data_5SXY # _entry.id 5SXY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.320 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5SXY WWPDB D_1000223248 BMRB 30153 # _pdbx_database_related.db_name BMRB _pdbx_database_related.details ;The solution NMR structure for the PqqD truncation of Methylobacterium extorquens PqqCD representing a functional and stand-alone ribosomally synthesized and post-translational modified (RiPP) recognition element (RRE) ; _pdbx_database_related.db_id 30153 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5SXY _pdbx_database_status.recvd_initial_deposition_date 2016-08-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Evans, R.L.' 1 'Xia, Y.' 2 'Wilmot, C.M.' 3 # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.unpublished_flag ? ? ? ? ? ? ? US ? ? primary Biochemistry BICHAW 0033 1520-4995 ? ? 56 ? 2735 2746 ;Nuclear Magnetic Resonance Structure and Binding Studies of PqqD, a Chaperone Required in the Biosynthesis of the Bacterial Dehydrogenase Cofactor Pyrroloquinoline Quinone. ; 2017 ? 10.1021/acs.biochem.7b00247 28481092 ? ? ? ? ? ? ? ? ? ? ? 1 'to be published' ? 0353 ? ? ? ? ? ? ? ;1H, 13C, and 15N resonance assignments and secondary structure information for Methylobacterium extorquens PqqD and the complex of PqqD with PqqA ; ? ? ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Evans, R.L.' 1 ? primary 'Latham, J.A.' 2 ? primary 'Xia, Y.' 3 ? primary 'Klinman, J.P.' 4 ? primary 'Wilmot, C.M.' 5 ? 1 'Evans, R.L.' 6 ? 1 'Latham, J.A.' 7 ? 1 'Klinman, J.P.' 8 ? 1 'Wilmot, C.M.' 9 ? 1 'Xia, Y.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Bifunctional coenzyme PQQ synthesis protein C/D' _entity.formula_weight 10421.945 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 1.3.3.11 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Pyrroloquinoline quinone biosynthesis protein C/D' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEPTAFSGSDVPRLPRGVRLRFDEVRNKHVLLAPERTFDLDDNAVAVLKLVDGRNTVSQIAQILGQTYDADPAIIEADIL PMLAGLAQKRVLER ; _entity_poly.pdbx_seq_one_letter_code_can ;MEPTAFSGSDVPRLPRGVRLRFDEVRNKHVLLAPERTFDLDDNAVAVLKLVDGRNTVSQIAQILGQTYDADPAIIEADIL PMLAGLAQKRVLER ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 PRO n 1 4 THR n 1 5 ALA n 1 6 PHE n 1 7 SER n 1 8 GLY n 1 9 SER n 1 10 ASP n 1 11 VAL n 1 12 PRO n 1 13 ARG n 1 14 LEU n 1 15 PRO n 1 16 ARG n 1 17 GLY n 1 18 VAL n 1 19 ARG n 1 20 LEU n 1 21 ARG n 1 22 PHE n 1 23 ASP n 1 24 GLU n 1 25 VAL n 1 26 ARG n 1 27 ASN n 1 28 LYS n 1 29 HIS n 1 30 VAL n 1 31 LEU n 1 32 LEU n 1 33 ALA n 1 34 PRO n 1 35 GLU n 1 36 ARG n 1 37 THR n 1 38 PHE n 1 39 ASP n 1 40 LEU n 1 41 ASP n 1 42 ASP n 1 43 ASN n 1 44 ALA n 1 45 VAL n 1 46 ALA n 1 47 VAL n 1 48 LEU n 1 49 LYS n 1 50 LEU n 1 51 VAL n 1 52 ASP n 1 53 GLY n 1 54 ARG n 1 55 ASN n 1 56 THR n 1 57 VAL n 1 58 SER n 1 59 GLN n 1 60 ILE n 1 61 ALA n 1 62 GLN n 1 63 ILE n 1 64 LEU n 1 65 GLY n 1 66 GLN n 1 67 THR n 1 68 TYR n 1 69 ASP n 1 70 ALA n 1 71 ASP n 1 72 PRO n 1 73 ALA n 1 74 ILE n 1 75 ILE n 1 76 GLU n 1 77 ALA n 1 78 ASP n 1 79 ILE n 1 80 LEU n 1 81 PRO n 1 82 MET n 1 83 LEU n 1 84 ALA n 1 85 GLY n 1 86 LEU n 1 87 ALA n 1 88 GLN n 1 89 LYS n 1 90 ARG n 1 91 VAL n 1 92 LEU n 1 93 GLU n 1 94 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 94 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'pqqCD, MexAM1_META1p1749' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 14718 / DSM 1338 / AM1' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 272630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type 'BL21(DE3)' _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PQQCD_METEA _struct_ref.pdbx_db_accession Q49150 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EPTAFSGSDVPRLPRGVRLRFDEVRNKHVLLAPERTFDLDDNAVAVLKLVDGRNTVSQIAQILGQTYDADPAIIEADILP MLAGLAQKRVLER ; _struct_ref.pdbx_align_begin 280 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5SXY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 94 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q49150 _struct_ref_seq.db_align_beg 280 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 372 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 94 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 5SXY _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q49150 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'initiating methionine' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D HNCACB' 2 isotropic 2 1 1 '2D 1H-15N HSQC' 2 isotropic 3 1 1 '3D CBCA(CO)NH' 2 isotropic 4 1 1 '3D HNCO' 1 isotropic 5 1 1 '2D plane of 3D HCACO' 1 isotropic 6 1 1 '3D HNHA' 1 isotropic 7 1 1 '3D H(CCO)NH' 1 isotropic 8 1 1 '3D C(CO)NH' 1 isotropic 9 1 1 '3D HCCH-TOCSY' 1 isotropic 10 1 1 '2D HBCBCGCDHD' 1 isotropic 11 1 1 '2D HBCBCGCDCEHE' 1 isotropic 12 1 1 '2D 1H-13C HSQC aromatic' 1 isotropic 13 1 1 '2D 1H-13C HSQC aliphatic' 1 isotropic 14 1 1 '2D plane of HCCH-TOCSY for aromatic ring' 1 isotropic 15 1 1 '3D 15N-edited NOESY' 2 isotropic 16 1 1 '3D 13C-edited NOESY' 2 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 25 _pdbx_nmr_exptl_sample_conditions.details ;PqqD sample contained 285 micro-L of 5.0 mg/ml (0.40 mM) 13C-, 15N-labeled M.ex.PqqD in 25 mM potassium phosphate, pH 6.5, 7 micro-L of 50 mM sodium azide, and 15 micro-L HPLC grade D2O. Final concentrations: 4.6 mg/ml (0.37 mM) MexPqqD, 1.1 mM sodium azide, 4.9% D2O). ; _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label PqqD _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '4.6 mg/mL [U-13C; U-15N] PqqD, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label PqqD _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ;PqqD sample contained 285 micro-L of 5.0 mg/ml (0.40 mM) 13C-, 15N-labeled M.ex.PqqD in 25 mM potassium phosphate, pH 6.5, 7 micro-L of 50 mM sodium azide, and 15 micro-L HPLC grade D2O. Final concentrations: 4.6 mg/ml (0.37 mM) MexPqqD, 1.1 mM sodium azide, 4.9% D2O). ; # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 850 '5 mm TCI CryoProbes including shielded z-gradient' 2 'AVANCE III' ? Bruker 900 '5 mm TCI CryoProbes including shielded z-gradient' # _pdbx_nmr_refine.entry_id 5SXY _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 6 # _pdbx_nmr_ensemble.entry_id 5SXY _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5SXY _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin 3.1.6 'Bruker Biospin' 2 processing NMRPipe 'year 2012' 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 3 'data analysis' Sparky 3 'Goddard and Kneller' 6 'structure calculation' XPLOR-NIH 2.37 Schwieters 7 refinement 'Protein Structure Validation Suite (PSVS)' 1.5 http://psvs-1_5-dev.nesg.org/ # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5SXY _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5SXY _struct.title ;The solution NMR structure for the PqqD truncation of Methylobacterium extorquens PqqCD representing a functional and stand-alone ribosomally synthesized and post-translational modified (RiPP) recognition element (RRE) ; _struct.pdbx_descriptor 'Bifunctional coenzyme PQQ synthesis protein C/D (E.C.1.3.3.11)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5SXY _struct_keywords.text 'RiPP RRE peptide scaffolding, CHAPERONE' _struct_keywords.pdbx_keywords CHAPERONE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 41 ? VAL A 51 ? ASP A 41 VAL A 51 1 ? 11 HELX_P HELX_P2 AA2 THR A 56 ? ASP A 69 ? THR A 56 ASP A 69 1 ? 14 HELX_P HELX_P3 AA3 ASP A 71 ? GLN A 88 ? ASP A 71 GLN A 88 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 20 ? ASP A 23 ? LEU A 20 ASP A 23 AA1 2 LYS A 28 ? LEU A 32 ? LYS A 28 LEU A 32 AA1 3 THR A 37 ? ASP A 39 ? THR A 37 ASP A 39 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASP A 23 ? N ASP A 23 O LYS A 28 ? O LYS A 28 AA1 2 3 N LEU A 31 ? N LEU A 31 O PHE A 38 ? O PHE A 38 # _atom_sites.entry_id 5SXY _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 MET 82 82 82 MET MET A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 ARG 94 94 94 ARG ARG A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-05-24 2 'Structure model' 1 1 2017-06-14 3 'Structure model' 1 2 2017-09-27 4 'Structure model' 1 3 2019-12-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Author supporting evidence' 3 4 'Structure model' 'Author supporting evidence' 4 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' pdbx_audit_support 3 4 'Structure model' pdbx_audit_support 4 4 'Structure model' pdbx_nmr_software 5 4 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_id_ASTM' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_volume' 5 2 'Structure model' '_citation.page_first' 6 2 'Structure model' '_citation.page_last' 7 3 'Structure model' '_pdbx_audit_support.funding_organization' 8 4 'Structure model' '_pdbx_audit_support.funding_organization' 9 4 'Structure model' '_pdbx_nmr_software.name' 10 4 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component PqqD _pdbx_nmr_exptl_sample.concentration 4.6 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mg/mL _pdbx_nmr_exptl_sample.isotopic_labeling '[U-13C; U-15N]' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 2 ? ? -167.48 54.77 2 1 ALA A 5 ? ? -165.78 62.72 3 1 ARG A 36 ? ? -172.89 -98.68 4 2 ALA A 5 ? ? -166.23 53.31 5 3 ALA A 5 ? ? 45.76 93.12 6 3 VAL A 91 ? ? -141.71 11.82 7 4 GLU A 2 ? ? 48.41 72.73 8 4 PHE A 6 ? ? 58.67 146.56 9 5 THR A 4 ? ? 60.76 -4.13 10 5 ALA A 5 ? ? 69.63 -40.52 11 5 PHE A 6 ? ? 56.74 107.72 12 6 ALA A 5 ? ? 69.56 -22.22 13 6 PHE A 6 ? ? 52.26 175.46 14 6 ARG A 36 ? ? -174.67 146.64 15 7 PRO A 3 ? ? -42.99 155.45 16 7 ALA A 5 ? ? 51.47 99.34 17 7 VAL A 91 ? ? -141.54 12.57 18 8 GLU A 2 ? ? -170.63 147.35 19 8 ALA A 5 ? ? -163.72 106.08 20 9 GLU A 2 ? ? 45.50 73.58 21 9 ARG A 36 ? ? -172.26 -96.64 22 9 VAL A 91 ? ? -141.78 16.42 23 10 GLU A 2 ? ? -166.53 62.04 24 11 GLU A 2 ? ? -168.24 71.60 25 11 VAL A 91 ? ? -141.46 16.20 26 12 GLU A 2 ? ? -166.86 51.14 27 12 THR A 4 ? ? 49.13 94.16 28 12 PHE A 6 ? ? 52.44 174.96 29 12 VAL A 91 ? ? -140.07 16.61 30 13 GLU A 2 ? ? -176.91 -57.92 31 13 PRO A 3 ? ? -58.07 -86.85 32 13 THR A 4 ? ? -161.92 67.32 33 13 ARG A 36 ? ? -171.51 -122.28 34 13 ASP A 52 ? ? -76.43 -86.81 35 14 GLU A 2 ? ? -168.00 62.71 36 14 ALA A 5 ? ? 52.38 88.08 37 14 ARG A 36 ? ? -176.32 149.07 38 15 THR A 4 ? ? -152.87 34.59 39 15 ALA A 5 ? ? -163.72 -34.92 40 15 PHE A 6 ? ? 50.70 -172.81 41 15 ARG A 36 ? ? -173.46 148.68 42 16 GLU A 2 ? ? -169.35 72.36 43 16 ALA A 5 ? ? 51.82 91.65 44 16 ASP A 52 ? ? -78.60 -86.59 45 17 PRO A 3 ? ? -71.70 42.88 46 17 ARG A 36 ? ? -171.81 -123.76 47 18 ALA A 5 ? ? -165.39 -84.13 48 18 PHE A 6 ? ? 55.62 110.51 49 18 ARG A 36 ? ? -174.95 -120.03 50 19 GLU A 2 ? ? -169.89 72.30 51 19 ALA A 5 ? ? -162.55 -31.18 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM-066569 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM-039296 2 #