data_5RSA # _entry.id 5RSA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5RSA pdb_00005rsa 10.2210/pdb5rsa/pdb WWPDB D_1000179769 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1985-07-17 2 'Structure model' 1 1 2008-03-03 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-10-24 5 'Structure model' 1 4 2023-03-15 6 'Structure model' 1 5 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Non-polymer description' 4 3 'Structure model' 'Version format compliance' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' Other 7 4 'Structure model' 'Structure summary' 8 5 'Structure model' 'Database references' 9 5 'Structure model' 'Derived calculations' 10 5 'Structure model' 'Refinement description' 11 6 'Structure model' 'Data collection' 12 6 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' struct_keywords 3 5 'Structure model' database_2 4 5 'Structure model' refine 5 5 'Structure model' struct_site 6 6 'Structure model' chem_comp_atom 7 6 'Structure model' chem_comp_bond 8 6 'Structure model' pdbx_entry_details 9 6 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.process_site' 2 4 'Structure model' '_struct_keywords.pdbx_keywords' 3 4 'Structure model' '_struct_keywords.text' 4 5 'Structure model' '_database_2.pdbx_DOI' 5 5 'Structure model' '_database_2.pdbx_database_accession' 6 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 7 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 8 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 1985-07-17 _pdbx_database_PDB_obs_spr.pdb_id 5RSA _pdbx_database_PDB_obs_spr.replace_pdb_id 4RSA _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 5RSA _pdbx_database_status.recvd_initial_deposition_date 1985-04-29 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _audit_author.name 'Wlodawer, A.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID ? # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Comparison of Two Independently Refined Models of Ribonuclease-A' 'Acta Crystallogr.,Sect.B' 42 379 ? 1986 ASBSDK DK 0108-7681 0622 ? -1 ? 1 ;Nuclear Magnetic Resonance and Neutron Diffraction Studies of the Complex of Ribonucleasea with Uridine Vanadate, a Transition-State Analogue ; Biochemistry 24 2058 ? 1985 BICHAW US 0006-2960 0033 ? ? ? 2 'Structure of Ribonuclease A. Results of Joint Neutron and X-Ray Refinement at 2.0-Angstroms Resolution' Biochemistry 22 2720 ? 1983 BICHAW US 0006-2960 0033 ? ? ? 3 'Active Site of Rnase. Neutron Diffraction Study of a Complex with Uridine Vanadate, a Transition-State Analog' Proc.Natl.Acad.Sci.USA 80 3628 ? 1983 PNASA6 US 0027-8424 0040 ? ? ? 4 'The Refined Crystal Structure of Ribonuclease A at 2.0 Angstroms Resolution' J.Biol.Chem. 257 1325 ? 1982 JBCHA3 US 0021-9258 0071 ? ? ? 5 'Hydrogen Exchange in Rnase A. Neutron Diffraction Study' Proc.Natl.Acad.Sci.USA 79 1418 ? 1982 PNASA6 US 0027-8424 0040 ? ? ? 6 'Structure of Ribonuclease A. X-Ray and Neutron Refinement' 'Acta Crystallogr.,Sect.A (Supplement)' 37 13 ? 1981 ACACBN DK 0567-7394 108 ? ? ? 7 'Joint Refinement of Macromolecular Structures with X-Ray and Neutron Single-Crystal Diffraction Data' 'Acta Crystallogr.,Sect.A (Supplement)' 37 8 ? 1981 ACACBN DK 0567-7394 108 ? ? ? 8 'Orientation of Histidine Residues in Rnase A. Neutron Diffraction Study' Proc.Natl.Acad.Sci.USA 78 2853 ? 1981 PNASA6 US 0027-8424 0040 ? ? ? 9 'Studies of Ribonuclease-A by X-Ray and Neutron Diffraction' 'Acta Crystallogr.,Sect.B' 36 1826 ? 1980 ASBSDK DK 0108-7681 0622 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wlodawer, A.' 1 ? primary 'Borkakoti, N.' 2 ? primary 'Moss, D.S.' 3 ? primary 'Howlin, B.' 4 ? 1 'Borah, B.' 5 ? 1 'Chen, C.-W.' 6 ? 1 'Egan, W.' 7 ? 1 'Miller, M.' 8 ? 1 'Wlodawer, A.' 9 ? 1 'Cohen, J.S.' 10 ? 2 'Wlodawer, A.' 11 ? 2 'Sjolin, L.' 12 ? 3 'Wlodawer, A.' 13 ? 3 'Miller, M.' 14 ? 3 'Sjolin, L.' 15 ? 4 'Wlodawer, A.' 16 ? 4 'Bott, R.' 17 ? 4 'Sjolin, L.' 18 ? 5 'Wlodawer, A.' 19 ? 5 'Sjolin, L.' 20 ? 6 'Wlodawer, A.' 21 ? 6 'Bott, R.' 22 ? 6 'Sjolin, L.' 23 ? 7 'Wlodawer, A.' 24 ? 7 'Hendrickson, W.A.' 25 ? 8 'Wlodawer, A.' 26 ? 8 'Sjolin, L.' 27 ? 9 'Wlodawer, A.' 28 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'RIBONUCLEASE A' 13708.326 1 3.1.27.5 ? ? ? 2 non-polymer syn 'PHOSPHATE ION' 94.971 1 ? ? ? ? 3 water nat water 18.015 128 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMS ITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV ; _entity_poly.pdbx_seq_one_letter_code_can ;KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMS ITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PHOSPHATE ION' PO4 3 water DOD # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 GLU n 1 3 THR n 1 4 ALA n 1 5 ALA n 1 6 ALA n 1 7 LYS n 1 8 PHE n 1 9 GLU n 1 10 ARG n 1 11 GLN n 1 12 HIS n 1 13 MET n 1 14 ASP n 1 15 SER n 1 16 SER n 1 17 THR n 1 18 SER n 1 19 ALA n 1 20 ALA n 1 21 SER n 1 22 SER n 1 23 SER n 1 24 ASN n 1 25 TYR n 1 26 CYS n 1 27 ASN n 1 28 GLN n 1 29 MET n 1 30 MET n 1 31 LYS n 1 32 SER n 1 33 ARG n 1 34 ASN n 1 35 LEU n 1 36 THR n 1 37 LYS n 1 38 ASP n 1 39 ARG n 1 40 CYS n 1 41 LYS n 1 42 PRO n 1 43 VAL n 1 44 ASN n 1 45 THR n 1 46 PHE n 1 47 VAL n 1 48 HIS n 1 49 GLU n 1 50 SER n 1 51 LEU n 1 52 ALA n 1 53 ASP n 1 54 VAL n 1 55 GLN n 1 56 ALA n 1 57 VAL n 1 58 CYS n 1 59 SER n 1 60 GLN n 1 61 LYS n 1 62 ASN n 1 63 VAL n 1 64 ALA n 1 65 CYS n 1 66 LYS n 1 67 ASN n 1 68 GLY n 1 69 GLN n 1 70 THR n 1 71 ASN n 1 72 CYS n 1 73 TYR n 1 74 GLN n 1 75 SER n 1 76 TYR n 1 77 SER n 1 78 THR n 1 79 MET n 1 80 SER n 1 81 ILE n 1 82 THR n 1 83 ASP n 1 84 CYS n 1 85 ARG n 1 86 GLU n 1 87 THR n 1 88 GLY n 1 89 SER n 1 90 SER n 1 91 LYS n 1 92 TYR n 1 93 PRO n 1 94 ASN n 1 95 CYS n 1 96 ALA n 1 97 TYR n 1 98 LYS n 1 99 THR n 1 100 THR n 1 101 GLN n 1 102 ALA n 1 103 ASN n 1 104 LYS n 1 105 HIS n 1 106 ILE n 1 107 ILE n 1 108 VAL n 1 109 ALA n 1 110 CYS n 1 111 GLU n 1 112 GLY n 1 113 ASN n 1 114 PRO n 1 115 TYR n 1 116 VAL n 1 117 PRO n 1 118 VAL n 1 119 HIS n 1 120 PHE n 1 121 ASP n 1 122 ALA n 1 123 SER n 1 124 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name cattle _entity_src_gen.gene_src_genus Bos _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bos taurus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9913 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line S2 _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ PANCREAS _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DOD non-polymer . 'DEUTERATED WATER' ? 'D2 O' 20.028 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 1 1 LYS LYS A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 HIS 12 12 12 HIS HIS A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 MET 29 29 29 MET MET A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 CYS 58 58 58 CYS CYS A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 CYS 65 65 65 CYS CYS A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 CYS 72 72 72 CYS CYS A . n A 1 73 TYR 73 73 73 TYR TYR A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 MET 79 79 79 MET MET A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 CYS 84 84 84 CYS CYS A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 TYR 92 92 92 TYR TYR A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 ASN 94 94 94 ASN ASN A . n A 1 95 CYS 95 95 95 CYS CYS A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 TYR 97 97 97 TYR TYR A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 GLN 101 101 101 GLN GLN A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 HIS 105 105 105 HIS HIS A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 CYS 110 110 110 CYS CYS A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 ASN 113 113 113 ASN ASN A . n A 1 114 PRO 114 114 114 PRO PRO A . n A 1 115 TYR 115 115 115 TYR TYR A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 PRO 117 117 117 PRO PRO A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 HIS 119 119 119 HIS HIS A . n A 1 120 PHE 120 120 120 PHE PHE A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 SER 123 123 123 SER SER A . n A 1 124 VAL 124 124 124 VAL VAL A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PO4 1 125 1 PO4 PO4 A . C 3 DOD 1 126 126 DOD DOD A . C 3 DOD 2 128 128 DOD DOD A . C 3 DOD 3 129 129 DOD DOD A . C 3 DOD 4 131 131 DOD DOD A . C 3 DOD 5 133 133 DOD DOD A . C 3 DOD 6 135 135 DOD DOD A . C 3 DOD 7 136 136 DOD DOD A . C 3 DOD 8 137 137 DOD DOD A . C 3 DOD 9 138 138 DOD DOD A . C 3 DOD 10 140 140 DOD DOD A . C 3 DOD 11 141 141 DOD DOD A . C 3 DOD 12 142 142 DOD DOD A . C 3 DOD 13 143 143 DOD DOD A . C 3 DOD 14 145 145 DOD DOD A . C 3 DOD 15 147 147 DOD DOD A . C 3 DOD 16 149 149 DOD DOD A . C 3 DOD 17 150 150 DOD DOD A . C 3 DOD 18 151 151 DOD DOD A . C 3 DOD 19 153 153 DOD DOD A . C 3 DOD 20 154 154 DOD DOD A . C 3 DOD 21 155 155 DOD DOD A . C 3 DOD 22 156 156 DOD DOD A . C 3 DOD 23 157 157 DOD DOD A . C 3 DOD 24 158 158 DOD DOD A . C 3 DOD 25 160 160 DOD DOD A . C 3 DOD 26 161 161 DOD DOD A . C 3 DOD 27 162 162 DOD DOD A . C 3 DOD 28 163 163 DOD DOD A . C 3 DOD 29 164 164 DOD DOD A . C 3 DOD 30 165 165 DOD DOD A . C 3 DOD 31 166 166 DOD DOD A . C 3 DOD 32 167 167 DOD DOD A . C 3 DOD 33 168 168 DOD DOD A . C 3 DOD 34 169 169 DOD DOD A . C 3 DOD 35 170 170 DOD DOD A . C 3 DOD 36 171 171 DOD DOD A . C 3 DOD 37 172 172 DOD DOD A . C 3 DOD 38 175 175 DOD DOD A . C 3 DOD 39 177 177 DOD DOD A . C 3 DOD 40 178 178 DOD DOD A . C 3 DOD 41 179 179 DOD DOD A . C 3 DOD 42 180 180 DOD DOD A . C 3 DOD 43 181 181 DOD DOD A . C 3 DOD 44 182 182 DOD DOD A . C 3 DOD 45 183 183 DOD DOD A . C 3 DOD 46 184 184 DOD DOD A . C 3 DOD 47 185 185 DOD DOD A . C 3 DOD 48 186 186 DOD DOD A . C 3 DOD 49 187 187 DOD DOD A . C 3 DOD 50 188 188 DOD DOD A . C 3 DOD 51 189 189 DOD DOD A . C 3 DOD 52 190 190 DOD DOD A . C 3 DOD 53 191 191 DOD DOD A . C 3 DOD 54 192 192 DOD DOD A . C 3 DOD 55 194 194 DOD DOD A . C 3 DOD 56 195 195 DOD DOD A . C 3 DOD 57 196 196 DOD DOD A . C 3 DOD 58 197 197 DOD DOD A . C 3 DOD 59 198 198 DOD DOD A . C 3 DOD 60 199 199 DOD DOD A . C 3 DOD 61 200 200 DOD DOD A . C 3 DOD 62 201 201 DOD DOD A . C 3 DOD 63 202 202 DOD DOD A . C 3 DOD 64 203 203 DOD DOD A . C 3 DOD 65 205 205 DOD DOD A . C 3 DOD 66 206 206 DOD DOD A . C 3 DOD 67 207 207 DOD DOD A . C 3 DOD 68 208 208 DOD DOD A . C 3 DOD 69 209 209 DOD DOD A . C 3 DOD 70 210 210 DOD DOD A . C 3 DOD 71 211 211 DOD DOD A . C 3 DOD 72 212 212 DOD DOD A . C 3 DOD 73 213 213 DOD DOD A . C 3 DOD 74 214 214 DOD DOD A . C 3 DOD 75 215 215 DOD DOD A . C 3 DOD 76 216 216 DOD DOD A . C 3 DOD 77 217 217 DOD DOD A . C 3 DOD 78 218 218 DOD DOD A . C 3 DOD 79 219 219 DOD DOD A . C 3 DOD 80 220 220 DOD DOD A . C 3 DOD 81 221 221 DOD DOD A . C 3 DOD 82 222 222 DOD DOD A . C 3 DOD 83 223 223 DOD DOD A . C 3 DOD 84 228 228 DOD DOD A . C 3 DOD 85 229 229 DOD DOD A . C 3 DOD 86 233 233 DOD DOD A . C 3 DOD 87 235 235 DOD DOD A . C 3 DOD 88 238 238 DOD DOD A . C 3 DOD 89 239 239 DOD DOD A . C 3 DOD 90 240 240 DOD DOD A . C 3 DOD 91 242 242 DOD DOD A . C 3 DOD 92 243 243 DOD DOD A . C 3 DOD 93 244 244 DOD DOD A . C 3 DOD 94 246 246 DOD DOD A . C 3 DOD 95 248 248 DOD DOD A . C 3 DOD 96 249 249 DOD DOD A . C 3 DOD 97 250 250 DOD DOD A . C 3 DOD 98 251 251 DOD DOD A . C 3 DOD 99 252 252 DOD DOD A . C 3 DOD 100 253 253 DOD DOD A . C 3 DOD 101 254 254 DOD DOD A . C 3 DOD 102 255 255 DOD DOD A . C 3 DOD 103 258 258 DOD DOD A . C 3 DOD 104 259 259 DOD DOD A . C 3 DOD 105 260 260 DOD DOD A . C 3 DOD 106 261 261 DOD DOD A . C 3 DOD 107 267 267 DOD DOD A . C 3 DOD 108 268 268 DOD DOD A . C 3 DOD 109 270 270 DOD DOD A . C 3 DOD 110 271 271 DOD DOD A . C 3 DOD 111 275 275 DOD DOD A . C 3 DOD 112 276 276 DOD DOD A . C 3 DOD 113 278 278 DOD DOD A . C 3 DOD 114 284 284 DOD DOD A . C 3 DOD 115 286 286 DOD DOD A . C 3 DOD 116 287 287 DOD DOD A . C 3 DOD 117 294 294 DOD DOD A . C 3 DOD 118 296 296 DOD DOD A . C 3 DOD 119 297 297 DOD DOD A . C 3 DOD 120 301 301 DOD DOD A . C 3 DOD 121 302 302 DOD DOD A . C 3 DOD 122 303 303 DOD DOD A . C 3 DOD 123 306 306 DOD DOD A . C 3 DOD 124 313 313 DOD DOD A . C 3 DOD 125 316 316 DOD DOD A . C 3 DOD 126 319 319 DOD DOD A . C 3 DOD 127 320 320 DOD DOD A . C 3 DOD 128 321 321 DOD DOD A . # _cell.entry_id 5RSA _cell.length_a 30.180 _cell.length_b 38.400 _cell.length_c 53.320 _cell.angle_alpha 90.00 _cell.angle_beta 105.85 _cell.angle_gamma 90.00 _cell.Z_PDB 2 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5RSA _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 # loop_ _exptl.entry_id _exptl.method _exptl.crystals_number 5RSA 'X-RAY DIFFRACTION' 1 5RSA 'NEUTRON DIFFRACTION' 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.17 _exptl_crystal.density_percent_sol 43.25 _exptl_crystal.description ;DATA WERE COLLECTED ON DEUTERATED CRYSTALS. THE SOLVENT IS TERTIARY BUTANOL. AMIDE HYDROGENS WHICH EXCHANGED LESS THAN 50 PER CENT ARE ENTERED AS H, OTHERS ARE ENTERED AS D. ; # loop_ _refine.entry_id _refine.ls_number_reflns_obs _refine.ls_number_reflns_all _refine.pdbx_ls_sigma_I _refine.pdbx_ls_sigma_F _refine.pdbx_data_cutoff_high_absF _refine.pdbx_data_cutoff_low_absF _refine.pdbx_data_cutoff_high_rms_absF _refine.ls_d_res_low _refine.ls_d_res_high _refine.ls_percent_reflns_obs _refine.ls_R_factor_obs _refine.ls_R_factor_all _refine.ls_R_factor_R_work _refine.ls_R_factor_R_free _refine.ls_R_factor_R_free_error _refine.ls_R_factor_R_free_error_details _refine.ls_percent_reflns_R_free _refine.ls_number_reflns_R_free _refine.ls_number_parameters _refine.ls_number_restraints _refine.occupancy_min _refine.occupancy_max _refine.B_iso_mean _refine.aniso_B[1][1] _refine.aniso_B[2][2] _refine.aniso_B[3][3] _refine.aniso_B[1][2] _refine.aniso_B[1][3] _refine.aniso_B[2][3] _refine.solvent_model_details _refine.solvent_model_param_ksol _refine.solvent_model_param_bsol _refine.pdbx_ls_cross_valid_method _refine.details _refine.pdbx_starting_model _refine.pdbx_method_to_determine_struct _refine.pdbx_isotropic_thermal_model _refine.pdbx_stereochemistry_target_values _refine.pdbx_stereochem_target_val_spec_case _refine.pdbx_R_Free_selection_details _refine.pdbx_overall_ESU_R _refine.pdbx_overall_ESU_R_Free _refine.overall_SU_ML _refine.overall_SU_B _refine.pdbx_refine_id _refine.pdbx_diffrn_id _refine.pdbx_TLS_residual_ADP_flag _refine.correlation_coeff_Fo_to_Fc _refine.correlation_coeff_Fo_to_Fc_free _refine.pdbx_solvent_vdw_probe_radii _refine.pdbx_solvent_ion_probe_radii _refine.pdbx_solvent_shrinkage_radii _refine.pdbx_overall_phase_error _refine.overall_SU_R_Cruickshank_DPI _refine.pdbx_overall_SU_R_free_Cruickshank_DPI _refine.pdbx_overall_SU_R_Blow_DPI _refine.pdbx_overall_SU_R_free_Blow_DPI 5RSA 7708 ? ? ? ? ? ? 10.0 2.0 95.6 0.159 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? 5RSA 4132 ? ? ? ? ? ? ? 2.0 51 0.183 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'NEUTRON DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? # _refine_hist.pdbx_refine_id 'NEUTRON DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 951 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 128 _refine_hist.number_atoms_total 1084 _refine_hist.d_res_high 2.0 _refine_hist.d_res_low 10.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function o_bond_d 0.023 ? ? ? 'X-RAY DIFFRACTION' ? o_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? o_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? o_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? o_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? o_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? o_angle_deg ? ? ? ? 'X-RAY DIFFRACTION' ? o_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? o_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? o_dihedral_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? o_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? o_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? o_improper_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? o_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? o_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? o_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? o_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? o_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? o_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _database_PDB_matrix.entry_id 5RSA _database_PDB_matrix.origx[1][1] 0.033135 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.009407 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 0.026042 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 0.019496 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 5RSA _struct.title 'COMPARISON OF TWO INDEPENDENTLY REFINED MODELS OF RIBONUCLEASE-A' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 5RSA _struct_keywords.pdbx_keywords Hydrolase/RNA _struct_keywords.text 'HYDROLASE-RNA Complex' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RNAS1_BOVIN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P61823 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MALKSLVLLSLLVLVLLLVRVQPSLGKETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADV QAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5RSA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 124 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P61823 _struct_ref_seq.db_align_beg 27 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 150 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 124 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 H1 THR A 3 ? MET A 13 ? THR A 3 MET A 13 1 ? 11 HELX_P HELX_P2 H2 ASN A 24 ? ASN A 34 ? ASN A 24 ASN A 34 1 'RESIDUE 34 IN 3/10 CONFIG' 11 HELX_P HELX_P3 H3 SER A 50 ? GLN A 60 ? SER A 50 GLN A 60 1 'RESIDUES 56-60 IN 3/10 CONFIG' 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 26 SG ? ? ? 1_555 A CYS 84 SG ? ? A CYS 26 A CYS 84 1_555 ? ? ? ? ? ? ? 2.037 ? ? disulf2 disulf ? ? A CYS 40 SG ? ? ? 1_555 A CYS 95 SG ? ? A CYS 40 A CYS 95 1_555 ? ? ? ? ? ? ? 1.969 ? ? disulf3 disulf ? ? A CYS 58 SG ? ? ? 1_555 A CYS 110 SG ? ? A CYS 58 A CYS 110 1_555 ? ? ? ? ? ? ? 1.954 ? ? disulf4 disulf ? ? A CYS 65 SG ? ? ? 1_555 A CYS 72 SG ? ? A CYS 65 A CYS 72 1_555 ? ? ? ? ? ? ? 1.941 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 26 ? CYS A 84 ? CYS A 26 ? 1_555 CYS A 84 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 40 ? CYS A 95 ? CYS A 40 ? 1_555 CYS A 95 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 58 ? CYS A 110 ? CYS A 58 ? 1_555 CYS A 110 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 65 ? CYS A 72 ? CYS A 65 ? 1_555 CYS A 72 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TYR 92 A . ? TYR 92 A PRO 93 A ? PRO 93 A 1 3.69 2 ASN 113 A . ? ASN 113 A PRO 114 A ? PRO 114 A 1 4.00 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details S1A ? 3 ? S1B ? 3 ? S2A ? 4 ? S2B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense S1A 1 2 ? anti-parallel S1A 2 3 ? anti-parallel S1B 1 2 ? anti-parallel S1B 2 3 ? anti-parallel S2A 1 2 ? anti-parallel S2A 2 3 ? anti-parallel S2A 3 4 ? anti-parallel S2B 1 2 ? anti-parallel S2B 2 3 ? anti-parallel S2B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S1A 1 LYS A 41 ? HIS A 48 ? LYS A 41 HIS A 48 S1A 2 MET A 79 ? THR A 87 ? MET A 79 THR A 87 S1A 3 ASN A 94 ? LYS A 104 ? ASN A 94 LYS A 104 S1B 1 LYS A 41 ? HIS A 48 ? LYS A 41 HIS A 48 S1B 2 SER A 90 ? LYS A 91 ? SER A 90 LYS A 91 S1B 3 ASN A 94 ? LYS A 104 ? ASN A 94 LYS A 104 S2A 1 LYS A 61 ? ALA A 64 ? LYS A 61 ALA A 64 S2A 2 ASN A 71 ? SER A 75 ? ASN A 71 SER A 75 S2A 3 HIS A 105 ? ASN A 113 ? HIS A 105 ASN A 113 S2A 4 PRO A 114 ? HIS A 119 ? PRO A 114 HIS A 119 S2B 1 LYS A 61 ? ALA A 64 ? LYS A 61 ALA A 64 S2B 2 ASN A 71 ? SER A 75 ? ASN A 71 SER A 75 S2B 3 HIS A 105 ? ASN A 113 ? HIS A 105 ASN A 113 S2B 4 ASP A 121 ? VAL A 124 ? ASP A 121 VAL A 124 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id S1A 1 2 O PRO A 42 ? O PRO A 42 N GLU A 86 ? N GLU A 86 S1A 2 3 N MET A 79 ? N MET A 79 O LYS A 104 ? O LYS A 104 S1B 2 3 N LYS A 91 ? N LYS A 91 O ASN A 94 ? O ASN A 94 S2A 1 2 N VAL A 63 ? N VAL A 63 O CYS A 72 ? O CYS A 72 S2A 2 3 N TYR A 73 ? N TYR A 73 O VAL A 108 ? O VAL A 108 S2A 3 4 N GLU A 111 ? N GLU A 111 O VAL A 116 ? O VAL A 116 S2B 1 2 N VAL A 63 ? N VAL A 63 O CYS A 72 ? O CYS A 72 S2B 2 3 N TYR A 73 ? N TYR A 73 O VAL A 108 ? O VAL A 108 S2B 3 4 O HIS A 105 ? O HIS A 105 N VAL A 124 ? N VAL A 124 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details ACT Author ? ? ? ? 9 'ACTIVE SITE OF ENZYME' AC1 Software A PO4 125 ? 6 'BINDING SITE FOR RESIDUE PO4 A 125' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 ACT 9 HIS A 12 ? HIS A 12 . ? 1_555 ? 2 ACT 9 LYS A 41 ? LYS A 41 . ? 1_555 ? 3 ACT 9 VAL A 43 ? VAL A 43 . ? 1_555 ? 4 ACT 9 ASN A 44 ? ASN A 44 . ? 1_555 ? 5 ACT 9 THR A 45 ? THR A 45 . ? 1_555 ? 6 ACT 9 HIS A 119 ? HIS A 119 . ? 1_555 ? 7 ACT 9 PHE A 120 ? PHE A 120 . ? 1_555 ? 8 ACT 9 ASP A 121 ? ASP A 121 . ? 1_555 ? 9 ACT 9 SER A 123 ? SER A 123 . ? 1_555 ? 10 AC1 6 GLN A 11 ? GLN A 11 . ? 1_555 ? 11 AC1 6 HIS A 12 ? HIS A 12 . ? 1_555 ? 12 AC1 6 LYS A 41 ? LYS A 41 . ? 1_555 ? 13 AC1 6 HIS A 119 ? HIS A 119 . ? 1_555 ? 14 AC1 6 PHE A 120 ? PHE A 120 . ? 1_555 ? 15 AC1 6 DOD C . ? DOD A 160 . ? 1_555 ? # _pdbx_entry_details.entry_id 5RSA _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A CYS 40 ? ? D1 A DOD 260 ? ? 1.25 2 1 DG A SER 123 ? ? O A DOD 206 ? ? 1.26 3 1 DD22 A ASN 94 ? ? O A DOD 191 ? ? 1.38 4 1 OD1 A ASN 103 ? ? D1 A DOD 222 ? ? 1.39 5 1 DD1 A HIS 119 ? ? O1 A PO4 125 ? ? 1.44 6 1 OD2 A ASP 53 ? ? D2 A DOD 184 ? ? 1.48 7 1 OE1 A GLU 111 ? ? D1 A DOD 271 ? ? 1.50 8 1 O A CYS 58 ? ? D1 A DOD 185 ? ? 1.50 9 1 O A DOD 220 ? ? D2 A DOD 276 ? ? 1.51 10 1 DE2 A HIS 48 ? ? OG1 A THR 82 ? ? 1.52 11 1 O A DOD 166 ? ? D2 A DOD 243 ? ? 1.55 12 1 O A VAL 118 ? ? D1 A DOD 211 ? ? 1.59 13 1 D2 A DOD 198 ? ? O A DOD 253 ? ? 1.60 14 1 O A DOD 198 ? ? O A DOD 253 ? ? 1.80 15 1 O A CYS 40 ? ? O A DOD 260 ? ? 2.12 16 1 O A CYS 58 ? ? O A DOD 185 ? ? 2.19 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A DOD 188 ? ? 1_555 O A DOD 306 ? ? 1_655 1.98 2 1 OD2 A ASP 38 ? ? 1_555 CG2 A THR 70 ? ? 2_745 2.14 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLU 86 ? ? OE1 A GLU 86 ? ? 1.168 1.252 -0.084 0.011 N 2 1 CD A GLU 86 ? ? OE2 A GLU 86 ? ? 1.177 1.252 -0.075 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 OE1 A GLU 9 ? ? CD A GLU 9 ? ? OE2 A GLU 9 ? ? 136.01 123.30 12.71 1.20 N 2 1 CD A ARG 10 ? ? NE A ARG 10 ? ? CZ A ARG 10 ? ? 134.39 123.60 10.79 1.40 N 3 1 NH1 A ARG 10 ? ? CZ A ARG 10 ? ? NH2 A ARG 10 ? ? 112.24 119.40 -7.16 1.10 N 4 1 NE A ARG 10 ? ? CZ A ARG 10 ? ? NH1 A ARG 10 ? ? 137.91 120.30 17.61 0.50 N 5 1 NE A ARG 10 ? ? CZ A ARG 10 ? ? NH2 A ARG 10 ? ? 109.79 120.30 -10.51 0.50 N 6 1 CA A HIS 12 ? ? C A HIS 12 ? ? O A HIS 12 ? ? 106.93 120.10 -13.17 2.10 N 7 1 N A THR 17 ? ? CA A THR 17 ? ? CB A THR 17 ? ? 93.31 110.30 -16.99 1.90 N 8 1 OG1 A THR 17 ? ? CB A THR 17 ? ? CG2 A THR 17 ? ? 124.83 110.00 14.83 2.30 N 9 1 N A ALA 20 ? ? CA A ALA 20 ? ? CB A ALA 20 ? ? 101.16 110.10 -8.94 1.40 N 10 1 NE A ARG 33 ? ? CZ A ARG 33 ? ? NH1 A ARG 33 ? ? 130.65 120.30 10.35 0.50 N 11 1 NE A ARG 33 ? ? CZ A ARG 33 ? ? NH2 A ARG 33 ? ? 115.34 120.30 -4.96 0.50 N 12 1 CB A ASN 34 ? ? CG A ASN 34 ? ? OD1 A ASN 34 ? ? 105.89 121.60 -15.71 2.00 N 13 1 NE A ARG 39 ? ? CZ A ARG 39 ? ? NH1 A ARG 39 ? ? 125.04 120.30 4.74 0.50 N 14 1 N A THR 70 ? ? CA A THR 70 ? ? CB A THR 70 ? ? 95.72 110.30 -14.58 1.90 N 15 1 CA A THR 70 ? ? CB A THR 70 ? ? OG1 A THR 70 ? ? 94.82 109.00 -14.18 2.10 N 16 1 CA A THR 70 ? ? CB A THR 70 ? ? CG2 A THR 70 ? ? 126.85 112.40 14.45 1.40 N 17 1 CB A TYR 73 ? ? CG A TYR 73 ? ? CD2 A TYR 73 ? ? 115.24 121.00 -5.76 0.60 N 18 1 CB A TYR 73 ? ? CG A TYR 73 ? ? CD1 A TYR 73 ? ? 127.95 121.00 6.95 0.60 N 19 1 N A SER 75 ? ? CA A SER 75 ? ? CB A SER 75 ? ? 119.71 110.50 9.21 1.50 N 20 1 OD1 A ASP 83 ? ? CG A ASP 83 ? ? OD2 A ASP 83 ? ? 136.77 123.30 13.47 1.90 N 21 1 CB A ASP 83 ? ? CG A ASP 83 ? ? OD2 A ASP 83 ? ? 106.90 118.30 -11.40 0.90 N 22 1 NE A ARG 85 ? ? CZ A ARG 85 ? ? NH1 A ARG 85 ? ? 124.42 120.30 4.12 0.50 N 23 1 NE A ARG 85 ? ? CZ A ARG 85 ? ? NH2 A ARG 85 ? ? 117.05 120.30 -3.25 0.50 N 24 1 OE1 A GLU 86 ? ? CD A GLU 86 ? ? OE2 A GLU 86 ? ? 133.00 123.30 9.70 1.20 N 25 1 N A THR 87 ? ? CA A THR 87 ? ? CB A THR 87 ? ? 96.43 110.30 -13.87 1.90 N 26 1 OE1 A GLU 111 ? ? CD A GLU 111 ? ? OE2 A GLU 111 ? ? 130.85 123.30 7.55 1.20 N 27 1 CA A VAL 116 ? ? CB A VAL 116 ? ? CG1 A VAL 116 ? ? 120.10 110.90 9.20 1.50 N 28 1 CB A VAL 118 ? ? CA A VAL 118 ? ? C A VAL 118 ? ? 124.13 111.40 12.73 1.90 N 29 1 N A VAL 118 ? ? CA A VAL 118 ? ? CB A VAL 118 ? ? 90.51 111.50 -20.99 2.20 N 30 1 CG1 A VAL 118 ? ? CB A VAL 118 ? ? CG2 A VAL 118 ? ? 127.86 110.90 16.96 1.60 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 48 ? ? -105.23 64.86 2 1 GLN A 60 ? ? -99.73 -143.14 # _pdbx_database_remark.id 700 _pdbx_database_remark.text ;SHEET THIS STRUCTURE CONTAINS TWO SHEETS. SHEET S1 COMPRISES THREE STRANDS. IN THE SECOND STRAND OF SHEET S1, RESIDUES 88 AND 89 *BULGE OUT*. IN ORDER TO REPRESENT THIS BREAK IN STRAND 2, TWO SHEETS (S1A AND S1B) ARE DEFINED BELOW. STRANDS 1 AND 3 OF *SHEETS* S1A AND S1B ARE, THEREFORE, IDENTICAL AND STRAND 2 DIFFERS. SHEET S2 COMPRISES FOUR STRANDS. RESIDUE 120 DOES NOT PROPERLY BELONG IN STRAND 4 OF SHEET S2. IN ORDER TO REPRESENT THIS BREAK IN STRAND 4, TWO SHEETS (S2A AND S2B) ARE DEFINED BELOW. STRANDS 1,2,3 OF *SHEETS* S2A AND S2B ARE, THEREFORE, IDENTICAL AND STRAND 4 DIFFERS. ; # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 DOD O O N N 88 DOD D1 D N N 89 DOD D2 D N N 90 GLN N N N N 91 GLN CA C N S 92 GLN C C N N 93 GLN O O N N 94 GLN CB C N N 95 GLN CG C N N 96 GLN CD C N N 97 GLN OE1 O N N 98 GLN NE2 N N N 99 GLN OXT O N N 100 GLN H H N N 101 GLN H2 H N N 102 GLN HA H N N 103 GLN HB2 H N N 104 GLN HB3 H N N 105 GLN HG2 H N N 106 GLN HG3 H N N 107 GLN HE21 H N N 108 GLN HE22 H N N 109 GLN HXT H N N 110 GLU N N N N 111 GLU CA C N S 112 GLU C C N N 113 GLU O O N N 114 GLU CB C N N 115 GLU CG C N N 116 GLU CD C N N 117 GLU OE1 O N N 118 GLU OE2 O N N 119 GLU OXT O N N 120 GLU H H N N 121 GLU H2 H N N 122 GLU HA H N N 123 GLU HB2 H N N 124 GLU HB3 H N N 125 GLU HG2 H N N 126 GLU HG3 H N N 127 GLU HE2 H N N 128 GLU HXT H N N 129 GLY N N N N 130 GLY CA C N N 131 GLY C C N N 132 GLY O O N N 133 GLY OXT O N N 134 GLY H H N N 135 GLY H2 H N N 136 GLY HA2 H N N 137 GLY HA3 H N N 138 GLY HXT H N N 139 HIS N N N N 140 HIS CA C N S 141 HIS C C N N 142 HIS O O N N 143 HIS CB C N N 144 HIS CG C Y N 145 HIS ND1 N Y N 146 HIS CD2 C Y N 147 HIS CE1 C Y N 148 HIS NE2 N Y N 149 HIS OXT O N N 150 HIS H H N N 151 HIS H2 H N N 152 HIS HA H N N 153 HIS HB2 H N N 154 HIS HB3 H N N 155 HIS HD1 H N N 156 HIS HD2 H N N 157 HIS HE1 H N N 158 HIS HE2 H N N 159 HIS HXT H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PO4 P P N N 273 PO4 O1 O N N 274 PO4 O2 O N N 275 PO4 O3 O N N 276 PO4 O4 O N N 277 PRO N N N N 278 PRO CA C N S 279 PRO C C N N 280 PRO O O N N 281 PRO CB C N N 282 PRO CG C N N 283 PRO CD C N N 284 PRO OXT O N N 285 PRO H H N N 286 PRO HA H N N 287 PRO HB2 H N N 288 PRO HB3 H N N 289 PRO HG2 H N N 290 PRO HG3 H N N 291 PRO HD2 H N N 292 PRO HD3 H N N 293 PRO HXT H N N 294 SER N N N N 295 SER CA C N S 296 SER C C N N 297 SER O O N N 298 SER CB C N N 299 SER OG O N N 300 SER OXT O N N 301 SER H H N N 302 SER H2 H N N 303 SER HA H N N 304 SER HB2 H N N 305 SER HB3 H N N 306 SER HG H N N 307 SER HXT H N N 308 THR N N N N 309 THR CA C N S 310 THR C C N N 311 THR O O N N 312 THR CB C N R 313 THR OG1 O N N 314 THR CG2 C N N 315 THR OXT O N N 316 THR H H N N 317 THR H2 H N N 318 THR HA H N N 319 THR HB H N N 320 THR HG1 H N N 321 THR HG21 H N N 322 THR HG22 H N N 323 THR HG23 H N N 324 THR HXT H N N 325 TYR N N N N 326 TYR CA C N S 327 TYR C C N N 328 TYR O O N N 329 TYR CB C N N 330 TYR CG C Y N 331 TYR CD1 C Y N 332 TYR CD2 C Y N 333 TYR CE1 C Y N 334 TYR CE2 C Y N 335 TYR CZ C Y N 336 TYR OH O N N 337 TYR OXT O N N 338 TYR H H N N 339 TYR H2 H N N 340 TYR HA H N N 341 TYR HB2 H N N 342 TYR HB3 H N N 343 TYR HD1 H N N 344 TYR HD2 H N N 345 TYR HE1 H N N 346 TYR HE2 H N N 347 TYR HH H N N 348 TYR HXT H N N 349 VAL N N N N 350 VAL CA C N S 351 VAL C C N N 352 VAL O O N N 353 VAL CB C N N 354 VAL CG1 C N N 355 VAL CG2 C N N 356 VAL OXT O N N 357 VAL H H N N 358 VAL H2 H N N 359 VAL HA H N N 360 VAL HB H N N 361 VAL HG11 H N N 362 VAL HG12 H N N 363 VAL HG13 H N N 364 VAL HG21 H N N 365 VAL HG22 H N N 366 VAL HG23 H N N 367 VAL HXT H N N 368 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 DOD O D1 sing N N 83 DOD O D2 sing N N 84 GLN N CA sing N N 85 GLN N H sing N N 86 GLN N H2 sing N N 87 GLN CA C sing N N 88 GLN CA CB sing N N 89 GLN CA HA sing N N 90 GLN C O doub N N 91 GLN C OXT sing N N 92 GLN CB CG sing N N 93 GLN CB HB2 sing N N 94 GLN CB HB3 sing N N 95 GLN CG CD sing N N 96 GLN CG HG2 sing N N 97 GLN CG HG3 sing N N 98 GLN CD OE1 doub N N 99 GLN CD NE2 sing N N 100 GLN NE2 HE21 sing N N 101 GLN NE2 HE22 sing N N 102 GLN OXT HXT sing N N 103 GLU N CA sing N N 104 GLU N H sing N N 105 GLU N H2 sing N N 106 GLU CA C sing N N 107 GLU CA CB sing N N 108 GLU CA HA sing N N 109 GLU C O doub N N 110 GLU C OXT sing N N 111 GLU CB CG sing N N 112 GLU CB HB2 sing N N 113 GLU CB HB3 sing N N 114 GLU CG CD sing N N 115 GLU CG HG2 sing N N 116 GLU CG HG3 sing N N 117 GLU CD OE1 doub N N 118 GLU CD OE2 sing N N 119 GLU OE2 HE2 sing N N 120 GLU OXT HXT sing N N 121 GLY N CA sing N N 122 GLY N H sing N N 123 GLY N H2 sing N N 124 GLY CA C sing N N 125 GLY CA HA2 sing N N 126 GLY CA HA3 sing N N 127 GLY C O doub N N 128 GLY C OXT sing N N 129 GLY OXT HXT sing N N 130 HIS N CA sing N N 131 HIS N H sing N N 132 HIS N H2 sing N N 133 HIS CA C sing N N 134 HIS CA CB sing N N 135 HIS CA HA sing N N 136 HIS C O doub N N 137 HIS C OXT sing N N 138 HIS CB CG sing N N 139 HIS CB HB2 sing N N 140 HIS CB HB3 sing N N 141 HIS CG ND1 sing Y N 142 HIS CG CD2 doub Y N 143 HIS ND1 CE1 doub Y N 144 HIS ND1 HD1 sing N N 145 HIS CD2 NE2 sing Y N 146 HIS CD2 HD2 sing N N 147 HIS CE1 NE2 sing Y N 148 HIS CE1 HE1 sing N N 149 HIS NE2 HE2 sing N N 150 HIS OXT HXT sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PO4 P O1 doub N N 260 PO4 P O2 sing N N 261 PO4 P O3 sing N N 262 PO4 P O4 sing N N 263 PRO N CA sing N N 264 PRO N CD sing N N 265 PRO N H sing N N 266 PRO CA C sing N N 267 PRO CA CB sing N N 268 PRO CA HA sing N N 269 PRO C O doub N N 270 PRO C OXT sing N N 271 PRO CB CG sing N N 272 PRO CB HB2 sing N N 273 PRO CB HB3 sing N N 274 PRO CG CD sing N N 275 PRO CG HG2 sing N N 276 PRO CG HG3 sing N N 277 PRO CD HD2 sing N N 278 PRO CD HD3 sing N N 279 PRO OXT HXT sing N N 280 SER N CA sing N N 281 SER N H sing N N 282 SER N H2 sing N N 283 SER CA C sing N N 284 SER CA CB sing N N 285 SER CA HA sing N N 286 SER C O doub N N 287 SER C OXT sing N N 288 SER CB OG sing N N 289 SER CB HB2 sing N N 290 SER CB HB3 sing N N 291 SER OG HG sing N N 292 SER OXT HXT sing N N 293 THR N CA sing N N 294 THR N H sing N N 295 THR N H2 sing N N 296 THR CA C sing N N 297 THR CA CB sing N N 298 THR CA HA sing N N 299 THR C O doub N N 300 THR C OXT sing N N 301 THR CB OG1 sing N N 302 THR CB CG2 sing N N 303 THR CB HB sing N N 304 THR OG1 HG1 sing N N 305 THR CG2 HG21 sing N N 306 THR CG2 HG22 sing N N 307 THR CG2 HG23 sing N N 308 THR OXT HXT sing N N 309 TYR N CA sing N N 310 TYR N H sing N N 311 TYR N H2 sing N N 312 TYR CA C sing N N 313 TYR CA CB sing N N 314 TYR CA HA sing N N 315 TYR C O doub N N 316 TYR C OXT sing N N 317 TYR CB CG sing N N 318 TYR CB HB2 sing N N 319 TYR CB HB3 sing N N 320 TYR CG CD1 doub Y N 321 TYR CG CD2 sing Y N 322 TYR CD1 CE1 sing Y N 323 TYR CD1 HD1 sing N N 324 TYR CD2 CE2 doub Y N 325 TYR CD2 HD2 sing N N 326 TYR CE1 CZ doub Y N 327 TYR CE1 HE1 sing N N 328 TYR CE2 CZ sing Y N 329 TYR CE2 HE2 sing N N 330 TYR CZ OH sing N N 331 TYR OH HH sing N N 332 TYR OXT HXT sing N N 333 VAL N CA sing N N 334 VAL N H sing N N 335 VAL N H2 sing N N 336 VAL CA C sing N N 337 VAL CA CB sing N N 338 VAL CA HA sing N N 339 VAL C O doub N N 340 VAL C OXT sing N N 341 VAL CB CG1 sing N N 342 VAL CB CG2 sing N N 343 VAL CB HB sing N N 344 VAL CG1 HG11 sing N N 345 VAL CG1 HG12 sing N N 346 VAL CG1 HG13 sing N N 347 VAL CG2 HG21 sing N N 348 VAL CG2 HG22 sing N N 349 VAL CG2 HG23 sing N N 350 VAL OXT HXT sing N N 351 # _atom_sites.entry_id 5RSA _atom_sites.fract_transf_matrix[1][1] 0.033135 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.009407 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.026042 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019496 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # _atom_sites_footnote.id 1 _atom_sites_footnote.text 'RESIDUES 93 AND 114 ARE CIS-PROLINES.' # loop_ _atom_type.symbol C D H N O P S # loop_