data_5SD4 # _entry.id 5SD4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5SD4 pdb_00005sd4 10.2210/pdb5sd4/pdb WWPDB D_1001404357 ? ? # _pdbx_database_status.entry_id 5SD4 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.recvd_initial_deposition_date 2021-12-20 _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # _audit_author.name 'Seattle Structural Genomics Center for Infectious Disease (SSGCID)' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID ? # _citation.id primary _citation.journal_abbrev 'to be published' _citation.title 'Crystal Structure of Dihydrofolate Reductase from Mycobacterium tuberculosis bound to NADP and SDDC Inhibitor SDDC-1218' _citation.year ? _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mayclin, S.J.' 1 ? primary 'Fairman, J.W.' 2 ? primary 'Dranow, D.M.' 3 ? primary 'Conrady, D.G.' 4 ? primary 'Fox III, D.' 5 ? primary 'Lukacs, C.M.' 6 ? primary 'Lorimer, D.D.' 7 ? primary 'Horanyi, P.S.' 8 ? primary 'Edwards, T.E.' 9 ? primary 'Abendroth, J.' 10 ? # _cell.entry_id 5SD4 _cell.length_a 29.530 _cell.length_b 66.920 _cell.length_c 72.040 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5SD4 _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.Int_Tables_number 19 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Dihydrofolate reductase' 19832.365 1 1.5.1.3 ? MtDHFR ? 2 non-polymer syn 'NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' 743.405 1 ? ? ? ? 3 non-polymer syn '3-(2-{3-[(2,4-diamino-6-ethylpyrimidin-5-yl)oxy]propoxy}pyridin-3-yl)prop-2-yn-1-ol' 343.380 1 ? ? ? ? 4 non-polymer syn 1,2-ETHANEDIOL 62.068 5 ? ? ? ? 5 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 6 water nat water 18.015 220 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMVGLIWAQATSGVIGRGGDIPWRLPEDQAHFREITMGHTIVMGRRTWDSLPAKVRPLPGR RNVVLSRQADFMASGAEVVGSLEEALTSPETWVIGGGQVYALALPYATRCEVTEVDIGLPREAGDALAPVLDETWRGETG EWRFSRSGLRYRLYSYHRS ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMVGLIWAQATSGVIGRGGDIPWRLPEDQAHFREITMGHTIVMGRRTWDSLPAKVRPLPGR RNVVLSRQADFMASGAEVVGSLEEALTSPETWVIGGGQVYALALPYATRCEVTEVDIGLPREAGDALAPVLDETWRGETG EWRFSRSGLRYRLYSYHRS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 VAL n 1 23 GLY n 1 24 LEU n 1 25 ILE n 1 26 TRP n 1 27 ALA n 1 28 GLN n 1 29 ALA n 1 30 THR n 1 31 SER n 1 32 GLY n 1 33 VAL n 1 34 ILE n 1 35 GLY n 1 36 ARG n 1 37 GLY n 1 38 GLY n 1 39 ASP n 1 40 ILE n 1 41 PRO n 1 42 TRP n 1 43 ARG n 1 44 LEU n 1 45 PRO n 1 46 GLU n 1 47 ASP n 1 48 GLN n 1 49 ALA n 1 50 HIS n 1 51 PHE n 1 52 ARG n 1 53 GLU n 1 54 ILE n 1 55 THR n 1 56 MET n 1 57 GLY n 1 58 HIS n 1 59 THR n 1 60 ILE n 1 61 VAL n 1 62 MET n 1 63 GLY n 1 64 ARG n 1 65 ARG n 1 66 THR n 1 67 TRP n 1 68 ASP n 1 69 SER n 1 70 LEU n 1 71 PRO n 1 72 ALA n 1 73 LYS n 1 74 VAL n 1 75 ARG n 1 76 PRO n 1 77 LEU n 1 78 PRO n 1 79 GLY n 1 80 ARG n 1 81 ARG n 1 82 ASN n 1 83 VAL n 1 84 VAL n 1 85 LEU n 1 86 SER n 1 87 ARG n 1 88 GLN n 1 89 ALA n 1 90 ASP n 1 91 PHE n 1 92 MET n 1 93 ALA n 1 94 SER n 1 95 GLY n 1 96 ALA n 1 97 GLU n 1 98 VAL n 1 99 VAL n 1 100 GLY n 1 101 SER n 1 102 LEU n 1 103 GLU n 1 104 GLU n 1 105 ALA n 1 106 LEU n 1 107 THR n 1 108 SER n 1 109 PRO n 1 110 GLU n 1 111 THR n 1 112 TRP n 1 113 VAL n 1 114 ILE n 1 115 GLY n 1 116 GLY n 1 117 GLY n 1 118 GLN n 1 119 VAL n 1 120 TYR n 1 121 ALA n 1 122 LEU n 1 123 ALA n 1 124 LEU n 1 125 PRO n 1 126 TYR n 1 127 ALA n 1 128 THR n 1 129 ARG n 1 130 CYS n 1 131 GLU n 1 132 VAL n 1 133 THR n 1 134 GLU n 1 135 VAL n 1 136 ASP n 1 137 ILE n 1 138 GLY n 1 139 LEU n 1 140 PRO n 1 141 ARG n 1 142 GLU n 1 143 ALA n 1 144 GLY n 1 145 ASP n 1 146 ALA n 1 147 LEU n 1 148 ALA n 1 149 PRO n 1 150 VAL n 1 151 LEU n 1 152 ASP n 1 153 GLU n 1 154 THR n 1 155 TRP n 1 156 ARG n 1 157 GLY n 1 158 GLU n 1 159 THR n 1 160 GLY n 1 161 GLU n 1 162 TRP n 1 163 ARG n 1 164 PHE n 1 165 SER n 1 166 ARG n 1 167 SER n 1 168 GLY n 1 169 LEU n 1 170 ARG n 1 171 TYR n 1 172 ARG n 1 173 LEU n 1 174 TYR n 1 175 SER n 1 176 TYR n 1 177 HIS n 1 178 ARG n 1 179 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 179 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'folA, dfrA, Rv2763c, MTV002.28c' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 25618 / H37Rv' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium tuberculosis H37Rv' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83332 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DYR_MYCTU _struct_ref.pdbx_db_accession P9WNX1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MVGLIWAQATSGVIGRGGDIPWRLPEDQAHFREITMGHTIVMGRRTWDSLPAKVRPLPGRRNVVLSRQADFMASGAEVVG SLEEALTSPETWVIGGGQVYALALPYATRCEVTEVDIGLPREAGDALAPVLDETWRGETGEWRFSRSGLRYRLYSYHRS ; _struct_ref.pdbx_align_begin 3 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5SD4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 21 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 179 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P9WNX1 _struct_ref_seq.db_align_beg 3 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 161 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 159 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5SD4 MET A 1 ? UNP P9WNX1 ? ? 'initiating methionine' -19 1 1 5SD4 GLY A 2 ? UNP P9WNX1 ? ? 'expression tag' -18 2 1 5SD4 SER A 3 ? UNP P9WNX1 ? ? 'expression tag' -17 3 1 5SD4 SER A 4 ? UNP P9WNX1 ? ? 'expression tag' -16 4 1 5SD4 HIS A 5 ? UNP P9WNX1 ? ? 'expression tag' -15 5 1 5SD4 HIS A 6 ? UNP P9WNX1 ? ? 'expression tag' -14 6 1 5SD4 HIS A 7 ? UNP P9WNX1 ? ? 'expression tag' -13 7 1 5SD4 HIS A 8 ? UNP P9WNX1 ? ? 'expression tag' -12 8 1 5SD4 HIS A 9 ? UNP P9WNX1 ? ? 'expression tag' -11 9 1 5SD4 HIS A 10 ? UNP P9WNX1 ? ? 'expression tag' -10 10 1 5SD4 SER A 11 ? UNP P9WNX1 ? ? 'expression tag' -9 11 1 5SD4 SER A 12 ? UNP P9WNX1 ? ? 'expression tag' -8 12 1 5SD4 GLY A 13 ? UNP P9WNX1 ? ? 'expression tag' -7 13 1 5SD4 LEU A 14 ? UNP P9WNX1 ? ? 'expression tag' -6 14 1 5SD4 VAL A 15 ? UNP P9WNX1 ? ? 'expression tag' -5 15 1 5SD4 PRO A 16 ? UNP P9WNX1 ? ? 'expression tag' -4 16 1 5SD4 ARG A 17 ? UNP P9WNX1 ? ? 'expression tag' -3 17 1 5SD4 GLY A 18 ? UNP P9WNX1 ? ? 'expression tag' -2 18 1 5SD4 SER A 19 ? UNP P9WNX1 ? ? 'expression tag' -1 19 1 5SD4 HIS A 20 ? UNP P9WNX1 ? ? 'expression tag' 0 20 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 HVR non-polymer . '3-(2-{3-[(2,4-diamino-6-ethylpyrimidin-5-yl)oxy]propoxy}pyridin-3-yl)prop-2-yn-1-ol' ? 'C17 H21 N5 O3' 343.380 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAP non-polymer . 'NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' ;2'-MONOPHOSPHOADENOSINE 5'-DIPHOSPHORIBOSE ; 'C21 H28 N7 O17 P3' 743.405 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 5SD4 _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_percent_sol 32 _exptl_crystal.density_Matthews 1.8 _exptl_crystal.pdbx_mosaicity 0.207 _exptl_crystal.density_meas ? _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.pH . _exptl_crystal_grow.temp 289 _exptl_crystal_grow.pdbx_details 'MCSG4 F7 (295168f7): 200mM Magnesium chloride, 100mM MES:NaOH pH 6.5, 10mg/mL, seeded from 284871d9, cryo 20% EG, puck djl6-7' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.crystal_id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'RAYONIX MX-300' _diffrn_detector.pdbx_collection_date 2017-10-12 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator 'C 111' _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97872 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 21-ID-F' _diffrn_source.pdbx_wavelength_list 0.97872 _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 21-ID-F _diffrn_source.pdbx_wavelength ? # _reflns.entry_id 5SD4 _reflns.pdbx_diffrn_id 1 _reflns.d_resolution_high 1.250 _reflns.d_resolution_low 50 _reflns.pdbx_number_measured_all 279834 _reflns.number_obs 38755 _reflns.pdbx_Rmerge_I_obs 0.040 _reflns.pdbx_netI_over_sigmaI 27.510 _reflns.percent_possible_obs 95.800 _reflns.B_iso_Wilson_estimate 15.122 _reflns.Rmerge_F_obs 1.000 _reflns.observed_criterion_sigma_I -3.000 _reflns.pdbx_Rrim_I_all 0.043 _reflns.pdbx_ordinal 1 _reflns.observed_criterion_sigma_F ? _reflns.number_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_redundancy ? _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_Rpim_I_all ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.pdbx_rejects _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.meanI_over_sigI_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star 1.250 1.280 17016 ? 2567 ? 0.313 5.300 ? ? ? ? ? 2993 ? ? 0.943 ? ? 85.800 0.340 ? ? 1 ? ? 1.280 1.320 19733 ? 2684 ? 0.272 6.640 ? ? ? ? ? 2825 ? ? 0.965 ? ? 95.000 0.293 ? ? 2 ? ? 1.320 1.360 19658 ? 2632 ? 0.246 7.680 ? ? ? ? ? 2793 ? ? 0.973 ? ? 94.200 0.264 ? ? 3 ? ? 1.360 1.400 19306 ? 2589 ? 0.207 9.110 ? ? ? ? ? 2724 ? ? 0.981 ? ? 95.000 0.222 ? ? 4 ? ? 1.400 1.440 18734 ? 2516 ? 0.172 11.020 ? ? ? ? ? 2635 ? ? 0.988 ? ? 95.500 0.185 ? ? 5 ? ? 1.440 1.490 17962 ? 2432 ? 0.139 13.460 ? ? ? ? ? 2538 ? ? 0.991 ? ? 95.800 0.149 ? ? 6 ? ? 1.490 1.550 17453 ? 2352 ? 0.117 16.070 ? ? ? ? ? 2477 ? ? 0.994 ? ? 95.000 0.126 ? ? 7 ? ? 1.550 1.610 16792 ? 2291 ? 0.094 19.740 ? ? ? ? ? 2365 ? ? 0.995 ? ? 96.900 0.101 ? ? 8 ? ? 1.610 1.690 16102 ? 2214 ? 0.081 22.870 ? ? ? ? ? 2280 ? ? 0.997 ? ? 97.100 0.087 ? ? 9 ? ? 1.690 1.770 15479 ? 2119 ? 0.068 26.690 ? ? ? ? ? 2202 ? ? 0.998 ? ? 96.200 0.073 ? ? 10 ? ? 1.770 1.860 14706 ? 2016 ? 0.052 33.570 ? ? ? ? ? 2088 ? ? 0.999 ? ? 96.600 0.056 ? ? 11 ? ? 1.860 1.980 14003 ? 1939 ? 0.041 40.790 ? ? ? ? ? 1991 ? ? 0.999 ? ? 97.400 0.045 ? ? 12 ? ? 1.980 2.110 12990 ? 1813 ? 0.037 45.530 ? ? ? ? ? 1855 ? ? 0.999 ? ? 97.700 0.039 ? ? 13 ? ? 2.110 2.280 12353 ? 1724 ? 0.033 49.370 ? ? ? ? ? 1753 ? ? 0.999 ? ? 98.300 0.035 ? ? 14 ? ? 2.280 2.500 11272 ? 1577 ? 0.029 53.230 ? ? ? ? ? 1599 ? ? 0.999 ? ? 98.600 0.031 ? ? 15 ? ? 2.500 2.800 10356 ? 1459 ? 0.026 59.730 ? ? ? ? ? 1472 ? ? 0.999 ? ? 99.100 0.028 ? ? 16 ? ? 2.800 3.230 9050 ? 1295 ? 0.022 63.350 ? ? ? ? ? 1306 ? ? 1.000 ? ? 99.200 0.024 ? ? 17 ? ? 3.230 3.950 7638 ? 1112 ? 0.020 68.260 ? ? ? ? ? 1125 ? ? 1.000 ? ? 98.800 0.021 ? ? 18 ? ? 3.950 5.590 6021 ? 891 ? 0.018 70.200 ? ? ? ? ? 895 ? ? 1.000 ? ? 99.600 0.020 ? ? 19 ? ? 5.590 ? 3210 ? 533 ? 0.020 64.420 ? ? ? ? ? 547 ? ? 1.000 ? ? 97.400 0.022 ? ? 20 ? ? # _refine.entry_id 5SD4 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_d_res_high 1.2500 _refine.ls_d_res_low 33.4600 _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 95.8100 _refine.ls_number_reflns_obs 38701 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.ls_matrix_type ? _refine.pdbx_R_Free_selection_details ? _refine.details ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1340 _refine.ls_R_factor_R_work 0.1323 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.1634 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 5.3000 _refine.ls_number_reflns_R_free 2052 _refine.ls_number_reflns_R_work 36649 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 16.6904 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.1100 _refine.overall_SU_B ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 54.150 _refine.B_iso_min 4.760 _refine.pdbx_overall_phase_error 14.0700 _refine.occupancy_max 1.000 _refine.occupancy_min 0.090 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_R_factor_R_free_error_details ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1297 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 94 _refine_hist.number_atoms_solvent 220 _refine_hist.number_atoms_total 1611 _refine_hist.d_res_high 1.2500 _refine_hist.d_res_low 33.4600 # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.pdbx_refine_id _refine_ls_shell.R_factor_obs 1.2500 1.2791 15 85.0000 2140 . 0.1645 0.2120 . 127 . 2267 . 'X-RAY DIFFRACTION' . 1.2791 1.3111 15 94.0000 2372 . 0.1481 0.1977 . 133 . 2505 . 'X-RAY DIFFRACTION' . 1.3111 1.3465 15 94.0000 2394 . 0.1419 0.1699 . 126 . 2520 . 'X-RAY DIFFRACTION' . 1.3465 1.3861 15 95.0000 2358 . 0.1327 0.1721 . 136 . 2494 . 'X-RAY DIFFRACTION' . 1.3861 1.4309 15 95.0000 2391 . 0.1282 0.1810 . 133 . 2524 . 'X-RAY DIFFRACTION' . 1.4309 1.4820 15 95.0000 2406 . 0.1249 0.1852 . 133 . 2539 . 'X-RAY DIFFRACTION' . 1.4820 1.5414 15 96.0000 2408 . 0.1236 0.1475 . 138 . 2546 . 'X-RAY DIFFRACTION' . 1.5414 1.6115 15 97.0000 2429 . 0.1257 0.1515 . 149 . 2578 . 'X-RAY DIFFRACTION' . 1.6115 1.6965 15 97.0000 2444 . 0.1198 0.1780 . 142 . 2586 . 'X-RAY DIFFRACTION' . 1.6965 1.8028 15 97.0000 2474 . 0.1267 0.1386 . 132 . 2606 . 'X-RAY DIFFRACTION' . 1.8028 1.9419 15 97.0000 2500 . 0.1260 0.1634 . 128 . 2628 . 'X-RAY DIFFRACTION' . 1.9419 2.1373 15 97.0000 2492 . 0.1251 0.1655 . 140 . 2632 . 'X-RAY DIFFRACTION' . 2.1373 2.4465 15 99.0000 2530 . 0.1369 0.1556 . 152 . 2682 . 'X-RAY DIFFRACTION' . 2.4465 3.0820 15 99.0000 2572 . 0.1403 0.1759 . 148 . 2720 . 'X-RAY DIFFRACTION' . 3.0820 33.4720 15 99.0000 2739 . 0.1329 0.1507 . 135 . 2874 . 'X-RAY DIFFRACTION' . # _struct.entry_id 5SD4 _struct.title 'Crystal Structure of Dihydrofolate Reductase from Mycobacterium tuberculosis bound to NADP and SDDC Inhibitor SDDC-1218' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 5SD4 _struct_keywords.text ;Mycobacterium tuberculosis, DHFR, NADP, Folate, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID ; _struct_keywords.pdbx_keywords 'OXIDOREDUCTASE/OXIDOREDUCTASE INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 4 ? G N N 4 ? H N N 4 ? I N N 5 ? J N N 6 ? # _struct_biol.id 1 _struct_biol.details 'biological unit is a monomer, the same as asu' # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 44 ? MET A 56 ? LEU A 24 MET A 36 1 ? 13 HELX_P HELX_P2 AA2 ARG A 64 ? LEU A 70 ? ARG A 44 LEU A 50 1 ? 7 HELX_P HELX_P3 AA3 PRO A 71 ? ARG A 75 ? PRO A 51 ARG A 55 5 ? 5 HELX_P HELX_P4 AA4 SER A 101 ? LEU A 106 ? SER A 81 LEU A 86 1 ? 6 HELX_P HELX_P5 AA5 GLY A 116 ? LEU A 124 ? GLY A 96 LEU A 104 1 ? 9 HELX_P HELX_P6 AA6 PRO A 125 ? ALA A 127 ? PRO A 105 ALA A 107 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ARG 75 A . ? ARG 55 A PRO 76 A ? PRO 56 A 1 -0.75 2 GLY 115 A . ? GLY 95 A GLY 116 A ? GLY 96 A 1 4.15 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 8 ? AA2 ? 8 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? parallel AA2 4 5 ? parallel AA2 5 6 ? parallel AA2 6 7 ? anti-parallel AA2 7 8 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 97 ? VAL A 99 ? GLU A 77 VAL A 79 AA1 2 ARG A 81 ? LEU A 85 ? ARG A 61 LEU A 65 AA1 3 THR A 59 ? GLY A 63 ? THR A 39 GLY A 43 AA1 4 GLU A 110 ? VAL A 113 ? GLU A 90 VAL A 93 AA1 5 MET A 21 ? ALA A 29 ? MET A 1 ALA A 9 AA1 6 ARG A 129 ? VAL A 135 ? ARG A 109 VAL A 115 AA1 7 ARG A 170 ? HIS A 177 ? ARG A 150 HIS A 157 AA1 8 ARG A 156 ? THR A 159 ? ARG A 136 THR A 139 AA2 1 GLU A 97 ? VAL A 99 ? GLU A 77 VAL A 79 AA2 2 ARG A 81 ? LEU A 85 ? ARG A 61 LEU A 65 AA2 3 THR A 59 ? GLY A 63 ? THR A 39 GLY A 43 AA2 4 GLU A 110 ? VAL A 113 ? GLU A 90 VAL A 93 AA2 5 MET A 21 ? ALA A 29 ? MET A 1 ALA A 9 AA2 6 ARG A 129 ? VAL A 135 ? ARG A 109 VAL A 115 AA2 7 ARG A 170 ? HIS A 177 ? ARG A 150 HIS A 157 AA2 8 ARG A 163 ? PHE A 164 ? ARG A 143 PHE A 144 AA3 1 VAL A 33 ? GLY A 35 ? VAL A 13 GLY A 15 AA3 2 ALA A 146 ? LEU A 147 ? ALA A 126 LEU A 127 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 97 ? O GLU A 77 N VAL A 84 ? N VAL A 64 AA1 2 3 O ARG A 81 ? O ARG A 61 N ILE A 60 ? N ILE A 40 AA1 3 4 N THR A 59 ? N THR A 39 O TRP A 112 ? O TRP A 92 AA1 4 5 O VAL A 113 ? O VAL A 93 N GLY A 23 ? N GLY A 3 AA1 5 6 N GLN A 28 ? N GLN A 8 O VAL A 135 ? O VAL A 115 AA1 6 7 N GLU A 134 ? N GLU A 114 O ARG A 172 ? O ARG A 152 AA1 7 8 O HIS A 177 ? O HIS A 157 N ARG A 156 ? N ARG A 136 AA2 1 2 O GLU A 97 ? O GLU A 77 N VAL A 84 ? N VAL A 64 AA2 2 3 O ARG A 81 ? O ARG A 61 N ILE A 60 ? N ILE A 40 AA2 3 4 N THR A 59 ? N THR A 39 O TRP A 112 ? O TRP A 92 AA2 4 5 O VAL A 113 ? O VAL A 93 N GLY A 23 ? N GLY A 3 AA2 5 6 N GLN A 28 ? N GLN A 8 O VAL A 135 ? O VAL A 115 AA2 6 7 N GLU A 134 ? N GLU A 114 O ARG A 172 ? O ARG A 152 AA2 7 8 O TYR A 171 ? O TYR A 151 N ARG A 163 ? N ARG A 143 AA3 1 2 N ILE A 34 ? N ILE A 14 O ALA A 146 ? O ALA A 126 # _atom_sites.entry_id 5SD4 _atom_sites.fract_transf_matrix[1][1] 0.033864 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014943 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013881 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CL N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -19 ? ? ? A . n A 1 2 GLY 2 -18 ? ? ? A . n A 1 3 SER 3 -17 ? ? ? A . n A 1 4 SER 4 -16 ? ? ? A . n A 1 5 HIS 5 -15 ? ? ? A . n A 1 6 HIS 6 -14 ? ? ? A . n A 1 7 HIS 7 -13 ? ? ? A . n A 1 8 HIS 8 -12 ? ? ? A . n A 1 9 HIS 9 -11 ? ? ? A . n A 1 10 HIS 10 -10 ? ? ? A . n A 1 11 SER 11 -9 ? ? ? A . n A 1 12 SER 12 -8 ? ? ? A . n A 1 13 GLY 13 -7 ? ? ? A . n A 1 14 LEU 14 -6 -6 LEU LEU A . n A 1 15 VAL 15 -5 -5 VAL VAL A . n A 1 16 PRO 16 -4 -4 PRO PRO A . n A 1 17 ARG 17 -3 -3 ARG ARG A . n A 1 18 GLY 18 -2 -2 GLY GLY A . n A 1 19 SER 19 -1 -1 SER SER A . n A 1 20 HIS 20 0 0 HIS HIS A . n A 1 21 MET 21 1 1 MET MET A . n A 1 22 VAL 22 2 2 VAL VAL A . n A 1 23 GLY 23 3 3 GLY GLY A . n A 1 24 LEU 24 4 4 LEU LEU A . n A 1 25 ILE 25 5 5 ILE ILE A . n A 1 26 TRP 26 6 6 TRP TRP A . n A 1 27 ALA 27 7 7 ALA ALA A . n A 1 28 GLN 28 8 8 GLN GLN A . n A 1 29 ALA 29 9 9 ALA ALA A . n A 1 30 THR 30 10 10 THR THR A . n A 1 31 SER 31 11 11 SER SER A . n A 1 32 GLY 32 12 12 GLY GLY A . n A 1 33 VAL 33 13 13 VAL VAL A . n A 1 34 ILE 34 14 14 ILE ILE A . n A 1 35 GLY 35 15 15 GLY GLY A . n A 1 36 ARG 36 16 16 ARG ARG A . n A 1 37 GLY 37 17 17 GLY GLY A . n A 1 38 GLY 38 18 18 GLY GLY A . n A 1 39 ASP 39 19 19 ASP ASP A . n A 1 40 ILE 40 20 20 ILE ILE A . n A 1 41 PRO 41 21 21 PRO PRO A . n A 1 42 TRP 42 22 22 TRP TRP A . n A 1 43 ARG 43 23 23 ARG ARG A . n A 1 44 LEU 44 24 24 LEU LEU A . n A 1 45 PRO 45 25 25 PRO PRO A . n A 1 46 GLU 46 26 26 GLU GLU A . n A 1 47 ASP 47 27 27 ASP ASP A . n A 1 48 GLN 48 28 28 GLN GLN A . n A 1 49 ALA 49 29 29 ALA ALA A . n A 1 50 HIS 50 30 30 HIS HIS A . n A 1 51 PHE 51 31 31 PHE PHE A . n A 1 52 ARG 52 32 32 ARG ARG A . n A 1 53 GLU 53 33 33 GLU GLU A . n A 1 54 ILE 54 34 34 ILE ILE A . n A 1 55 THR 55 35 35 THR THR A . n A 1 56 MET 56 36 36 MET MET A . n A 1 57 GLY 57 37 37 GLY GLY A . n A 1 58 HIS 58 38 38 HIS HIS A . n A 1 59 THR 59 39 39 THR THR A . n A 1 60 ILE 60 40 40 ILE ILE A . n A 1 61 VAL 61 41 41 VAL VAL A . n A 1 62 MET 62 42 42 MET MET A . n A 1 63 GLY 63 43 43 GLY GLY A . n A 1 64 ARG 64 44 44 ARG ARG A . n A 1 65 ARG 65 45 45 ARG ARG A . n A 1 66 THR 66 46 46 THR THR A . n A 1 67 TRP 67 47 47 TRP TRP A . n A 1 68 ASP 68 48 48 ASP ASP A . n A 1 69 SER 69 49 49 SER SER A . n A 1 70 LEU 70 50 50 LEU LEU A . n A 1 71 PRO 71 51 51 PRO PRO A . n A 1 72 ALA 72 52 52 ALA ALA A . n A 1 73 LYS 73 53 53 LYS LYS A . n A 1 74 VAL 74 54 54 VAL VAL A . n A 1 75 ARG 75 55 55 ARG ARG A . n A 1 76 PRO 76 56 56 PRO PRO A . n A 1 77 LEU 77 57 57 LEU LEU A . n A 1 78 PRO 78 58 58 PRO PRO A . n A 1 79 GLY 79 59 59 GLY GLY A . n A 1 80 ARG 80 60 60 ARG ARG A . n A 1 81 ARG 81 61 61 ARG ARG A . n A 1 82 ASN 82 62 62 ASN ASN A . n A 1 83 VAL 83 63 63 VAL VAL A . n A 1 84 VAL 84 64 64 VAL VAL A . n A 1 85 LEU 85 65 65 LEU LEU A . n A 1 86 SER 86 66 66 SER SER A . n A 1 87 ARG 87 67 67 ARG ARG A . n A 1 88 GLN 88 68 68 GLN GLN A . n A 1 89 ALA 89 69 69 ALA ALA A . n A 1 90 ASP 90 70 70 ASP ASP A . n A 1 91 PHE 91 71 71 PHE PHE A . n A 1 92 MET 92 72 72 MET MET A . n A 1 93 ALA 93 73 73 ALA ALA A . n A 1 94 SER 94 74 74 SER SER A . n A 1 95 GLY 95 75 75 GLY GLY A . n A 1 96 ALA 96 76 76 ALA ALA A . n A 1 97 GLU 97 77 77 GLU GLU A . n A 1 98 VAL 98 78 78 VAL VAL A . n A 1 99 VAL 99 79 79 VAL VAL A . n A 1 100 GLY 100 80 80 GLY GLY A . n A 1 101 SER 101 81 81 SER SER A . n A 1 102 LEU 102 82 82 LEU LEU A . n A 1 103 GLU 103 83 83 GLU GLU A . n A 1 104 GLU 104 84 84 GLU GLU A . n A 1 105 ALA 105 85 85 ALA ALA A . n A 1 106 LEU 106 86 86 LEU LEU A . n A 1 107 THR 107 87 87 THR THR A . n A 1 108 SER 108 88 88 SER SER A . n A 1 109 PRO 109 89 89 PRO PRO A . n A 1 110 GLU 110 90 90 GLU GLU A . n A 1 111 THR 111 91 91 THR THR A . n A 1 112 TRP 112 92 92 TRP TRP A . n A 1 113 VAL 113 93 93 VAL VAL A . n A 1 114 ILE 114 94 94 ILE ILE A . n A 1 115 GLY 115 95 95 GLY GLY A . n A 1 116 GLY 116 96 96 GLY GLY A . n A 1 117 GLY 117 97 97 GLY GLY A . n A 1 118 GLN 118 98 98 GLN GLN A . n A 1 119 VAL 119 99 99 VAL VAL A . n A 1 120 TYR 120 100 100 TYR TYR A . n A 1 121 ALA 121 101 101 ALA ALA A . n A 1 122 LEU 122 102 102 LEU LEU A . n A 1 123 ALA 123 103 103 ALA ALA A . n A 1 124 LEU 124 104 104 LEU LEU A . n A 1 125 PRO 125 105 105 PRO PRO A . n A 1 126 TYR 126 106 106 TYR TYR A . n A 1 127 ALA 127 107 107 ALA ALA A . n A 1 128 THR 128 108 108 THR THR A . n A 1 129 ARG 129 109 109 ARG ARG A . n A 1 130 CYS 130 110 110 CYS CYS A . n A 1 131 GLU 131 111 111 GLU GLU A . n A 1 132 VAL 132 112 112 VAL VAL A . n A 1 133 THR 133 113 113 THR THR A . n A 1 134 GLU 134 114 114 GLU GLU A . n A 1 135 VAL 135 115 115 VAL VAL A . n A 1 136 ASP 136 116 116 ASP ASP A . n A 1 137 ILE 137 117 117 ILE ILE A . n A 1 138 GLY 138 118 118 GLY GLY A . n A 1 139 LEU 139 119 119 LEU LEU A . n A 1 140 PRO 140 120 120 PRO PRO A . n A 1 141 ARG 141 121 121 ARG ARG A . n A 1 142 GLU 142 122 122 GLU GLU A . n A 1 143 ALA 143 123 123 ALA ALA A . n A 1 144 GLY 144 124 124 GLY GLY A . n A 1 145 ASP 145 125 125 ASP ASP A . n A 1 146 ALA 146 126 126 ALA ALA A . n A 1 147 LEU 147 127 127 LEU LEU A . n A 1 148 ALA 148 128 128 ALA ALA A . n A 1 149 PRO 149 129 129 PRO PRO A . n A 1 150 VAL 150 130 130 VAL VAL A . n A 1 151 LEU 151 131 131 LEU LEU A . n A 1 152 ASP 152 132 132 ASP ASP A . n A 1 153 GLU 153 133 133 GLU GLU A . n A 1 154 THR 154 134 134 THR THR A . n A 1 155 TRP 155 135 135 TRP TRP A . n A 1 156 ARG 156 136 136 ARG ARG A . n A 1 157 GLY 157 137 137 GLY GLY A . n A 1 158 GLU 158 138 138 GLU GLU A . n A 1 159 THR 159 139 139 THR THR A . n A 1 160 GLY 160 140 140 GLY GLY A . n A 1 161 GLU 161 141 141 GLU GLU A . n A 1 162 TRP 162 142 142 TRP TRP A . n A 1 163 ARG 163 143 143 ARG ARG A . n A 1 164 PHE 164 144 144 PHE PHE A . n A 1 165 SER 165 145 145 SER SER A . n A 1 166 ARG 166 146 146 ARG ARG A . n A 1 167 SER 167 147 147 SER SER A . n A 1 168 GLY 168 148 148 GLY GLY A . n A 1 169 LEU 169 149 149 LEU LEU A . n A 1 170 ARG 170 150 150 ARG ARG A . n A 1 171 TYR 171 151 151 TYR TYR A . n A 1 172 ARG 172 152 152 ARG ARG A . n A 1 173 LEU 173 153 153 LEU LEU A . n A 1 174 TYR 174 154 154 TYR TYR A . n A 1 175 SER 175 155 155 SER SER A . n A 1 176 TYR 176 156 156 TYR TYR A . n A 1 177 HIS 177 157 157 HIS HIS A . n A 1 178 ARG 178 158 158 ARG ARG A . n A 1 179 SER 179 159 159 SER SER A . n # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 isabelle.phan@seattlechildrens.org Isabelle Phan ? 'principal investigator/group leader' 0000-0001-6873-3401 3 peter.myler@seattlechildrens.org Peter Myler ? 'principal investigator/group leader' 0000-0002-0056-0513 4 julie.early@seattlechildrens.org Julie Early ? 'principal investigator/group leader' 0000-0003-1224-2747 5 donald.lorimer@ucb.com Don Lorimer ? 'principal investigator/group leader' 0000-0002-9638-8083 6 peter.horanyi@ucb.com Peter Horanyi ? 'principal investigator/group leader' 0000-0003-2218-9986 7 tom.edwards@ucb.com Tom Edwards ? 'principal investigator/group leader' 0000-0002-0474-8003 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NIAID, National Institute of Allergy and Infectious Diseases' _pdbx_SG_project.full_name_of_center 'Seattle Structural Genomics Center for Infectious Disease' _pdbx_SG_project.initial_of_center SSGCID # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NAP 1 201 160 NAP NAP A . C 3 HVR 1 202 161 HVR 218 A . D 4 EDO 1 203 162 EDO EDO A . E 4 EDO 1 204 163 EDO EDO A . F 4 EDO 1 205 164 EDO EDO A . G 4 EDO 1 206 165 EDO EDO A . H 4 EDO 1 207 166 EDO EDO A . I 5 CL 1 208 167 CL CL A . J 6 HOH 1 301 142 HOH HOH A . J 6 HOH 2 302 132 HOH HOH A . J 6 HOH 3 303 136 HOH HOH A . J 6 HOH 4 304 181 HOH HOH A . J 6 HOH 5 305 71 HOH HOH A . J 6 HOH 6 306 24 HOH HOH A . J 6 HOH 7 307 190 HOH HOH A . J 6 HOH 8 308 164 HOH HOH A . J 6 HOH 9 309 191 HOH HOH A . J 6 HOH 10 310 63 HOH HOH A . J 6 HOH 11 311 67 HOH HOH A . J 6 HOH 12 312 198 HOH HOH A . J 6 HOH 13 313 107 HOH HOH A . J 6 HOH 14 314 12 HOH HOH A . J 6 HOH 15 315 177 HOH HOH A . J 6 HOH 16 316 129 HOH HOH A . J 6 HOH 17 317 86 HOH HOH A . J 6 HOH 18 318 73 HOH HOH A . J 6 HOH 19 319 156 HOH HOH A . J 6 HOH 20 320 171 HOH HOH A . J 6 HOH 21 321 19 HOH HOH A . J 6 HOH 22 322 204 HOH HOH A . J 6 HOH 23 323 167 HOH HOH A . J 6 HOH 24 324 52 HOH HOH A . J 6 HOH 25 325 45 HOH HOH A . J 6 HOH 26 326 41 HOH HOH A . J 6 HOH 27 327 166 HOH HOH A . J 6 HOH 28 328 69 HOH HOH A . J 6 HOH 29 329 68 HOH HOH A . J 6 HOH 30 330 55 HOH HOH A . J 6 HOH 31 331 185 HOH HOH A . J 6 HOH 32 332 62 HOH HOH A . J 6 HOH 33 333 199 HOH HOH A . J 6 HOH 34 334 11 HOH HOH A . J 6 HOH 35 335 205 HOH HOH A . J 6 HOH 36 336 16 HOH HOH A . J 6 HOH 37 337 163 HOH HOH A . J 6 HOH 38 338 154 HOH HOH A . J 6 HOH 39 339 23 HOH HOH A . J 6 HOH 40 340 147 HOH HOH A . J 6 HOH 41 341 50 HOH HOH A . J 6 HOH 42 342 197 HOH HOH A . J 6 HOH 43 343 178 HOH HOH A . J 6 HOH 44 344 10 HOH HOH A . J 6 HOH 45 345 39 HOH HOH A . J 6 HOH 46 346 195 HOH HOH A . J 6 HOH 47 347 100 HOH HOH A . J 6 HOH 48 348 31 HOH HOH A . J 6 HOH 49 349 151 HOH HOH A . J 6 HOH 50 350 4 HOH HOH A . J 6 HOH 51 351 105 HOH HOH A . J 6 HOH 52 352 141 HOH HOH A . J 6 HOH 53 353 72 HOH HOH A . J 6 HOH 54 354 99 HOH HOH A . J 6 HOH 55 355 28 HOH HOH A . J 6 HOH 56 356 33 HOH HOH A . J 6 HOH 57 357 43 HOH HOH A . J 6 HOH 58 358 74 HOH HOH A . J 6 HOH 59 359 7 HOH HOH A . J 6 HOH 60 360 143 HOH HOH A . J 6 HOH 61 361 162 HOH HOH A . J 6 HOH 62 362 17 HOH HOH A . J 6 HOH 63 363 49 HOH HOH A . J 6 HOH 64 364 51 HOH HOH A . J 6 HOH 65 365 97 HOH HOH A . J 6 HOH 66 366 25 HOH HOH A . J 6 HOH 67 367 32 HOH HOH A . J 6 HOH 68 368 78 HOH HOH A . J 6 HOH 69 369 42 HOH HOH A . J 6 HOH 70 370 30 HOH HOH A . J 6 HOH 71 371 8 HOH HOH A . J 6 HOH 72 372 70 HOH HOH A . J 6 HOH 73 373 98 HOH HOH A . J 6 HOH 74 374 5 HOH HOH A . J 6 HOH 75 375 22 HOH HOH A . J 6 HOH 76 376 64 HOH HOH A . J 6 HOH 77 377 9 HOH HOH A . J 6 HOH 78 378 29 HOH HOH A . J 6 HOH 79 379 85 HOH HOH A . J 6 HOH 80 380 34 HOH HOH A . J 6 HOH 81 381 76 HOH HOH A . J 6 HOH 82 382 109 HOH HOH A . J 6 HOH 83 383 27 HOH HOH A . J 6 HOH 84 384 192 HOH HOH A . J 6 HOH 85 385 149 HOH HOH A . J 6 HOH 86 386 84 HOH HOH A . J 6 HOH 87 387 14 HOH HOH A . J 6 HOH 88 388 13 HOH HOH A . J 6 HOH 89 389 77 HOH HOH A . J 6 HOH 90 390 38 HOH HOH A . J 6 HOH 91 391 89 HOH HOH A . J 6 HOH 92 392 182 HOH HOH A . J 6 HOH 93 393 54 HOH HOH A . J 6 HOH 94 394 219 HOH HOH A . J 6 HOH 95 395 2 HOH HOH A . J 6 HOH 96 396 35 HOH HOH A . J 6 HOH 97 397 131 HOH HOH A . J 6 HOH 98 398 46 HOH HOH A . J 6 HOH 99 399 57 HOH HOH A . J 6 HOH 100 400 103 HOH HOH A . J 6 HOH 101 401 15 HOH HOH A . J 6 HOH 102 402 6 HOH HOH A . J 6 HOH 103 403 135 HOH HOH A . J 6 HOH 104 404 114 HOH HOH A . J 6 HOH 105 405 122 HOH HOH A . J 6 HOH 106 406 21 HOH HOH A . J 6 HOH 107 407 3 HOH HOH A . J 6 HOH 108 408 145 HOH HOH A . J 6 HOH 109 409 221 HOH HOH A . J 6 HOH 110 410 61 HOH HOH A . J 6 HOH 111 411 40 HOH HOH A . J 6 HOH 112 412 26 HOH HOH A . J 6 HOH 113 413 159 HOH HOH A . J 6 HOH 114 414 94 HOH HOH A . J 6 HOH 115 415 53 HOH HOH A . J 6 HOH 116 416 225 HOH HOH A . J 6 HOH 117 417 165 HOH HOH A . J 6 HOH 118 418 80 HOH HOH A . J 6 HOH 119 419 124 HOH HOH A . J 6 HOH 120 420 150 HOH HOH A . J 6 HOH 121 421 58 HOH HOH A . J 6 HOH 122 422 121 HOH HOH A . J 6 HOH 123 423 125 HOH HOH A . J 6 HOH 124 424 113 HOH HOH A . J 6 HOH 125 425 152 HOH HOH A . J 6 HOH 126 426 186 HOH HOH A . J 6 HOH 127 427 87 HOH HOH A . J 6 HOH 128 428 138 HOH HOH A . J 6 HOH 129 429 127 HOH HOH A . J 6 HOH 130 430 120 HOH HOH A . J 6 HOH 131 431 36 HOH HOH A . J 6 HOH 132 432 106 HOH HOH A . J 6 HOH 133 433 213 HOH HOH A . J 6 HOH 134 434 123 HOH HOH A . J 6 HOH 135 435 134 HOH HOH A . J 6 HOH 136 436 193 HOH HOH A . J 6 HOH 137 437 1 HOH HOH A . J 6 HOH 138 438 144 HOH HOH A . J 6 HOH 139 439 91 HOH HOH A . J 6 HOH 140 440 66 HOH HOH A . J 6 HOH 141 441 158 HOH HOH A . J 6 HOH 142 442 88 HOH HOH A . J 6 HOH 143 443 60 HOH HOH A . J 6 HOH 144 444 196 HOH HOH A . J 6 HOH 145 445 140 HOH HOH A . J 6 HOH 146 446 93 HOH HOH A . J 6 HOH 147 447 108 HOH HOH A . J 6 HOH 148 448 116 HOH HOH A . J 6 HOH 149 449 44 HOH HOH A . J 6 HOH 150 450 168 HOH HOH A . J 6 HOH 151 451 207 HOH HOH A . J 6 HOH 152 452 20 HOH HOH A . J 6 HOH 153 453 112 HOH HOH A . J 6 HOH 154 454 208 HOH HOH A . J 6 HOH 155 455 170 HOH HOH A . J 6 HOH 156 456 161 HOH HOH A . J 6 HOH 157 457 187 HOH HOH A . J 6 HOH 158 458 102 HOH HOH A . J 6 HOH 159 459 48 HOH HOH A . J 6 HOH 160 460 209 HOH HOH A . J 6 HOH 161 461 83 HOH HOH A . J 6 HOH 162 462 146 HOH HOH A . J 6 HOH 163 463 220 HOH HOH A . J 6 HOH 164 464 169 HOH HOH A . J 6 HOH 165 465 206 HOH HOH A . J 6 HOH 166 466 119 HOH HOH A . J 6 HOH 167 467 212 HOH HOH A . J 6 HOH 168 468 176 HOH HOH A . J 6 HOH 169 469 160 HOH HOH A . J 6 HOH 170 470 92 HOH HOH A . J 6 HOH 171 471 59 HOH HOH A . J 6 HOH 172 472 18 HOH HOH A . J 6 HOH 173 473 172 HOH HOH A . J 6 HOH 174 474 217 HOH HOH A . J 6 HOH 175 475 223 HOH HOH A . J 6 HOH 176 476 155 HOH HOH A . J 6 HOH 177 477 194 HOH HOH A . J 6 HOH 178 478 153 HOH HOH A . J 6 HOH 179 479 173 HOH HOH A . J 6 HOH 180 480 118 HOH HOH A . J 6 HOH 181 481 126 HOH HOH A . J 6 HOH 182 482 90 HOH HOH A . J 6 HOH 183 483 148 HOH HOH A . J 6 HOH 184 484 184 HOH HOH A . J 6 HOH 185 485 82 HOH HOH A . J 6 HOH 186 486 157 HOH HOH A . J 6 HOH 187 487 95 HOH HOH A . J 6 HOH 188 488 115 HOH HOH A . J 6 HOH 189 489 175 HOH HOH A . J 6 HOH 190 490 111 HOH HOH A . J 6 HOH 191 491 180 HOH HOH A . J 6 HOH 192 492 65 HOH HOH A . J 6 HOH 193 493 117 HOH HOH A . J 6 HOH 194 494 222 HOH HOH A . J 6 HOH 195 495 130 HOH HOH A . J 6 HOH 196 496 79 HOH HOH A . J 6 HOH 197 497 104 HOH HOH A . J 6 HOH 198 498 224 HOH HOH A . J 6 HOH 199 499 214 HOH HOH A . J 6 HOH 200 500 179 HOH HOH A . J 6 HOH 201 501 128 HOH HOH A . J 6 HOH 202 502 139 HOH HOH A . J 6 HOH 203 503 189 HOH HOH A . J 6 HOH 204 504 137 HOH HOH A . J 6 HOH 205 505 211 HOH HOH A . J 6 HOH 206 506 216 HOH HOH A . J 6 HOH 207 507 133 HOH HOH A . J 6 HOH 208 508 200 HOH HOH A . J 6 HOH 209 509 101 HOH HOH A . J 6 HOH 210 510 81 HOH HOH A . J 6 HOH 211 511 56 HOH HOH A . J 6 HOH 212 512 218 HOH HOH A . J 6 HOH 213 513 96 HOH HOH A . J 6 HOH 214 514 210 HOH HOH A . J 6 HOH 215 515 201 HOH HOH A . J 6 HOH 216 516 188 HOH HOH A . J 6 HOH 217 517 37 HOH HOH A . J 6 HOH 218 518 110 HOH HOH A . J 6 HOH 219 519 183 HOH HOH A . J 6 HOH 220 520 215 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-02-09 2 'Structure model' 1 1 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Other 2 2 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_SG_project 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' struct_keywords # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_database_status.SG_entry' 2 2 'Structure model' '_struct_keywords.text' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? dev_2919 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.11 4 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 6 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 7 # _pdbx_entry_details.entry_id 5SD4 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 447 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 485 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.13 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 21 ? ? -83.17 30.79 2 1 LEU A 86 ? ? -106.46 53.40 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -19 ? A MET 1 2 1 Y 1 A GLY -18 ? A GLY 2 3 1 Y 1 A SER -17 ? A SER 3 4 1 Y 1 A SER -16 ? A SER 4 5 1 Y 1 A HIS -15 ? A HIS 5 6 1 Y 1 A HIS -14 ? A HIS 6 7 1 Y 1 A HIS -13 ? A HIS 7 8 1 Y 1 A HIS -12 ? A HIS 8 9 1 Y 1 A HIS -11 ? A HIS 9 10 1 Y 1 A HIS -10 ? A HIS 10 11 1 Y 1 A SER -9 ? A SER 11 12 1 Y 1 A SER -8 ? A SER 12 13 1 Y 1 A GLY -7 ? A GLY 13 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number HHSN272201700059C _pdbx_audit_support.ordinal 1 # _pdbx_deposit_group.group_title 'DHFR structures, SSGCID' _pdbx_deposit_group.group_description 'human and M. tuberculosis DHFR structures bound to ligands' _pdbx_deposit_group.group_type 'ground state' _pdbx_deposit_group.group_id G_1002223 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id HVR _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id HVR _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' NAP 3 '3-(2-{3-[(2,4-diamino-6-ethylpyrimidin-5-yl)oxy]propoxy}pyridin-3-yl)prop-2-yn-1-ol' HVR 4 1,2-ETHANEDIOL EDO 5 'CHLORIDE ION' CL 6 water HOH #