data_5T1N # _entry.id 5T1N # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5T1N pdb_00005t1n 10.2210/pdb5t1n/pdb WWPDB D_1000223065 ? ? BMRB 30158 ? 10.13018/BMR30158 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-11-16 2 'Structure model' 1 1 2016-12-07 3 'Structure model' 1 2 2016-12-21 4 'Structure model' 1 3 2017-07-26 5 'Structure model' 1 4 2017-11-01 6 'Structure model' 1 5 2019-12-04 7 'Structure model' 1 6 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Author supporting evidence' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Structure summary' 6 5 'Structure model' 'Author supporting evidence' 7 6 'Structure model' 'Author supporting evidence' 8 6 'Structure model' 'Data collection' 9 7 'Structure model' 'Data collection' 10 7 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' entity 2 4 'Structure model' pdbx_audit_support 3 4 'Structure model' pdbx_database_related 4 5 'Structure model' pdbx_struct_assembly_auth_evidence 5 6 'Structure model' pdbx_audit_support 6 6 'Structure model' pdbx_nmr_software 7 6 'Structure model' pdbx_nmr_spectrometer 8 7 'Structure model' chem_comp_atom 9 7 'Structure model' chem_comp_bond 10 7 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_entity.pdbx_number_of_molecules' 2 4 'Structure model' '_pdbx_audit_support.funding_organization' 3 6 'Structure model' '_pdbx_audit_support.funding_organization' 4 6 'Structure model' '_pdbx_nmr_software.name' 5 6 'Structure model' '_pdbx_nmr_spectrometer.model' 6 7 'Structure model' '_database_2.pdbx_DOI' 7 7 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5T1N _pdbx_database_status.recvd_initial_deposition_date 2016-08-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution-state NMR structural ensemble of NPr (1-85) refined with RDCs and PCS' _pdbx_database_related.db_id 30158 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Strickland, M.' 1 'Wang, G.' 2 'Peterkofsky, A.' 3 'Tjandra, N.' 4 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Structure _citation.journal_id_ASTM STRUE6 _citation.journal_id_CSD 2005 _citation.journal_id_ISSN 1878-4186 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 24 _citation.language ? _citation.page_first 2127 _citation.page_last 2137 _citation.title 'Structure of the NPr:EIN(Ntr) Complex: Mechanism for Specificity in Paralogous Phosphotransferase Systems.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.str.2016.10.007 _citation.pdbx_database_id_PubMed 27839951 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Strickland, M.' 1 ? primary 'Stanley, A.M.' 2 ? primary 'Wang, G.' 3 ? primary 'Botos, I.' 4 ? primary 'Schwieters, C.D.' 5 ? primary 'Buchanan, S.K.' 6 ? primary 'Peterkofsky, A.' 7 ? primary 'Tjandra, N.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Phosphocarrier protein NPr' _entity.formula_weight 9254.570 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.7.11.- _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Nitrogen-related HPr' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTVKQTVEITNKLGMHARPAMKLFELMQGFDAEVLLRNDEGTEAEANSVIALLMLDSAKGRQIEVEATGPQEEEALAAVI ALFNS ; _entity_poly.pdbx_seq_one_letter_code_can ;MTVKQTVEITNKLGMHARPAMKLFELMQGFDAEVLLRNDEGTEAEANSVIALLMLDSAKGRQIEVEATGPQEEEALAAVI ALFNS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 VAL n 1 4 LYS n 1 5 GLN n 1 6 THR n 1 7 VAL n 1 8 GLU n 1 9 ILE n 1 10 THR n 1 11 ASN n 1 12 LYS n 1 13 LEU n 1 14 GLY n 1 15 MET n 1 16 HIS n 1 17 ALA n 1 18 ARG n 1 19 PRO n 1 20 ALA n 1 21 MET n 1 22 LYS n 1 23 LEU n 1 24 PHE n 1 25 GLU n 1 26 LEU n 1 27 MET n 1 28 GLN n 1 29 GLY n 1 30 PHE n 1 31 ASP n 1 32 ALA n 1 33 GLU n 1 34 VAL n 1 35 LEU n 1 36 LEU n 1 37 ARG n 1 38 ASN n 1 39 ASP n 1 40 GLU n 1 41 GLY n 1 42 THR n 1 43 GLU n 1 44 ALA n 1 45 GLU n 1 46 ALA n 1 47 ASN n 1 48 SER n 1 49 VAL n 1 50 ILE n 1 51 ALA n 1 52 LEU n 1 53 LEU n 1 54 MET n 1 55 LEU n 1 56 ASP n 1 57 SER n 1 58 ALA n 1 59 LYS n 1 60 GLY n 1 61 ARG n 1 62 GLN n 1 63 ILE n 1 64 GLU n 1 65 VAL n 1 66 GLU n 1 67 ALA n 1 68 THR n 1 69 GLY n 1 70 PRO n 1 71 GLN n 1 72 GLU n 1 73 GLU n 1 74 GLU n 1 75 ALA n 1 76 LEU n 1 77 ALA n 1 78 ALA n 1 79 VAL n 1 80 ILE n 1 81 ALA n 1 82 LEU n 1 83 PHE n 1 84 ASN n 1 85 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 85 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ptsO, Z4569, ECs4085' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli O157:H7' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83334 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ER2566 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pETDuet1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 MET 15 15 15 MET MET A . n A 1 16 HIS 16 16 16 HIS HIS A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 MET 21 21 21 MET MET A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 MET 27 27 27 MET MET A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 MET 54 54 54 MET MET A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 PHE 83 83 83 PHE PHE A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 SER 85 85 85 SER SER A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5T1N _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5T1N _struct.title 'Solution-state NMR structural ensemble of NPr (1-85) refined with RDCs and PCS' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5T1N _struct_keywords.text 'PTSNtr, phosphotransfer, HPr-like, bacterial, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PTSO_ECO57 _struct_ref.pdbx_db_accession P0A9N2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTVKQTVEITNKLGMHARPAMKLFELMQGFDAEVLLRNDEGTEAEANSVIALLMLDSAKGRQIEVEATGPQEEEALAAVI ALFNS ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5T1N _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 85 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0A9N2 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 85 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 85 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details 'Monomer according to Gel filtration' # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 17 ? PHE A 30 ? ALA A 17 PHE A 30 1 ? 14 HELX_P HELX_P2 AA2 SER A 48 ? SER A 57 ? SER A 48 SER A 57 1 ? 10 HELX_P HELX_P3 AA3 GLN A 71 ? ASN A 84 ? GLN A 71 ASN A 84 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 3 ? GLU A 8 ? VAL A 3 GLU A 8 AA1 2 GLN A 62 ? THR A 68 ? GLN A 62 THR A 68 AA1 3 GLU A 33 ? ARG A 37 ? GLU A 33 ARG A 37 AA1 4 GLU A 43 ? GLU A 45 ? GLU A 43 GLU A 45 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 3 ? N VAL A 3 O ALA A 67 ? O ALA A 67 AA1 2 3 O GLU A 66 ? O GLU A 66 N LEU A 35 ? N LEU A 35 AA1 3 4 N LEU A 36 ? N LEU A 36 O ALA A 44 ? O ALA A 44 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ASN 84 ? ? HG A SER 85 ? ? 1.39 2 1 O A ARG 18 ? ? H A LYS 22 ? ? 1.53 3 1 O A ARG 37 ? ? H A GLU 64 ? ? 1.58 4 2 O A ARG 18 ? ? H A LYS 22 ? ? 1.49 5 2 H A GLU 33 ? ? O A THR 68 ? ? 1.58 6 4 O A ARG 18 ? ? H A LYS 22 ? ? 1.48 7 4 O A LEU 26 ? ? H A PHE 30 ? ? 1.49 8 4 H A ASP 31 ? ? OE1 A GLN 71 ? ? 1.51 9 4 O A ARG 37 ? ? H A GLU 64 ? ? 1.56 10 5 O A ASN 38 ? ? H A GLY 41 ? ? 1.56 11 6 O A ARG 18 ? ? H A LYS 22 ? ? 1.57 12 6 O A ARG 37 ? ? H A GLU 64 ? ? 1.58 13 6 O A ALA 58 ? ? H A ARG 61 ? ? 1.59 14 7 O A ARG 18 ? ? H A LYS 22 ? ? 1.47 15 8 HB3 A LYS 12 ? ? O A PHE 83 ? ? 1.54 16 9 O A ARG 18 ? ? H A LYS 22 ? ? 1.50 17 9 O A LEU 26 ? ? H A PHE 30 ? ? 1.53 18 9 O A ARG 37 ? ? H A GLU 64 ? ? 1.59 19 9 O A THR 10 ? ? OD1 A ASN 11 ? ? 1.65 20 10 OE2 A GLU 40 ? ? HH21 A ARG 61 ? ? 1.47 21 11 O A LEU 26 ? ? H A PHE 30 ? ? 1.49 22 11 O A ARG 37 ? ? H A GLU 64 ? ? 1.55 23 11 O A ARG 18 ? ? H A LYS 22 ? ? 1.56 24 12 O A ARG 18 ? ? H A LYS 22 ? ? 1.56 25 12 H A GLU 33 ? ? O A THR 68 ? ? 1.58 26 13 H3 A MET 1 ? ? H A THR 2 ? ? 1.33 27 13 H A ASP 31 ? ? OE1 A GLN 71 ? ? 1.36 28 13 O A ARG 18 ? ? H A LYS 22 ? ? 1.46 29 13 O A ARG 37 ? ? H A GLU 64 ? ? 1.60 30 14 H A ASP 31 ? ? OE1 A GLN 71 ? ? 1.51 31 15 O A ARG 18 ? ? H A LYS 22 ? ? 1.52 32 15 O A LEU 26 ? ? H A PHE 30 ? ? 1.58 33 15 O A LYS 12 ? ? N A GLY 14 ? ? 2.08 34 16 O A LEU 26 ? ? H A PHE 30 ? ? 1.57 35 16 O A ARG 37 ? ? H A GLU 64 ? ? 1.59 36 17 O A LEU 55 ? ? H A ALA 58 ? ? 1.53 37 17 O A ARG 37 ? ? H A GLU 64 ? ? 1.58 38 17 O A PRO 19 ? ? H A LEU 23 ? ? 1.60 39 18 O A ARG 18 ? ? H A LYS 22 ? ? 1.39 40 18 O A LEU 26 ? ? H A PHE 30 ? ? 1.54 41 19 O A ARG 18 ? ? H A LYS 22 ? ? 1.48 42 19 O A ARG 37 ? ? H A GLU 64 ? ? 1.58 43 20 O A ARG 18 ? ? H A LYS 22 ? ? 1.53 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 12 ? ? -169.19 96.56 2 1 HIS A 16 ? ? 57.53 -137.06 3 1 ALA A 32 ? ? 170.97 158.09 4 1 LYS A 59 ? ? -69.37 97.27 5 1 GLU A 72 ? ? -38.25 -35.80 6 2 LYS A 12 ? ? 99.77 -179.36 7 2 LEU A 13 ? ? -54.98 -1.43 8 2 ALA A 32 ? ? 172.53 153.34 9 2 ALA A 44 ? ? -100.40 77.20 10 2 ALA A 46 ? ? -66.58 3.78 11 2 ALA A 58 ? ? -74.52 29.29 12 3 ASN A 11 ? ? 85.36 26.67 13 3 LYS A 12 ? ? 86.94 -161.77 14 3 HIS A 16 ? ? 53.19 -80.31 15 3 ALA A 17 ? ? -170.94 3.80 16 3 ALA A 32 ? ? 171.75 151.77 17 3 GLU A 45 ? ? -37.14 121.03 18 3 ALA A 58 ? ? -88.08 31.03 19 4 ASN A 11 ? ? 79.78 37.47 20 4 LYS A 12 ? ? 80.80 -174.15 21 4 ALA A 32 ? ? 170.75 152.57 22 4 GLU A 40 ? ? -68.07 0.47 23 4 ASN A 47 ? ? -64.34 1.12 24 4 ALA A 58 ? ? -79.88 29.68 25 5 THR A 2 ? ? 62.87 129.96 26 5 ASN A 11 ? ? 85.45 12.14 27 5 LYS A 12 ? ? 101.49 179.29 28 5 LEU A 13 ? ? -53.00 -4.70 29 5 MET A 15 ? ? -56.49 -73.82 30 5 ALA A 17 ? ? 72.48 -4.28 31 5 ALA A 32 ? ? 169.96 153.26 32 5 ALA A 46 ? ? -58.98 -1.81 33 5 ALA A 58 ? ? -89.32 30.19 34 6 ASN A 11 ? ? 85.76 26.88 35 6 LYS A 12 ? ? 85.13 -154.75 36 6 HIS A 16 ? ? 176.21 -77.53 37 6 ALA A 17 ? ? -147.27 -10.01 38 6 ALA A 32 ? ? 172.99 155.16 39 6 ALA A 46 ? ? -69.79 0.72 40 6 LYS A 59 ? ? -53.37 101.51 41 7 ASN A 11 ? ? 84.05 32.24 42 7 LYS A 12 ? ? 88.66 -178.53 43 7 LEU A 13 ? ? -68.66 22.56 44 7 HIS A 16 ? ? 47.07 -112.50 45 7 ALA A 32 ? ? 163.03 155.73 46 7 ALA A 44 ? ? -84.31 47.33 47 7 GLU A 45 ? ? -39.52 119.91 48 7 ASN A 47 ? ? -74.53 33.95 49 8 THR A 10 ? ? -142.14 34.83 50 8 ASN A 11 ? ? 109.54 11.36 51 8 LEU A 13 ? ? -59.13 13.61 52 8 HIS A 16 ? ? -165.01 84.01 53 8 ALA A 17 ? ? 55.18 2.06 54 8 ALA A 32 ? ? 158.86 152.50 55 8 ASN A 47 ? ? -76.70 28.60 56 9 THR A 2 ? ? 56.76 116.11 57 9 ASN A 11 ? ? 94.17 -26.10 58 9 LYS A 12 ? ? 154.53 -172.32 59 9 HIS A 16 ? ? 56.96 -109.22 60 9 ALA A 32 ? ? 171.36 150.32 61 9 ALA A 58 ? ? -79.44 29.41 62 10 ASN A 11 ? ? 88.81 24.44 63 10 ALA A 32 ? ? 168.91 151.63 64 10 GLU A 45 ? ? -39.27 121.27 65 10 ALA A 46 ? ? -68.63 8.57 66 11 ASN A 11 ? ? 80.27 34.12 67 11 LYS A 12 ? ? 79.63 -165.68 68 11 HIS A 16 ? ? -156.91 -94.85 69 11 ALA A 32 ? ? 163.08 150.54 70 11 ALA A 58 ? ? -84.18 30.48 71 12 ASN A 11 ? ? 81.56 16.76 72 12 LYS A 12 ? ? 95.34 -170.38 73 12 MET A 15 ? ? -72.44 -162.14 74 12 ALA A 17 ? ? 166.47 9.60 75 12 ALA A 32 ? ? 172.22 155.51 76 12 GLU A 45 ? ? -38.27 120.95 77 12 ALA A 46 ? ? -62.40 0.12 78 12 ALA A 58 ? ? -85.00 30.04 79 13 ASN A 11 ? ? 83.18 18.53 80 13 LYS A 12 ? ? 96.21 -176.62 81 13 LEU A 13 ? ? -56.58 -3.32 82 13 HIS A 16 ? ? 47.11 -100.12 83 13 ALA A 17 ? ? -151.52 9.82 84 13 ALA A 32 ? ? 163.48 153.30 85 13 ASN A 47 ? ? -99.17 30.34 86 13 ALA A 58 ? ? -80.68 30.92 87 14 THR A 2 ? ? 63.21 117.70 88 14 ASN A 11 ? ? 80.27 35.95 89 14 LYS A 12 ? ? 81.01 -168.97 90 14 LEU A 13 ? ? -77.15 21.11 91 14 HIS A 16 ? ? 55.41 15.54 92 14 ALA A 32 ? ? 161.63 152.45 93 14 ALA A 44 ? ? -100.91 72.16 94 14 GLU A 45 ? ? -39.35 120.43 95 14 ASN A 47 ? ? -104.84 46.22 96 14 ALA A 58 ? ? -78.29 30.73 97 15 ASN A 11 ? ? 83.00 13.87 98 15 LYS A 12 ? ? 99.60 168.01 99 15 LEU A 13 ? ? -37.33 -9.29 100 15 ALA A 32 ? ? 168.89 157.34 101 15 ASN A 47 ? ? -74.99 22.53 102 15 GLU A 72 ? ? -39.35 -35.89 103 16 THR A 2 ? ? 62.63 120.77 104 16 ASN A 11 ? ? 84.89 29.77 105 16 LYS A 12 ? ? 81.65 -162.36 106 16 LEU A 13 ? ? -68.47 2.87 107 16 HIS A 16 ? ? -163.73 -95.74 108 16 ALA A 32 ? ? 174.49 154.36 109 16 GLU A 45 ? ? -39.24 120.94 110 16 ALA A 46 ? ? -59.27 -7.68 111 16 ASN A 47 ? ? -108.00 42.70 112 16 ALA A 58 ? ? -90.02 30.57 113 17 THR A 2 ? ? 62.71 120.84 114 17 LYS A 12 ? ? -178.17 125.94 115 17 HIS A 16 ? ? 158.76 83.71 116 17 ALA A 17 ? ? 55.74 -0.42 117 17 ALA A 32 ? ? 170.77 156.35 118 17 ALA A 46 ? ? -69.48 13.19 119 17 ALA A 58 ? ? -79.65 28.86 120 18 ASN A 11 ? ? 81.42 -47.46 121 18 HIS A 16 ? ? 56.75 -88.29 122 18 ALA A 17 ? ? -157.43 9.36 123 18 ALA A 32 ? ? 163.75 153.91 124 18 GLU A 45 ? ? -38.80 120.54 125 18 ASN A 47 ? ? -90.80 42.97 126 18 LYS A 59 ? ? -60.76 97.99 127 19 ASN A 11 ? ? 83.87 26.92 128 19 LYS A 12 ? ? 88.81 -164.53 129 19 LEU A 13 ? ? -73.73 26.31 130 19 MET A 15 ? ? -74.90 -147.96 131 19 ALA A 17 ? ? 165.51 4.89 132 19 ALA A 32 ? ? 170.20 153.53 133 19 GLU A 45 ? ? -38.53 120.65 134 19 ALA A 46 ? ? -64.38 0.29 135 19 ALA A 58 ? ? -77.97 32.65 136 20 ASN A 11 ? ? 80.05 30.07 137 20 LYS A 12 ? ? 86.87 -162.50 138 20 LEU A 13 ? ? -66.51 4.86 139 20 HIS A 16 ? ? 59.46 -116.17 140 20 ALA A 32 ? ? 167.28 157.36 141 20 ALA A 58 ? ? -75.99 29.99 142 20 GLU A 72 ? ? -34.78 -37.54 # _pdbx_nmr_ensemble.entry_id 5T1N _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5T1N _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '1 mM [U-13C; U-15N] NPr, 25 mM Tris, 93% H2O/7% D2O' '93% H2O/7% D2O' NPr_Wang solution 'Used for NOE and hydrogen bond restraints.' 2 '0.6 mM [U-13C; U-15N; U-2H] NPr, 10 mM TRIS, 100 mM sodium chloride, 0.5 mM EDTA, 93% H2O/7% D2O' '93% H2O/7% D2O' NPr_rdc 'filamentous virus' 'Pf1 filamentous phage was used to induce partial alignment.' 3 '0.6 mM [U-13C; U-15N; U-2H] NPr, 10 mM TRIS, 100 mM sodium chloride, 0.5 mM EDTA, 93% H2O/7% D2O' '93% H2O/7% D2O' NPr_assign solution 'Used for assignment and for RDC isotropic sample.' 4 '0.6 mM [U-15N; U-2H] NPr, 10 mM TRIS, 100 mM sodium chloride, 0.5 mM EDTA, 93% H2O/7% D2O' '93% H2O/7% D2O' NPr_PCSiso solution 'The sample was mutated (E45C) to accommodate a Lu-M8-SPy tag, which was the control sample for pseudocontact shifts.' 5 '0.6 mM [U-15N; U-2H] NPr, 10 mM TRIS, 100 mM sodium chloride, 0.5 mM EDTA, 93% H2O/7% D2O' '93% H2O/7% D2O' NPr_PCSaniso solution 'The sample was mutated (E45C) to accommodate a Yb-M8-SPy tag, which was used to induce pseudocontact shifts.' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 NPr 1 ? mM '[U-13C; U-15N]' 1 Tris 25 ? mM 'natural abundance' 2 NPr 0.6 ? mM '[U-13C; U-15N; U-2H]' 2 TRIS 10 ? mM 'natural abundance' 2 'sodium chloride' 100 ? mM 'natural abundance' 2 EDTA 0.5 ? mM 'natural abundance' 3 NPr 0.6 ? mM '[U-13C; U-15N; U-2H]' 3 TRIS 10 ? mM 'natural abundance' 3 'sodium chloride' 100 ? mM 'natural abundance' 3 EDTA 0.5 ? mM 'natural abundance' 4 NPr 0.6 ? mM '[U-15N; U-2H]' 4 TRIS 10 ? mM 'natural abundance' 4 'sodium chloride' 100 ? mM 'natural abundance' 4 EDTA 0.5 ? mM 'natural abundance' 5 NPr 0.6 ? mM '[U-15N; U-2H]' 5 TRIS 10 ? mM 'natural abundance' 5 'sodium chloride' 100 ? mM 'natural abundance' 5 EDTA 0.5 ? mM 'natural abundance' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.details _pdbx_nmr_exptl_sample_conditions.ionic_strength_err _pdbx_nmr_exptl_sample_conditions.ionic_strength_units _pdbx_nmr_exptl_sample_conditions.label _pdbx_nmr_exptl_sample_conditions.pH_err _pdbx_nmr_exptl_sample_conditions.pH_units _pdbx_nmr_exptl_sample_conditions.pressure_err _pdbx_nmr_exptl_sample_conditions.temperature_err _pdbx_nmr_exptl_sample_conditions.temperature_units 1 308 atm 1 7 25 ? ? mM conditions_1 ? pH ? ? K 2 300 atm 1 7.5 108 ? ? mM conditions_2 ? pH ? ? K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D 1H-15N NOESY' 3 isotropic 2 1 1 '3D 1H-13C NOESY' 3 isotropic 3 1 1 '4D HNHC NOESY' 3 isotropic 4 1 3 '3D HNCACB' 1 isotropic 15 2 3 '2D IPAP' 1 isotropic 16 2 2 '2D IPAP' 1 anisotropic 17 2 3 '3D HNCACB' 1 isotropic 20 2 4 '2D 1H-15N HSQC' 2 isotropic 18 2 5 '2D 1H-15N HSQC' 2 anisotropic # _pdbx_nmr_refine.entry_id 5T1N _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details 'Structure was refined using PDB ID 5T17 as a starting structure.' _pdbx_nmr_refine.software_ordinal 8 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 2 'chemical shift assignment' Analysis 2.4.2 CCPN 12 'chemical shift assignment' PIPP ? Garrett 13 'peak picking' PIPP ? Garrett 4 'peak picking' Analysis 2.4.2 CCPN 5 collection VNMR ? Varian 6 collection TopSpin 3.0 'Bruker Biospin' 7 processing NMRPipe 8.2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 8 'structure calculation' 'X-PLOR NIH' 2.37.7 'Schwieters, Kuszewski, Tjandra and Clore' 9 refinement 'X-PLOR NIH' 2.37.7 'Schwieters, Kuszewski, Tjandra and Clore' 10 'data analysis' TALOS-N 4.12 'Cornilescu, Delaglio and Bax' 11 'geometry optimization' Gaussian 9 'Gaussian, Inc.' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 VAL N N N N 304 VAL CA C N S 305 VAL C C N N 306 VAL O O N N 307 VAL CB C N N 308 VAL CG1 C N N 309 VAL CG2 C N N 310 VAL OXT O N N 311 VAL H H N N 312 VAL H2 H N N 313 VAL HA H N N 314 VAL HB H N N 315 VAL HG11 H N N 316 VAL HG12 H N N 317 VAL HG13 H N N 318 VAL HG21 H N N 319 VAL HG22 H N N 320 VAL HG23 H N N 321 VAL HXT H N N 322 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 VAL N CA sing N N 291 VAL N H sing N N 292 VAL N H2 sing N N 293 VAL CA C sing N N 294 VAL CA CB sing N N 295 VAL CA HA sing N N 296 VAL C O doub N N 297 VAL C OXT sing N N 298 VAL CB CG1 sing N N 299 VAL CB CG2 sing N N 300 VAL CB HB sing N N 301 VAL CG1 HG11 sing N N 302 VAL CG1 HG12 sing N N 303 VAL CG1 HG13 sing N N 304 VAL CG2 HG21 sing N N 305 VAL CG2 HG22 sing N N 306 VAL CG2 HG23 sing N N 307 VAL OXT HXT sing N N 308 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Heart, Lung, and Blood Institute (NIH/NHLBI)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 AVANCE ? Bruker 600 Cryoprobe 2 AVANCE ? Bruker 800 Cryoprobe 3 INOVA ? Varian 600 ? # _atom_sites.entry_id 5T1N _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_