1 72 SER 72 81 81 SER SER A . n A 1 73 PHE 73 82 82 PHE PHE A . n A 1 74 PHE 74 83 83 PHE PHE A . n A 1 75 GLY 75 84 84 GLY GLY A . n A 1 76 VAL 76 85 85 VAL VAL A . n A 1 77 GLN 77 86 86 GLN GLN A . n A 1 78 GLU 78 87 87 GLU GLU A . n A 1 79 ILE 79 88 88 ILE ILE A . n A 1 80 ILE 80 89 89 ILE ILE A . n A 1 81 ILE 81 90 90 ILE ILE A . n A 1 82 HIS 82 91 91 HIS HIS A . n A 1 83 ASP 83 92 92 ASP ASP A . n A 1 84 GLN 84 93 93 GLN GLN A . n A 1 85 TYR 85 94 94 TYR TYR A . n A 1 86 LYS 86 95 95 LYS LYS A . n A 1 87 MET 87 96 96 MET MET A . n A 1 88 ALA 88 97 97 ALA ALA A . n A 1 89 GLU 89 98 98 GLU GLU A . n A 1 90 SER 90 99 99 SER SER A . n A 1 91 GLY 91 100 100 GLY GLY A . n A 1 92 TYR 92 101 101 TYR TYR A . n A 1 93 ASP 93 102 102 ASP ASP A . n A 1 94 ILE 94 103 103 ILE ILE A . n A 1 95 ALA 95 104 104 ALA ALA A . n A 1 96 LEU 96 105 105 LEU LEU A . n A 1 97 LEU 97 106 106 LEU LEU A . n A 1 98 LYS 98 107 107 LYS LYS A . n A 1 99 LEU 99 108 108 LEU LEU A . n A 1 100 GLU 100 109 109 GLU GLU A . n A 1 101 THR 101 110 110 THR THR A . n A 1 102 THR 102 111 111 THR THR A . n A 1 103 VAL 103 112 112 VAL VAL A . n A 1 104 GLY 104 113 113 GLY GLY A . n A 1 105 TYR 105 114 114 TYR TYR A . n A 1 106 GLY 106 115 115 GLY GLY A . n A 1 107 ASP 107 116 116 ASP ASP A . n A 1 108 SER 108 117 117 SER SER A . n A 1 109 GLN 109 118 118 GLN GLN A . n A 1 110 ARG 110 119 119 ARG ARG A . n A 1 111 PRO 111 120 120 PRO PRO A . n A 1 112 ILE 112 121 121 ILE ILE A . n A 1 113 CYS 113 122 122 CYS CYS A . n A 1 114 LEU 114 123 123 LEU LEU A . n A 1 115 PRO 115 124 124 PRO PRO A . n A 1 116 SER 116 125 125 SER SER A . n A 1 117 LYS 117 126 126 LYS LYS A . n A 1 118 GLY 118 127 127 GLY GLY A . n A 1 119 ASP 119 128 128 ASP ASP A . n A 1 120 ARG 120 129 129 ARG ARG A . n A 1 121 ASN 121 130 130 ASN ASN A . n A 1 122 VAL 122 131 131 VAL VAL A . n A 1 123 ILE 123 132 132 ILE ILE A . n A 1 124 TYR 124 133 133 TYR TYR A . n A 1 125 THR 125 134 134 THR THR A . n A 1 126 ASP 126 135 135 ASP ASP A . n A 1 127 CYS 127 136 136 CYS CYS A . n A 1 128 TRP 128 137 137 TRP TRP A . n A 1 129 VAL 129 138 138 VAL VAL A . n A 1 130 THR 130 139 139 THR THR A . n A 1 131 GLY 131 140 140 GLY GLY A . n A 1 132 TRP 132 141 141 TRP TRP A . n A 1 133 GLY 133 142 142 GLY GLY A . n A 1 134 TYR 134 143 143 TYR TYR A . n A 1 135 ARG 135 145 145 ARG ARG A . n A 1 136 LYS 136 146 146 LYS LYS A . n A 1 137 LEU 137 147 147 LEU LEU A . n A 1 138 ARG 138 148 148 ARG ARG A . n A 1 139 ASP 139 149 149 ASP ASP A . n A 1 140 LYS 140 150 150 LYS LYS A . n A 1 141 ILE 141 151 151 ILE ILE A . n A 1 142 GLN 142 152 152 GLN GLN A . n A 1 143 ASN 143 153 153 ASN ASN A . n A 1 144 THR 144 154 154 THR THR A . n A 1 145 LEU 145 155 155 LEU LEU A . n A 1 146 GLN 146 156 156 GLN GLN A . n A 1 147 LYS 147 157 157 LYS LYS A . n A 1 148 ALA 148 158 158 ALA ALA A . n A 1 149 LYS 149 159 159 LYS LYS A . n A 1 150 ILE 150 160 160 ILE ILE A . n A 1 151 PRO 151 161 161 PRO PRO A . n A 1 152 LEU 152 162 162 LEU LEU A . n A 1 153 VAL 153 163 163 VAL VAL A . n A 1 154 THR 154 164 164 THR THR A . n A 1 155 ASN 155 165 165 ASN ASN A . n A 1 156 GLU 156 166 166 GLU GLU A . n A 1 157 GLU 157 167 167 GLU GLU A . n A 1 158 CYS 158 168 168 CYS CYS A . n A 1 159 GLN 159 168 168 GLN GLN A A n A 1 160 LYS 160 169 169 LYS LYS A . n A 1 161 ARG 161 170 170 ARG ARG A . n A 1 162 TYR 162 171 171 TYR TYR A . n A 1 163 ARG 163 172 172 ARG ARG A . n A 1 164 GLY 164 173 173 GLY GLY A . n A 1 165 HIS 165 174 174 HIS HIS A . n A 1 166 LYS 166 175 175 LYS LYS A . n A 1 167 ILE 167 176 176 ILE ILE A . n A 1 168 THR 168 177 177 THR THR A . n A 1 169 HIS 169 178 178 HIS HIS A . n A 1 170 LYS 170 179 179 LYS LYS A . n A 1 171 MET 171 180 180 MET MET A . n A 1 172 ILE 172 181 181 ILE ILE A . n A 1 173 CYS 173 182 182 CYS CYS A . n A 1 174 ALA 174 183 183 ALA ALA A . n A 1 175 GLY 175 184 184 GLY GLY A . n A 1 176 TYR 176 184 184 TYR TYR A A n A 1 177 ARG 177 184 184 ARG ARG A B n A 1 178 GLU 178 185 185 GLU GLU A . n A 1 179 GLY 179 186 186 GLY GLY A . n A 1 180 GLY 180 187 187 GLY GLY A . n A 1 181 LYS 181 188 188 LYS LYS A . n A 1 182 ASP 182 189 189 ASP ASP A . n A 1 183 ALA 183 190 190 ALA ALA A . n A 1 184 CYS 184 191 191 CYS CYS A . n A 1 185 LYS 185 192 192 LYS LYS A . n A 1 186 GLY 186 193 193 GLY GLY A . n A 1 187 ASP 187 194 194 ASP ASP A . n A 1 188 SER 188 195 195 SER SER A . n A 1 189 GLY 189 196 196 GLY GLY A . n A 1 190 GLY 190 197 197 GLY GLY A . n A 1 191 PRO 191 198 198 PRO PRO A . n A 1 192 LEU 192 199 199 LEU LEU A . n A 1 193 SER 193 200 200 SER SER A . n A 1 194 CYS 194 201 201 CYS CYS A . n A 1 195 LYS 195 202 202 LYS LYS A . n A 1 196 HIS 196 203 203 HIS HIS A . n A 1 197 ASN 197 204 204 ASN ASN A . n A 1 198 GLU 198 205 205 GLU GLU A . n A 1 199 VAL 199 206 206 VAL VAL A . n A 1 200 TRP 200 207 207 TRP TRP A . n A 1 201 HIS 201 208 208 HIS HIS A . n A 1 202 LEU 202 209 209 LEU LEU A . n A 1 203 VAL 203 210 210 VAL VAL A . n A 1 204 GLY 204 211 211 GLY GLY A . n A 1 205 ILE 205 212 212 ILE ILE A . n A 1 206 THR 206 213 213 THR THR A . n A 1 207 SER 207 214 214 SER SER A . n A 1 208 TRP 208 215 215 TRP TRP A . n A 1 209 GLY 209 216 216 GLY GLY A . n A 1 210 GLU 210 217 217 GLU GLU A . n A 1 211 GLY 211 218 218 GLY GLY A . n A 1 212 CYS 212 219 219 CYS CYS A . n A 1 213 ALA 213 220 220 ALA ALA A . n A 1 214 GLN 214 221 221 GLN GLN A . n A 1 215 ARG 215 222 222 ARG ARG A . n A 1 216 GLU 216 223 223 GLU GLU A . n A 1 217 ARG 217 224 224 ARG ARG A . n A 1 218 PRO 218 225 225 PRO PRO A . n A 1 219 GLY 219 226 226 GLY GLY A . n A 1 220 VAL 220 227 227 VAL VAL A . n A 1 221 TYR 221 228 228 TYR TYR A . n A 1 222 THR 222 229 229 THR THR A . n A 1 223 ASN 223 230 230 ASN ASN A . n A 1 224 VAL 224 231 231 VAL VAL A . n A 1 225 VAL 225 232 232 VAL VAL A . n A 1 226 GLU 226 233 233 GLU GLU A . n A 1 227 TYR 227 234 234 TYR TYR A . n A 1 228 VAL 228 235 235 VAL VAL A . n A 1 229 ASP 229 236 236 ASP ASP A . n A 1 230 TRP 230 237 237 TRP TRP A . n A 1 231 ILE 231 238 238 ILE ILE A . n A 1 232 LEU 232 239 239 LEU LEU A . n A 1 233 GLU 233 240 240 GLU GLU A . n A 1 234 LYS 234 241 241 LYS LYS A . n A 1 235 THR 235 242 242 THR THR A . n A 1 236 GLN 236 243 243 GLN GLN A . n A 1 237 ALA 237 244 244 ALA ALA A . n A 1 238 VAL 238 245 245 VAL VAL A . n A 1 239 HIS 239 246 ? ? ? A . n A 1 240 HIS 240 247 ? ? ? A . n A 1 241 HIS 241 248 ? ? ? A . n A 1 242 HIS 242 249 ? ? ? A . n A 1 243 HIS 243 250 ? ? ? A . n A 1 244 HIS 244 251 ? ? ? A . n B 2 1 MET 1 352 ? ? ? H . n B 2 2 ASP 2 353 ? ? ? H . n B 2 3 ASP 3 354 ? ? ? H . n B 2 4 ASP 4 355 ? ? ? H . n B 2 5 ASP 5 356 ? ? ? H . n B 2 6 LYS 6 357 ? ? ? H . n B 2 7 MET 7 358 ? ? ? H . n B 2 8 ASP 8 359 ? ? ? H . n B 2 9 ASN 9 360 ? ? ? H . n B 2 10 GLU 10 361 ? ? ? H . n B 2 11 CYS 11 362 362 CYS CYS H . n B 2 12 THR 12 363 363 THR THR H . n B 2 13 THR 13 364 364 THR THR H . n B 2 14 LYS 14 365 365 LYS LYS H . n B 2 15 ILE 15 366 366 ILE ILE H . n B 2 16 LYS 16 367 367 LYS LYS H . n B 2 17 PRO 17 368 368 PRO PRO H . n B 2 18 ARG 18 369 ? ? ? H . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 QEV 1 301 1 QEV LG1 A . D 4 SO4 1 302 2 SO4 SO4 A . E 5 EDO 1 303 4 EDO EDO A . F 5 EDO 1 304 7 EDO EDO A . G 5 EDO 1 305 8 EDO EDO A . H 5 EDO 1 306 9 EDO EDO A . I 5 EDO 1 307 11 EDO EDO A . J 5 EDO 1 308 16 EDO EDO A . K 5 EDO 1 309 17 EDO EDO A . L 5 EDO 1 310 19 EDO EDO A . M 5 EDO 1 311 20 EDO EDO A . N 6 HOH 1 401 87 HOH HOH A . N 6 HOH 2 402 8 HOH HOH A . N 6 HOH 3 403 82 HOH HOH A . N 6 HOH 4 404 56 HOH HOH A . N 6 HOH 5 405 54 HOH HOH A . N 6 HOH 6 406 1 HOH HOH A . N 6 HOH 7 407 48 HOH HOH A . N 6 HOH 8 408 2 HOH HOH A . N 6 HOH 9 409 10 HOH HOH A . N 6 HOH 10 410 29 HOH HOH A . N 6 HOH 11 411 9 HOH HOH A . N 6 HOH 12 412 88 HOH HOH A . N 6 HOH 13 413 45 HOH HOH A . N 6 HOH 14 414 81 HOH HOH A . N 6 HOH 15 415 51 HOH HOH A . N 6 HOH 16 416 13 HOH HOH A . N 6 HOH 17 417 14 HOH HOH A . N 6 HOH 18 418 6 HOH HOH A . N 6 HOH 19 419 33 HOH HOH A . N 6 HOH 20 420 55 HOH HOH A . N 6 HOH 21 421 16 HOH HOH A . N 6 HOH 22 422 53 HOH HOH A . N 6 HOH 23 423 19 HOH HOH A . N 6 HOH 24 424 23 HOH HOH A . N 6 HOH 25 425 43 HOH HOH A . N 6 HOH 26 426 24 HOH HOH A . N 6 HOH 27 427 99 HOH HOH A . N 6 HOH 28 428 3 HOH HOH A . N 6 HOH 29 429 102 HOH HOH A . N 6 HOH 30 430 85 HOH HOH A . N 6 HOH 31 431 72 HOH HOH A . N 6 HOH 32 432 98 HOH HOH A . N 6 HOH 33 433 18 HOH HOH A . N 6 HOH 34 434 21 HOH HOH A . N 6 HOH 35 435 71 HOH HOH A . N 6 HOH 36 436 5 HOH HOH A . N 6 HOH 37 437 26 HOH HOH A . N 6 HOH 38 438 38 HOH HOH A . N 6 HOH 39 439 35 HOH HOH A . N 6 HOH 40 440 27 HOH HOH A . N 6 HOH 41 441 41 HOH HOH A . N 6 HOH 42 442 77 HOH HOH A . N 6 HOH 43 443 52 HOH HOH A . N 6 HOH 44 444 39 HOH HOH A . N 6 HOH 45 445 58 HOH HOH A . N 6 HOH 46 446 94 HOH HOH A . N 6 HOH 47 447 68 HOH HOH A . N 6 HOH 48 448 80 HOH HOH A . N 6 HOH 49 449 34 HOH HOH A . N 6 HOH 50 450 101 HOH HOH A . N 6 HOH 51 451 7 HOH HOH A . N 6 HOH 52 452 95 HOH HOH A . N 6 HOH 53 453 4 HOH HOH A . N 6 HOH 54 454 46 HOH HOH A . N 6 HOH 55 455 84 HOH HOH A . N 6 HOH 56 456 17 HOH HOH A . N 6 HOH 57 457 91 HOH HOH A . N 6 HOH 58 458 103 HOH HOH A . N 6 HOH 59 459 37 HOH HOH A . N 6 HOH 60 460 100 HOH HOH A . N 6 HOH 61 461 28 HOH HOH A . N 6 HOH 62 462 62 HOH HOH A . N 6 HOH 63 463 20 HOH HOH A . N 6 HOH 64 464 69 HOH HOH A . N 6 HOH 65 465 76 HOH HOH A . N 6 HOH 66 466 22 HOH HOH A . N 6 HOH 67 467 11 HOH HOH A . N 6 HOH 68 468 47 HOH HOH A . N 6 HOH 69 469 42 HOH HOH A . N 6 HOH 70 470 66 HOH HOH A . N 6 HOH 71 471 67 HOH HOH A . N 6 HOH 72 472 74 HOH HOH A . N 6 HOH 73 473 25 HOH HOH A . N 6 HOH 74 474 49 HOH HOH A . N 6 HOH 75 475 64 HOH HOH A . N 6 HOH 76 476 97 HOH HOH A . N 6 HOH 77 477 44 HOH HOH A . N 6 HOH 78 478 89 HOH HOH A . N 6 HOH 79 479 63 HOH HOH A . N 6 HOH 80 480 40 HOH HOH A . N 6 HOH 81 481 93 HOH HOH A . N 6 HOH 82 482 86 HOH HOH A . N 6 HOH 83 483 65 HOH HOH A . N 6 HOH 84 484 90 HOH HOH A . N 6 HOH 85 485 75 HOH HOH A . N 6 HOH 86 486 12 HOH HOH A . N 6 HOH 87 487 36 HOH HOH A . N 6 HOH 88 488 57 HOH HOH A . N 6 HOH 89 489 31 HOH HOH A . N 6 HOH 90 490 32 HOH HOH A . N 6 HOH 91 491 30 HOH HOH A . N 6 HOH 92 492 83 HOH HOH A . N 6 HOH 93 493 15 HOH HOH A . N 6 HOH 94 494 79 HOH HOH A . N 6 HOH 95 495 61 HOH HOH A . N 6 HOH 96 496 59 HOH HOH A . N 6 HOH 97 497 50 HOH HOH A . N 6 HOH 98 498 73 HOH HOH A . N 6 HOH 99 499 96 HOH HOH A . N 6 HOH 100 500 78 HOH HOH A . N 6 HOH 101 501 92 HOH HOH A . N 6 HOH 102 502 70 HOH HOH A . O 6 HOH 1 401 60 HOH HOH H . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L,M,N,O # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 810 ? 1 MORE -7 ? 1 'SSA (A^2)' 11380 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id SO4 _pdbx_struct_special_symmetry.auth_seq_id 302 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id SO4 _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-12-25 2 'Structure model' 1 1 2020-01-29 3 'Structure model' 1 2 2021-05-12 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 3 'Structure model' pdbx_deposit_group # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 3 'Structure model' '_citation.journal_abbrev' 5 3 'Structure model' '_citation.journal_id_ISSN' 6 3 'Structure model' '_citation.journal_volume' 7 3 'Structure model' '_citation.page_first' 8 3 'Structure model' '_citation.page_last' 9 3 'Structure model' '_citation.pdbx_database_id_DOI' 10 3 'Structure model' '_citation.pdbx_database_id_PubMed' 11 3 'Structure model' '_citation.title' 12 3 'Structure model' '_citation.year' 13 3 'Structure model' '_citation_author.identifier_ORCID' 14 3 'Structure model' '_citation_author.name' 15 3 'Structure model' '_pdbx_deposit_group.group_type' # _phasing.method MR # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 XDS . ? program 'Wolfgang Kabsch' Wolfgang.Kabsch@mpimf-heidelberg.mp 'data reduction' http://xds.mpimf-heidelberg.mpg.de/ ? ? 2 SCALA . ? program 'Phil R. Evans' pre@mrc-lmb.cam.ac.uk 'data scaling' http://www.ccp4.ac.uk/dist/html/scala.html Fortran_77 ? 3 AMoRE . ? program 'Jorge Navaza' ccp4@ccp4.ac.uk phasing http://www.ccp4.ac.uk/ Fortran_77 ? 4 BUSTER 2.11.7 ? program 'Gerard Bricogne' buster-develop@GlobalPhasing.com refinement http://www.globalphasing.com/buster/ ? ? 5 PDB_EXTRACT 3.22 'July. 13, 2016' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? # _pdbx_entry_details.entry_id 5QTU _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TRP A 27 ? ? -119.14 69.10 2 1 LEU A 41 ? ? -109.05 -60.06 3 1 GLN A 50 ? ? -141.59 20.03 4 1 TYR A 133 ? ? 76.57 111.49 5 1 ASP A 149 ? ? -163.60 -144.13 6 1 ASP A 189 ? ? -171.56 -178.94 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 61 ? CG ? A GLU 50 CG 2 1 Y 1 A GLU 61 ? CD ? A GLU 50 CD 3 1 Y 1 A GLU 61 ? OE1 ? A GLU 50 OE1 4 1 Y 1 A GLU 61 ? OE2 ? A GLU 50 OE2 5 1 Y 1 A GLU 78 ? CG ? A GLU 69 CG 6 1 Y 1 A GLU 78 ? CD ? A GLU 69 CD 7 1 Y 1 A GLU 78 ? OE1 ? A GLU 69 OE1 8 1 Y 1 A GLU 78 ? OE2 ? A GLU 69 OE2 9 1 Y 1 A LYS 126 ? CG ? A LYS 117 CG 10 1 Y 1 A LYS 126 ? CD ? A LYS 117 CD 11 1 Y 1 A LYS 126 ? CE ? A LYS 117 CE 12 1 Y 1 A LYS 126 ? NZ ? A LYS 117 NZ 13 1 Y 1 A ARG 129 ? CG ? A ARG 120 CG 14 1 Y 1 A ARG 129 ? CD ? A ARG 120 CD 15 1 Y 1 A ARG 129 ? NE ? A ARG 120 NE 16 1 Y 1 A ARG 129 ? CZ ? A ARG 120 CZ 17 1 Y 1 A ARG 129 ? NH1 ? A ARG 120 NH1 18 1 Y 1 A ARG 129 ? NH2 ? A ARG 120 NH2 19 1 Y 1 A ASN 130 ? CG ? A ASN 121 CG 20 1 Y 1 A ASN 130 ? OD1 ? A ASN 121 OD1 21 1 Y 1 A ASN 130 ? ND2 ? A ASN 121 ND2 22 1 Y 1 A ARG 148 ? CG ? A ARG 138 CG 23 1 Y 1 A ARG 148 ? CD ? A ARG 138 CD 24 1 Y 1 A ARG 148 ? NE ? A ARG 138 NE 25 1 Y 1 A ARG 148 ? CZ ? A ARG 138 CZ 26 1 Y 1 A ARG 148 ? NH1 ? A ARG 138 NH1 27 1 Y 1 A ARG 148 ? NH2 ? A ARG 138 NH2 28 1 Y 1 A GLU 185 ? CG ? A GLU 178 CG 29 1 Y 1 A GLU 185 ? CD ? A GLU 178 CD 30 1 Y 1 A GLU 185 ? OE1 ? A GLU 178 OE1 31 1 Y 1 A GLU 185 ? OE2 ? A GLU 178 OE2 32 1 Y 1 H LYS 365 ? CD ? B LYS 14 CD 33 1 Y 1 H LYS 365 ? CE ? B LYS 14 CE 34 1 Y 1 H LYS 365 ? NZ ? B LYS 14 NZ 35 1 Y 1 H LYS 367 ? CE ? B LYS 16 CE 36 1 Y 1 H LYS 367 ? NZ ? B LYS 16 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 246 ? A HIS 239 2 1 Y 1 A HIS 247 ? A HIS 240 3 1 Y 1 A HIS 248 ? A HIS 241 4 1 Y 1 A HIS 249 ? A HIS 242 5 1 Y 1 A HIS 250 ? A HIS 243 6 1 Y 1 A HIS 251 ? A HIS 244 7 1 Y 1 H MET 352 ? B MET 1 8 1 Y 1 H ASP 353 ? B ASP 2 9 1 Y 1 H ASP 354 ? B ASP 3 10 1 Y 1 H ASP 355 ? B ASP 4 11 1 Y 1 H ASP 356 ? B ASP 5 12 1 Y 1 H LYS 357 ? B LYS 6 13 1 Y 1 H MET 358 ? B MET 7 14 1 Y 1 H ASP 359 ? B ASP 8 15 1 Y 1 H ASN 360 ? B ASN 9 16 1 Y 1 H GLU 361 ? B GLU 10 17 1 Y 1 H ARG 369 ? B ARG 18 # _pdbx_deposit_group.group_id G_1002107 _pdbx_deposit_group.group_title FXIa _pdbx_deposit_group.group_description 'Structures deposited in support of J. R. Corte et al., J.Med.Chem., about to be submitted' _pdbx_deposit_group.group_type undefined # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id QEV _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id QEV _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 ;methyl [(3R,7S)-7-{[1-(3-chloro-2-fluorophenyl)-5-methyl-1H-imidazole-4-carbonyl]amino}-3-methyl-2-oxo-2,3,4,5,6,7-hexahydro-1H-12,8-(metheno)-1,9-benzodiazacyclotetradecin-15-yl]carbamate ; QEV 4 'SULFATE ION' SO4 5 1,2-ETHANEDIOL EDO 6 water HOH #