data_5TCW # _entry.id 5TCW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5TCW pdb_00005tcw 10.2210/pdb5tcw/pdb WWPDB D_1000224048 ? ? # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 5TVC _pdbx_database_related.db_name PDB _pdbx_database_related.details . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5TCW _pdbx_database_status.recvd_initial_deposition_date 2016-09-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Gunawardana, D.M.' 1 'Yosaatmadja, Y.' 2 'Leung, I.K.' 3 'Squire, C.J.' 4 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'ACC oxidase complex with substrate 1-aminocyclopropane-1-carboxylic acid' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gunawardana, D.M.' 1 ? primary 'Arabshahi, J.' 2 ? primary 'Yosaatmadja, Y.' 3 ? primary 'Reynisson, J.' 4 ? primary 'Squire, C.J.' 5 ? primary 'Leung, I.K.' 6 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5TCW _cell.details ? _cell.formula_units_Z ? _cell.length_a 70.944 _cell.length_a_esd ? _cell.length_b 108.136 _cell.length_b_esd ? _cell.length_c 108.320 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5TCW _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '1-aminocyclopropane-1-carboxylate oxidase 1' 36233.719 1 1.14.17.4 ? ? ? 2 non-polymer syn 'ACETATE ION' 59.044 1 ? ? ? ? 3 non-polymer syn 'NICKEL (II) ION' 58.693 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'ACCO,Ethylene-forming enzyme,EFE' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MENFPIISLDKVNGVERAATMEMIKDACENWGFFELVNHGIPREVMDTVEKMTKGHYKKCMEQRFKELVASKALEGVQAE VTDMDWESTFFLKHLPISNISEVPDLDEEYREVMRDFAKRLEKLAEELLDLLCENLGLEKGYLKNAFYGSKGPNFGTKVS NYPPCPKPDLIKGLRAHTDAGGIILLFQDDKVSGLQLLKDGQWIDVPPMRHSIVVNLGDQLEVITNGKYKSVMHRVIAQK DGARMSLASFYNPGSDAVIYPAPALVEKEAEENKQVYPKFVFDDYMKLYAGLKFQAKEPRFEAMKAMETDVKMDPIATV ; _entity_poly.pdbx_seq_one_letter_code_can ;MENFPIISLDKVNGVERAATMEMIKDACENWGFFELVNHGIPREVMDTVEKMTKGHYKKCMEQRFKELVASKALEGVQAE VTDMDWESTFFLKHLPISNISEVPDLDEEYREVMRDFAKRLEKLAEELLDLLCENLGLEKGYLKNAFYGSKGPNFGTKVS NYPPCPKPDLIKGLRAHTDAGGIILLFQDDKVSGLQLLKDGQWIDVPPMRHSIVVNLGDQLEVITNGKYKSVMHRVIAQK DGARMSLASFYNPGSDAVIYPAPALVEKEAEENKQVYPKFVFDDYMKLYAGLKFQAKEPRFEAMKAMETDVKMDPIATV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 ASN n 1 4 PHE n 1 5 PRO n 1 6 ILE n 1 7 ILE n 1 8 SER n 1 9 LEU n 1 10 ASP n 1 11 LYS n 1 12 VAL n 1 13 ASN n 1 14 GLY n 1 15 VAL n 1 16 GLU n 1 17 ARG n 1 18 ALA n 1 19 ALA n 1 20 THR n 1 21 MET n 1 22 GLU n 1 23 MET n 1 24 ILE n 1 25 LYS n 1 26 ASP n 1 27 ALA n 1 28 CYS n 1 29 GLU n 1 30 ASN n 1 31 TRP n 1 32 GLY n 1 33 PHE n 1 34 PHE n 1 35 GLU n 1 36 LEU n 1 37 VAL n 1 38 ASN n 1 39 HIS n 1 40 GLY n 1 41 ILE n 1 42 PRO n 1 43 ARG n 1 44 GLU n 1 45 VAL n 1 46 MET n 1 47 ASP n 1 48 THR n 1 49 VAL n 1 50 GLU n 1 51 LYS n 1 52 MET n 1 53 THR n 1 54 LYS n 1 55 GLY n 1 56 HIS n 1 57 TYR n 1 58 LYS n 1 59 LYS n 1 60 CYS n 1 61 MET n 1 62 GLU n 1 63 GLN n 1 64 ARG n 1 65 PHE n 1 66 LYS n 1 67 GLU n 1 68 LEU n 1 69 VAL n 1 70 ALA n 1 71 SER n 1 72 LYS n 1 73 ALA n 1 74 LEU n 1 75 GLU n 1 76 GLY n 1 77 VAL n 1 78 GLN n 1 79 ALA n 1 80 GLU n 1 81 VAL n 1 82 THR n 1 83 ASP n 1 84 MET n 1 85 ASP n 1 86 TRP n 1 87 GLU n 1 88 SER n 1 89 THR n 1 90 PHE n 1 91 PHE n 1 92 LEU n 1 93 LYS n 1 94 HIS n 1 95 LEU n 1 96 PRO n 1 97 ILE n 1 98 SER n 1 99 ASN n 1 100 ILE n 1 101 SER n 1 102 GLU n 1 103 VAL n 1 104 PRO n 1 105 ASP n 1 106 LEU n 1 107 ASP n 1 108 GLU n 1 109 GLU n 1 110 TYR n 1 111 ARG n 1 112 GLU n 1 113 VAL n 1 114 MET n 1 115 ARG n 1 116 ASP n 1 117 PHE n 1 118 ALA n 1 119 LYS n 1 120 ARG n 1 121 LEU n 1 122 GLU n 1 123 LYS n 1 124 LEU n 1 125 ALA n 1 126 GLU n 1 127 GLU n 1 128 LEU n 1 129 LEU n 1 130 ASP n 1 131 LEU n 1 132 LEU n 1 133 CYS n 1 134 GLU n 1 135 ASN n 1 136 LEU n 1 137 GLY n 1 138 LEU n 1 139 GLU n 1 140 LYS n 1 141 GLY n 1 142 TYR n 1 143 LEU n 1 144 LYS n 1 145 ASN n 1 146 ALA n 1 147 PHE n 1 148 TYR n 1 149 GLY n 1 150 SER n 1 151 LYS n 1 152 GLY n 1 153 PRO n 1 154 ASN n 1 155 PHE n 1 156 GLY n 1 157 THR n 1 158 LYS n 1 159 VAL n 1 160 SER n 1 161 ASN n 1 162 TYR n 1 163 PRO n 1 164 PRO n 1 165 CYS n 1 166 PRO n 1 167 LYS n 1 168 PRO n 1 169 ASP n 1 170 LEU n 1 171 ILE n 1 172 LYS n 1 173 GLY n 1 174 LEU n 1 175 ARG n 1 176 ALA n 1 177 HIS n 1 178 THR n 1 179 ASP n 1 180 ALA n 1 181 GLY n 1 182 GLY n 1 183 ILE n 1 184 ILE n 1 185 LEU n 1 186 LEU n 1 187 PHE n 1 188 GLN n 1 189 ASP n 1 190 ASP n 1 191 LYS n 1 192 VAL n 1 193 SER n 1 194 GLY n 1 195 LEU n 1 196 GLN n 1 197 LEU n 1 198 LEU n 1 199 LYS n 1 200 ASP n 1 201 GLY n 1 202 GLN n 1 203 TRP n 1 204 ILE n 1 205 ASP n 1 206 VAL n 1 207 PRO n 1 208 PRO n 1 209 MET n 1 210 ARG n 1 211 HIS n 1 212 SER n 1 213 ILE n 1 214 VAL n 1 215 VAL n 1 216 ASN n 1 217 LEU n 1 218 GLY n 1 219 ASP n 1 220 GLN n 1 221 LEU n 1 222 GLU n 1 223 VAL n 1 224 ILE n 1 225 THR n 1 226 ASN n 1 227 GLY n 1 228 LYS n 1 229 TYR n 1 230 LYS n 1 231 SER n 1 232 VAL n 1 233 MET n 1 234 HIS n 1 235 ARG n 1 236 VAL n 1 237 ILE n 1 238 ALA n 1 239 GLN n 1 240 LYS n 1 241 ASP n 1 242 GLY n 1 243 ALA n 1 244 ARG n 1 245 MET n 1 246 SER n 1 247 LEU n 1 248 ALA n 1 249 SER n 1 250 PHE n 1 251 TYR n 1 252 ASN n 1 253 PRO n 1 254 GLY n 1 255 SER n 1 256 ASP n 1 257 ALA n 1 258 VAL n 1 259 ILE n 1 260 TYR n 1 261 PRO n 1 262 ALA n 1 263 PRO n 1 264 ALA n 1 265 LEU n 1 266 VAL n 1 267 GLU n 1 268 LYS n 1 269 GLU n 1 270 ALA n 1 271 GLU n 1 272 GLU n 1 273 ASN n 1 274 LYS n 1 275 GLN n 1 276 VAL n 1 277 TYR n 1 278 PRO n 1 279 LYS n 1 280 PHE n 1 281 VAL n 1 282 PHE n 1 283 ASP n 1 284 ASP n 1 285 TYR n 1 286 MET n 1 287 LYS n 1 288 LEU n 1 289 TYR n 1 290 ALA n 1 291 GLY n 1 292 LEU n 1 293 LYS n 1 294 PHE n 1 295 GLN n 1 296 ALA n 1 297 LYS n 1 298 GLU n 1 299 PRO n 1 300 ARG n 1 301 PHE n 1 302 GLU n 1 303 ALA n 1 304 MET n 1 305 LYS n 1 306 ALA n 1 307 MET n 1 308 GLU n 1 309 THR n 1 310 ASP n 1 311 VAL n 1 312 LYS n 1 313 MET n 1 314 ASP n 1 315 PRO n 1 316 ILE n 1 317 ALA n 1 318 THR n 1 319 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 319 _entity_src_gen.gene_src_common_name Petunia _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ACO1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Petunia hybrida' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4102 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ACCO1_PETHY _struct_ref.pdbx_db_accession Q08506 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MENFPIISLDKVNGVERAATMEMIKDACENWGFFELVNHGIPREVMDTVEKMTKGHYKKCMEQRFKELVASKALEGVQAE VTDMDWESTFFLKHLPISNISEVPDLDEEYREVMRDFAKRLEKLAEELLDLLCENLGLEKGYLKNAFYGSKGPNFGTKVS NYPPCPKPDLIKGLRAHTDAGGIILLFQDDKVSGLQLLKDGQWIDVPPMRHSIVVNLGDQLEVITNGKYKSVMHRVIAQK DGARMSLASFYNPGSDAVIYPAPALVEKEAEENKQVYPKFVFDDYMKLYAGLKFQAKEPRFEAMKAMETDVKMDPIATV ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5TCW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 319 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q08506 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 319 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 319 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACT non-polymer . 'ACETATE ION' ? 'C2 H3 O2 -1' 59.044 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NI non-polymer . 'NICKEL (II) ION' ? 'Ni 2' 58.693 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5TCW _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.87 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 57.09 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 10.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'sodium dihydrogen phosphate, lithium sulfate, potasium hydrogen phosphate. CAPS pH 10.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 210r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-09-07 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9537 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9537 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MX1 _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5TCW _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.70 _reflns.d_resolution_low 19.78 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11727 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F 0.0 _reflns.observed_criterion_sigma_I 0.0 _reflns.percent_possible_obs 99.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 14.5 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 18.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.70 _reflns_shell.d_res_low 2.83 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.0 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 98.5 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 13.6 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.454 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -4.21 _refine.aniso_B[1][2] -0.00 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][2] 3.42 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] 0.79 _refine.B_iso_max ? _refine.B_iso_mean 75.281 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.946 _refine.correlation_coeff_Fo_to_Fc_free 0.929 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5TCW _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.70 _refine.ls_d_res_low 19.78 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11129 _refine.ls_number_reflns_R_free 597 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.42 _refine.ls_percent_reflns_R_free 5.1 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.22705 _refine.ls_R_factor_R_free 0.26944 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.22476 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1WA6 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.719 _refine.pdbx_overall_ESU_R_Free 0.341 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 18.728 _refine.overall_SU_ML 0.344 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 2335 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2340 _refine_hist.d_res_high 2.70 _refine_hist.d_res_low 19.78 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 0.019 2404 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 2275 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.028 1.973 3245 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.812 3.000 5252 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.701 5.000 298 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 39.150 25.046 109 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 13.256 15.000 416 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 12.367 15.000 9 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.058 0.200 352 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 0.021 2706 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 523 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 2.008 7.558 1194 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.005 7.560 1194 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 3.541 11.330 1489 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 3.541 11.330 1489 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 1.712 7.699 1210 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 1.711 7.699 1211 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 3.025 11.469 1756 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 5.254 58.323 2535 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 5.254 58.330 2536 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.700 _refine_ls_shell.d_res_low 2.770 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 44 _refine_ls_shell.number_reflns_R_work 779 _refine_ls_shell.percent_reflns_obs 96.94 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.365 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.380 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5TCW _struct.title 'ACC oxidase complex with nickel and acetate' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5TCW _struct_keywords.text 'substrate complex, OXYGENASE, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 10 ? GLY A 14 ? ASP A 10 GLY A 14 5 ? 5 HELX_P HELX_P2 AA2 GLU A 16 ? TRP A 31 ? GLU A 16 TRP A 31 1 ? 16 HELX_P HELX_P3 AA3 PRO A 42 ? GLU A 75 ? PRO A 42 GLU A 75 1 ? 34 HELX_P HELX_P4 AA4 GLU A 80 ? MET A 84 ? GLU A 80 MET A 84 5 ? 5 HELX_P HELX_P5 AA5 ASP A 107 ? GLY A 137 ? ASP A 107 GLY A 137 1 ? 31 HELX_P HELX_P6 AA6 GLY A 141 ? PHE A 147 ? GLY A 141 PHE A 147 1 ? 7 HELX_P HELX_P7 AA7 LYS A 167 ? ILE A 171 ? LYS A 167 ILE A 171 5 ? 5 HELX_P HELX_P8 AA8 GLY A 218 ? THR A 225 ? GLY A 218 THR A 225 1 ? 8 HELX_P HELX_P9 AA9 PHE A 282 ? ALA A 290 ? PHE A 282 ALA A 290 1 ? 9 HELX_P HELX_P10 AB1 ALA A 296 ? MET A 307 ? ALA A 296 MET A 307 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? A ASP 26 OD1 ? ? ? 1_555 A ASN 30 ND2 ? ? A ASP 26 A ASN 30 1_555 ? ? ? ? ? ? ? 2.671 ? ? metalc1 metalc ? ? A HIS 177 NE2 ? ? ? 1_555 C NI . NI ? ? A HIS 177 A NI 402 1_555 ? ? ? ? ? ? ? 2.598 ? ? metalc2 metalc ? ? A ASP 179 OD1 ? ? ? 1_555 C NI . NI ? ? A ASP 179 A NI 402 1_555 ? ? ? ? ? ? ? 2.200 ? ? metalc3 metalc ? ? A HIS 234 NE2 ? ? ? 1_555 C NI . NI ? ? A HIS 234 A NI 402 1_555 ? ? ? ? ? ? ? 2.582 ? ? metalc4 metalc ? ? B ACT . OXT ? ? ? 1_555 C NI . NI ? ? A ACT 401 A NI 402 1_555 ? ? ? ? ? ? ? 2.598 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LEU _struct_mon_prot_cis.label_seq_id 95 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LEU _struct_mon_prot_cis.auth_seq_id 95 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 96 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 96 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -5.74 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 3 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 6 ? SER A 8 ? ILE A 6 SER A 8 AA1 2 PHE A 33 ? VAL A 37 ? PHE A 33 VAL A 37 AA1 3 ILE A 213 ? LEU A 217 ? ILE A 213 LEU A 217 AA1 4 ILE A 183 ? GLN A 188 ? ILE A 183 GLN A 188 AA1 5 MET A 245 ? ASN A 252 ? MET A 245 ASN A 252 AA1 6 ASN A 154 ? ASN A 161 ? ASN A 154 ASN A 161 AA1 7 SER A 88 ? LEU A 95 ? SER A 88 LEU A 95 AA2 1 GLN A 202 ? ASP A 205 ? GLN A 202 ASP A 205 AA2 2 LEU A 195 ? LYS A 199 ? LEU A 195 LYS A 199 AA2 3 HIS A 234 ? VAL A 236 ? HIS A 234 VAL A 236 AA3 1 VAL A 258 ? ILE A 259 ? VAL A 258 ILE A 259 AA3 2 PHE A 280 ? VAL A 281 ? PHE A 280 VAL A 281 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 7 ? N ILE A 7 O GLU A 35 ? O GLU A 35 AA1 2 3 N LEU A 36 ? N LEU A 36 O ILE A 213 ? O ILE A 213 AA1 3 4 O VAL A 214 ? O VAL A 214 N LEU A 186 ? N LEU A 186 AA1 4 5 N LEU A 185 ? N LEU A 185 O SER A 249 ? O SER A 249 AA1 5 6 O ALA A 248 ? O ALA A 248 N LYS A 158 ? N LYS A 158 AA1 6 7 O VAL A 159 ? O VAL A 159 N PHE A 90 ? N PHE A 90 AA2 1 2 O ILE A 204 ? O ILE A 204 N LEU A 197 ? N LEU A 197 AA2 2 3 N GLN A 196 ? N GLN A 196 O ARG A 235 ? O ARG A 235 AA3 1 2 N ILE A 259 ? N ILE A 259 O PHE A 280 ? O PHE A 280 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ACT 401 ? 4 'binding site for residue ACT A 401' AC2 Software A NI 402 ? 5 'binding site for residue NI A 402' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 ASP A 179 ? ASP A 179 . ? 1_555 ? 2 AC1 4 ASN A 216 ? ASN A 216 . ? 1_555 ? 3 AC1 4 HIS A 234 ? HIS A 234 . ? 1_555 ? 4 AC1 4 NI C . ? NI A 402 . ? 1_555 ? 5 AC2 5 GLU A 80 ? GLU A 80 . ? 2_555 ? 6 AC2 5 HIS A 177 ? HIS A 177 . ? 1_555 ? 7 AC2 5 ASP A 179 ? ASP A 179 . ? 1_555 ? 8 AC2 5 HIS A 234 ? HIS A 234 . ? 1_555 ? 9 AC2 5 ACT B . ? ACT A 401 . ? 1_555 ? # _atom_sites.entry_id 5TCW _atom_sites.fract_transf_matrix[1][1] 0.014096 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009248 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009232 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C IN N NI O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 MET 21 21 21 MET MET A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 MET 23 23 23 MET MET A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 TRP 31 31 31 TRP TRP A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 MET 46 46 46 MET MET A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 MET 52 52 52 MET MET A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 CYS 60 60 60 CYS CYS A . n A 1 61 MET 61 61 61 MET MET A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 MET 84 84 84 MET MET A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 TRP 86 86 86 TRP TRP A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 PHE 91 91 91 PHE PHE A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 HIS 94 94 94 HIS HIS A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 PRO 104 104 104 PRO PRO A . n A 1 105 ASP 105 105 105 ASP ASP A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 TYR 110 110 110 TYR TYR A . n A 1 111 ARG 111 111 111 ARG ARG A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 MET 114 114 114 MET MET A . n A 1 115 ARG 115 115 115 ARG ARG A . n A 1 116 ASP 116 116 116 ASP ASP A . n A 1 117 PHE 117 117 117 PHE PHE A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 ARG 120 120 120 ARG ARG A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 ASP 130 130 130 ASP ASP A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 CYS 133 133 133 CYS CYS A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 ASN 135 135 135 ASN ASN A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 LYS 140 140 140 LYS LYS A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 TYR 142 142 142 TYR TYR A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 LYS 144 144 144 LYS LYS A . n A 1 145 ASN 145 145 145 ASN ASN A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 PHE 147 147 147 PHE PHE A . n A 1 148 TYR 148 148 148 TYR TYR A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 SER 150 150 150 SER SER A . n A 1 151 LYS 151 151 151 LYS LYS A . n A 1 152 GLY 152 152 152 GLY GLY A . n A 1 153 PRO 153 153 153 PRO PRO A . n A 1 154 ASN 154 154 154 ASN ASN A . n A 1 155 PHE 155 155 155 PHE PHE A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 THR 157 157 157 THR THR A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 VAL 159 159 159 VAL VAL A . n A 1 160 SER 160 160 160 SER SER A . n A 1 161 ASN 161 161 161 ASN ASN A . n A 1 162 TYR 162 162 162 TYR TYR A . n A 1 163 PRO 163 163 163 PRO PRO A . n A 1 164 PRO 164 164 164 PRO PRO A . n A 1 165 CYS 165 165 165 CYS CYS A . n A 1 166 PRO 166 166 166 PRO PRO A . n A 1 167 LYS 167 167 167 LYS LYS A . n A 1 168 PRO 168 168 168 PRO PRO A . n A 1 169 ASP 169 169 169 ASP ASP A . n A 1 170 LEU 170 170 170 LEU LEU A . n A 1 171 ILE 171 171 171 ILE ILE A . n A 1 172 LYS 172 172 172 LYS LYS A . n A 1 173 GLY 173 173 173 GLY GLY A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 ARG 175 175 175 ARG ARG A . n A 1 176 ALA 176 176 176 ALA ALA A . n A 1 177 HIS 177 177 177 HIS HIS A . n A 1 178 THR 178 178 178 THR THR A . n A 1 179 ASP 179 179 179 ASP ASP A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 GLY 181 181 181 GLY GLY A . n A 1 182 GLY 182 182 182 GLY GLY A . n A 1 183 ILE 183 183 183 ILE ILE A . n A 1 184 ILE 184 184 184 ILE ILE A . n A 1 185 LEU 185 185 185 LEU LEU A . n A 1 186 LEU 186 186 186 LEU LEU A . n A 1 187 PHE 187 187 187 PHE PHE A . n A 1 188 GLN 188 188 188 GLN GLN A . n A 1 189 ASP 189 189 189 ASP ASP A . n A 1 190 ASP 190 190 190 ASP ASP A . n A 1 191 LYS 191 191 191 LYS LYS A . n A 1 192 VAL 192 192 192 VAL VAL A . n A 1 193 SER 193 193 193 SER SER A . n A 1 194 GLY 194 194 194 GLY GLY A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 GLN 196 196 196 GLN GLN A . n A 1 197 LEU 197 197 197 LEU LEU A . n A 1 198 LEU 198 198 198 LEU LEU A . n A 1 199 LYS 199 199 199 LYS LYS A . n A 1 200 ASP 200 200 200 ASP ASP A . n A 1 201 GLY 201 201 201 GLY GLY A . n A 1 202 GLN 202 202 202 GLN GLN A . n A 1 203 TRP 203 203 203 TRP TRP A . n A 1 204 ILE 204 204 204 ILE ILE A . n A 1 205 ASP 205 205 205 ASP ASP A . n A 1 206 VAL 206 206 206 VAL VAL A . n A 1 207 PRO 207 207 207 PRO PRO A . n A 1 208 PRO 208 208 208 PRO PRO A . n A 1 209 MET 209 209 209 MET MET A . n A 1 210 ARG 210 210 210 ARG ARG A . n A 1 211 HIS 211 211 211 HIS HIS A . n A 1 212 SER 212 212 212 SER SER A . n A 1 213 ILE 213 213 213 ILE ILE A . n A 1 214 VAL 214 214 214 VAL VAL A . n A 1 215 VAL 215 215 215 VAL VAL A . n A 1 216 ASN 216 216 216 ASN ASN A . n A 1 217 LEU 217 217 217 LEU LEU A . n A 1 218 GLY 218 218 218 GLY GLY A . n A 1 219 ASP 219 219 219 ASP ASP A . n A 1 220 GLN 220 220 220 GLN GLN A . n A 1 221 LEU 221 221 221 LEU LEU A . n A 1 222 GLU 222 222 222 GLU GLU A . n A 1 223 VAL 223 223 223 VAL VAL A . n A 1 224 ILE 224 224 224 ILE ILE A . n A 1 225 THR 225 225 225 THR THR A . n A 1 226 ASN 226 226 226 ASN ASN A . n A 1 227 GLY 227 227 227 GLY GLY A . n A 1 228 LYS 228 228 228 LYS LYS A . n A 1 229 TYR 229 229 229 TYR TYR A . n A 1 230 LYS 230 230 230 LYS LYS A . n A 1 231 SER 231 231 231 SER SER A . n A 1 232 VAL 232 232 232 VAL VAL A . n A 1 233 MET 233 233 233 MET MET A . n A 1 234 HIS 234 234 234 HIS HIS A . n A 1 235 ARG 235 235 235 ARG ARG A . n A 1 236 VAL 236 236 236 VAL VAL A . n A 1 237 ILE 237 237 237 ILE ILE A . n A 1 238 ALA 238 238 238 ALA ALA A . n A 1 239 GLN 239 239 239 GLN GLN A . n A 1 240 LYS 240 240 240 LYS LYS A . n A 1 241 ASP 241 241 241 ASP ASP A . n A 1 242 GLY 242 242 242 GLY GLY A . n A 1 243 ALA 243 243 243 ALA ALA A . n A 1 244 ARG 244 244 244 ARG ARG A . n A 1 245 MET 245 245 245 MET MET A . n A 1 246 SER 246 246 246 SER SER A . n A 1 247 LEU 247 247 247 LEU LEU A . n A 1 248 ALA 248 248 248 ALA ALA A . n A 1 249 SER 249 249 249 SER SER A . n A 1 250 PHE 250 250 250 PHE PHE A . n A 1 251 TYR 251 251 251 TYR TYR A . n A 1 252 ASN 252 252 252 ASN ASN A . n A 1 253 PRO 253 253 253 PRO PRO A . n A 1 254 GLY 254 254 254 GLY GLY A . n A 1 255 SER 255 255 255 SER SER A . n A 1 256 ASP 256 256 256 ASP ASP A . n A 1 257 ALA 257 257 257 ALA ALA A . n A 1 258 VAL 258 258 258 VAL VAL A . n A 1 259 ILE 259 259 259 ILE ILE A . n A 1 260 TYR 260 260 260 TYR TYR A . n A 1 261 PRO 261 261 261 PRO PRO A . n A 1 262 ALA 262 262 262 ALA ALA A . n A 1 263 PRO 263 263 263 PRO PRO A . n A 1 264 ALA 264 264 264 ALA ALA A . n A 1 265 LEU 265 265 265 LEU LEU A . n A 1 266 VAL 266 266 266 VAL VAL A . n A 1 267 GLU 267 267 ? ? ? A . n A 1 268 LYS 268 268 ? ? ? A . n A 1 269 GLU 269 269 ? ? ? A . n A 1 270 ALA 270 270 ? ? ? A . n A 1 271 GLU 271 271 ? ? ? A . n A 1 272 GLU 272 272 ? ? ? A . n A 1 273 ASN 273 273 ? ? ? A . n A 1 274 LYS 274 274 ? ? ? A . n A 1 275 GLN 275 275 275 GLN GLN A . n A 1 276 VAL 276 276 276 VAL VAL A . n A 1 277 TYR 277 277 277 TYR TYR A . n A 1 278 PRO 278 278 278 PRO PRO A . n A 1 279 LYS 279 279 279 LYS LYS A . n A 1 280 PHE 280 280 280 PHE PHE A . n A 1 281 VAL 281 281 281 VAL VAL A . n A 1 282 PHE 282 282 282 PHE PHE A . n A 1 283 ASP 283 283 283 ASP ASP A . n A 1 284 ASP 284 284 284 ASP ASP A . n A 1 285 TYR 285 285 285 TYR TYR A . n A 1 286 MET 286 286 286 MET MET A . n A 1 287 LYS 287 287 287 LYS LYS A . n A 1 288 LEU 288 288 288 LEU LEU A . n A 1 289 TYR 289 289 289 TYR TYR A . n A 1 290 ALA 290 290 290 ALA ALA A . n A 1 291 GLY 291 291 291 GLY GLY A . n A 1 292 LEU 292 292 292 LEU LEU A . n A 1 293 LYS 293 293 293 LYS LYS A . n A 1 294 PHE 294 294 294 PHE PHE A . n A 1 295 GLN 295 295 295 GLN GLN A . n A 1 296 ALA 296 296 296 ALA ALA A . n A 1 297 LYS 297 297 297 LYS LYS A . n A 1 298 GLU 298 298 298 GLU GLU A . n A 1 299 PRO 299 299 299 PRO PRO A . n A 1 300 ARG 300 300 300 ARG ARG A . n A 1 301 PHE 301 301 301 PHE PHE A . n A 1 302 GLU 302 302 302 GLU GLU A . n A 1 303 ALA 303 303 303 ALA ALA A . n A 1 304 MET 304 304 304 MET MET A . n A 1 305 LYS 305 305 305 LYS LYS A . n A 1 306 ALA 306 306 306 ALA ALA A . n A 1 307 MET 307 307 307 MET MET A . n A 1 308 GLU 308 308 308 GLU GLU A . n A 1 309 THR 309 309 ? ? ? A . n A 1 310 ASP 310 310 ? ? ? A . n A 1 311 VAL 311 311 ? ? ? A . n A 1 312 LYS 312 312 ? ? ? A . n A 1 313 MET 313 313 ? ? ? A . n A 1 314 ASP 314 314 ? ? ? A . n A 1 315 PRO 315 315 ? ? ? A . n A 1 316 ILE 316 316 ? ? ? A . n A 1 317 ALA 317 317 ? ? ? A . n A 1 318 THR 318 318 ? ? ? A . n A 1 319 VAL 319 319 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ACT 1 401 401 ACT ACT A . C 3 NI 1 402 501 NI NI A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 14630 ? 1 MORE -103 ? 1 'SSA (A^2)' 50090 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_558 -x,y,-z+3 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 324.9600000000 4 'crystal symmetry operation' 4_558 x,-y,-z+3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 324.9600000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 177 ? A HIS 177 ? 1_555 NI ? C NI . ? A NI 402 ? 1_555 OD1 ? A ASP 179 ? A ASP 179 ? 1_555 91.1 ? 2 NE2 ? A HIS 177 ? A HIS 177 ? 1_555 NI ? C NI . ? A NI 402 ? 1_555 NE2 ? A HIS 234 ? A HIS 234 ? 1_555 85.4 ? 3 OD1 ? A ASP 179 ? A ASP 179 ? 1_555 NI ? C NI . ? A NI 402 ? 1_555 NE2 ? A HIS 234 ? A HIS 234 ? 1_555 82.4 ? 4 NE2 ? A HIS 177 ? A HIS 177 ? 1_555 NI ? C NI . ? A NI 402 ? 1_555 OXT ? B ACT . ? A ACT 401 ? 1_555 169.8 ? 5 OD1 ? A ASP 179 ? A ASP 179 ? 1_555 NI ? C NI . ? A NI 402 ? 1_555 OXT ? B ACT . ? A ACT 401 ? 1_555 95.5 ? 6 NE2 ? A HIS 234 ? A HIS 234 ? 1_555 NI ? C NI . ? A NI 402 ? 1_555 OXT ? B ACT . ? A ACT 401 ? 1_555 87.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-09-20 2 'Structure model' 1 1 2023-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model 5 2 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0131 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 3 ? ? 64.46 148.40 2 1 GLU A 16 ? ? -93.57 37.99 3 1 SER A 150 ? ? -104.79 -61.28 4 1 ASP A 190 ? ? 63.94 -178.30 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 43 ? CG ? A ARG 43 CG 2 1 Y 1 A ARG 43 ? CD ? A ARG 43 CD 3 1 Y 1 A ARG 43 ? NE ? A ARG 43 NE 4 1 Y 1 A ARG 43 ? CZ ? A ARG 43 CZ 5 1 Y 1 A ARG 43 ? NH1 ? A ARG 43 NH1 6 1 Y 1 A ARG 43 ? NH2 ? A ARG 43 NH2 7 1 Y 1 A LYS 51 ? CG ? A LYS 51 CG 8 1 Y 1 A LYS 51 ? CD ? A LYS 51 CD 9 1 Y 1 A LYS 51 ? CE ? A LYS 51 CE 10 1 Y 1 A LYS 51 ? NZ ? A LYS 51 NZ 11 1 Y 1 A LYS 59 ? CG ? A LYS 59 CG 12 1 Y 1 A LYS 59 ? CD ? A LYS 59 CD 13 1 Y 1 A LYS 59 ? CE ? A LYS 59 CE 14 1 Y 1 A LYS 59 ? NZ ? A LYS 59 NZ 15 1 Y 1 A ASN 99 ? CG ? A ASN 99 CG 16 1 Y 1 A ASN 99 ? OD1 ? A ASN 99 OD1 17 1 Y 1 A ASN 99 ? ND2 ? A ASN 99 ND2 18 1 Y 1 A LYS 119 ? CG ? A LYS 119 CG 19 1 Y 1 A LYS 119 ? CD ? A LYS 119 CD 20 1 Y 1 A LYS 119 ? CE ? A LYS 119 CE 21 1 Y 1 A LYS 119 ? NZ ? A LYS 119 NZ 22 1 Y 1 A LYS 167 ? CG ? A LYS 167 CG 23 1 Y 1 A LYS 167 ? CD ? A LYS 167 CD 24 1 Y 1 A LYS 167 ? CE ? A LYS 167 CE 25 1 Y 1 A LYS 167 ? NZ ? A LYS 167 NZ 26 1 Y 1 A LYS 172 ? CG ? A LYS 172 CG 27 1 Y 1 A LYS 172 ? CD ? A LYS 172 CD 28 1 Y 1 A LYS 172 ? CE ? A LYS 172 CE 29 1 Y 1 A LYS 172 ? NZ ? A LYS 172 NZ 30 1 Y 1 A ARG 235 ? CG ? A ARG 235 CG 31 1 Y 1 A ARG 235 ? CD ? A ARG 235 CD 32 1 Y 1 A ARG 235 ? NE ? A ARG 235 NE 33 1 Y 1 A ARG 235 ? CZ ? A ARG 235 CZ 34 1 Y 1 A ARG 235 ? NH1 ? A ARG 235 NH1 35 1 Y 1 A ARG 235 ? NH2 ? A ARG 235 NH2 36 1 Y 1 A LYS 305 ? CG ? A LYS 305 CG 37 1 Y 1 A LYS 305 ? CD ? A LYS 305 CD 38 1 Y 1 A LYS 305 ? CE ? A LYS 305 CE 39 1 Y 1 A LYS 305 ? NZ ? A LYS 305 NZ 40 1 Y 1 A GLU 308 ? CA ? A GLU 308 CA 41 1 Y 1 A GLU 308 ? C ? A GLU 308 C 42 1 Y 1 A GLU 308 ? O ? A GLU 308 O 43 1 Y 1 A GLU 308 ? CB ? A GLU 308 CB 44 1 Y 1 A GLU 308 ? CG ? A GLU 308 CG 45 1 Y 1 A GLU 308 ? CD ? A GLU 308 CD 46 1 Y 1 A GLU 308 ? OE1 ? A GLU 308 OE1 47 1 Y 1 A GLU 308 ? OE2 ? A GLU 308 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLU 267 ? A GLU 267 3 1 Y 1 A LYS 268 ? A LYS 268 4 1 Y 1 A GLU 269 ? A GLU 269 5 1 Y 1 A ALA 270 ? A ALA 270 6 1 Y 1 A GLU 271 ? A GLU 271 7 1 Y 1 A GLU 272 ? A GLU 272 8 1 Y 1 A ASN 273 ? A ASN 273 9 1 Y 1 A LYS 274 ? A LYS 274 10 1 Y 1 A THR 309 ? A THR 309 11 1 Y 1 A ASP 310 ? A ASP 310 12 1 Y 1 A VAL 311 ? A VAL 311 13 1 Y 1 A LYS 312 ? A LYS 312 14 1 Y 1 A MET 313 ? A MET 313 15 1 Y 1 A ASP 314 ? A ASP 314 16 1 Y 1 A PRO 315 ? A PRO 315 17 1 Y 1 A ILE 316 ? A ILE 316 18 1 Y 1 A ALA 317 ? A ALA 317 19 1 Y 1 A THR 318 ? A THR 318 20 1 Y 1 A VAL 319 ? A VAL 319 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACT C C N N 1 ACT O O N N 2 ACT OXT O N N 3 ACT CH3 C N N 4 ACT H1 H N N 5 ACT H2 H N N 6 ACT H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 ARG N N N N 21 ARG CA C N S 22 ARG C C N N 23 ARG O O N N 24 ARG CB C N N 25 ARG CG C N N 26 ARG CD C N N 27 ARG NE N N N 28 ARG CZ C N N 29 ARG NH1 N N N 30 ARG NH2 N N N 31 ARG OXT O N N 32 ARG H H N N 33 ARG H2 H N N 34 ARG HA H N N 35 ARG HB2 H N N 36 ARG HB3 H N N 37 ARG HG2 H N N 38 ARG HG3 H N N 39 ARG HD2 H N N 40 ARG HD3 H N N 41 ARG HE H N N 42 ARG HH11 H N N 43 ARG HH12 H N N 44 ARG HH21 H N N 45 ARG HH22 H N N 46 ARG HXT H N N 47 ASN N N N N 48 ASN CA C N S 49 ASN C C N N 50 ASN O O N N 51 ASN CB C N N 52 ASN CG C N N 53 ASN OD1 O N N 54 ASN ND2 N N N 55 ASN OXT O N N 56 ASN H H N N 57 ASN H2 H N N 58 ASN HA H N N 59 ASN HB2 H N N 60 ASN HB3 H N N 61 ASN HD21 H N N 62 ASN HD22 H N N 63 ASN HXT H N N 64 ASP N N N N 65 ASP CA C N S 66 ASP C C N N 67 ASP O O N N 68 ASP CB C N N 69 ASP CG C N N 70 ASP OD1 O N N 71 ASP OD2 O N N 72 ASP OXT O N N 73 ASP H H N N 74 ASP H2 H N N 75 ASP HA H N N 76 ASP HB2 H N N 77 ASP HB3 H N N 78 ASP HD2 H N N 79 ASP HXT H N N 80 CYS N N N N 81 CYS CA C N R 82 CYS C C N N 83 CYS O O N N 84 CYS CB C N N 85 CYS SG S N N 86 CYS OXT O N N 87 CYS H H N N 88 CYS H2 H N N 89 CYS HA H N N 90 CYS HB2 H N N 91 CYS HB3 H N N 92 CYS HG H N N 93 CYS HXT H N N 94 GLN N N N N 95 GLN CA C N S 96 GLN C C N N 97 GLN O O N N 98 GLN CB C N N 99 GLN CG C N N 100 GLN CD C N N 101 GLN OE1 O N N 102 GLN NE2 N N N 103 GLN OXT O N N 104 GLN H H N N 105 GLN H2 H N N 106 GLN HA H N N 107 GLN HB2 H N N 108 GLN HB3 H N N 109 GLN HG2 H N N 110 GLN HG3 H N N 111 GLN HE21 H N N 112 GLN HE22 H N N 113 GLN HXT H N N 114 GLU N N N N 115 GLU CA C N S 116 GLU C C N N 117 GLU O O N N 118 GLU CB C N N 119 GLU CG C N N 120 GLU CD C N N 121 GLU OE1 O N N 122 GLU OE2 O N N 123 GLU OXT O N N 124 GLU H H N N 125 GLU H2 H N N 126 GLU HA H N N 127 GLU HB2 H N N 128 GLU HB3 H N N 129 GLU HG2 H N N 130 GLU HG3 H N N 131 GLU HE2 H N N 132 GLU HXT H N N 133 GLY N N N N 134 GLY CA C N N 135 GLY C C N N 136 GLY O O N N 137 GLY OXT O N N 138 GLY H H N N 139 GLY H2 H N N 140 GLY HA2 H N N 141 GLY HA3 H N N 142 GLY HXT H N N 143 HIS N N N N 144 HIS CA C N S 145 HIS C C N N 146 HIS O O N N 147 HIS CB C N N 148 HIS CG C Y N 149 HIS ND1 N Y N 150 HIS CD2 C Y N 151 HIS CE1 C Y N 152 HIS NE2 N Y N 153 HIS OXT O N N 154 HIS H H N N 155 HIS H2 H N N 156 HIS HA H N N 157 HIS HB2 H N N 158 HIS HB3 H N N 159 HIS HD1 H N N 160 HIS HD2 H N N 161 HIS HE1 H N N 162 HIS HE2 H N N 163 HIS HXT H N N 164 ILE N N N N 165 ILE CA C N S 166 ILE C C N N 167 ILE O O N N 168 ILE CB C N S 169 ILE CG1 C N N 170 ILE CG2 C N N 171 ILE CD1 C N N 172 ILE OXT O N N 173 ILE H H N N 174 ILE H2 H N N 175 ILE HA H N N 176 ILE HB H N N 177 ILE HG12 H N N 178 ILE HG13 H N N 179 ILE HG21 H N N 180 ILE HG22 H N N 181 ILE HG23 H N N 182 ILE HD11 H N N 183 ILE HD12 H N N 184 ILE HD13 H N N 185 ILE HXT H N N 186 LEU N N N N 187 LEU CA C N S 188 LEU C C N N 189 LEU O O N N 190 LEU CB C N N 191 LEU CG C N N 192 LEU CD1 C N N 193 LEU CD2 C N N 194 LEU OXT O N N 195 LEU H H N N 196 LEU H2 H N N 197 LEU HA H N N 198 LEU HB2 H N N 199 LEU HB3 H N N 200 LEU HG H N N 201 LEU HD11 H N N 202 LEU HD12 H N N 203 LEU HD13 H N N 204 LEU HD21 H N N 205 LEU HD22 H N N 206 LEU HD23 H N N 207 LEU HXT H N N 208 LYS N N N N 209 LYS CA C N S 210 LYS C C N N 211 LYS O O N N 212 LYS CB C N N 213 LYS CG C N N 214 LYS CD C N N 215 LYS CE C N N 216 LYS NZ N N N 217 LYS OXT O N N 218 LYS H H N N 219 LYS H2 H N N 220 LYS HA H N N 221 LYS HB2 H N N 222 LYS HB3 H N N 223 LYS HG2 H N N 224 LYS HG3 H N N 225 LYS HD2 H N N 226 LYS HD3 H N N 227 LYS HE2 H N N 228 LYS HE3 H N N 229 LYS HZ1 H N N 230 LYS HZ2 H N N 231 LYS HZ3 H N N 232 LYS HXT H N N 233 MET N N N N 234 MET CA C N S 235 MET C C N N 236 MET O O N N 237 MET CB C N N 238 MET CG C N N 239 MET SD S N N 240 MET CE C N N 241 MET OXT O N N 242 MET H H N N 243 MET H2 H N N 244 MET HA H N N 245 MET HB2 H N N 246 MET HB3 H N N 247 MET HG2 H N N 248 MET HG3 H N N 249 MET HE1 H N N 250 MET HE2 H N N 251 MET HE3 H N N 252 MET HXT H N N 253 NI NI NI N N 254 PHE N N N N 255 PHE CA C N S 256 PHE C C N N 257 PHE O O N N 258 PHE CB C N N 259 PHE CG C Y N 260 PHE CD1 C Y N 261 PHE CD2 C Y N 262 PHE CE1 C Y N 263 PHE CE2 C Y N 264 PHE CZ C Y N 265 PHE OXT O N N 266 PHE H H N N 267 PHE H2 H N N 268 PHE HA H N N 269 PHE HB2 H N N 270 PHE HB3 H N N 271 PHE HD1 H N N 272 PHE HD2 H N N 273 PHE HE1 H N N 274 PHE HE2 H N N 275 PHE HZ H N N 276 PHE HXT H N N 277 PRO N N N N 278 PRO CA C N S 279 PRO C C N N 280 PRO O O N N 281 PRO CB C N N 282 PRO CG C N N 283 PRO CD C N N 284 PRO OXT O N N 285 PRO H H N N 286 PRO HA H N N 287 PRO HB2 H N N 288 PRO HB3 H N N 289 PRO HG2 H N N 290 PRO HG3 H N N 291 PRO HD2 H N N 292 PRO HD3 H N N 293 PRO HXT H N N 294 SER N N N N 295 SER CA C N S 296 SER C C N N 297 SER O O N N 298 SER CB C N N 299 SER OG O N N 300 SER OXT O N N 301 SER H H N N 302 SER H2 H N N 303 SER HA H N N 304 SER HB2 H N N 305 SER HB3 H N N 306 SER HG H N N 307 SER HXT H N N 308 THR N N N N 309 THR CA C N S 310 THR C C N N 311 THR O O N N 312 THR CB C N R 313 THR OG1 O N N 314 THR CG2 C N N 315 THR OXT O N N 316 THR H H N N 317 THR H2 H N N 318 THR HA H N N 319 THR HB H N N 320 THR HG1 H N N 321 THR HG21 H N N 322 THR HG22 H N N 323 THR HG23 H N N 324 THR HXT H N N 325 TRP N N N N 326 TRP CA C N S 327 TRP C C N N 328 TRP O O N N 329 TRP CB C N N 330 TRP CG C Y N 331 TRP CD1 C Y N 332 TRP CD2 C Y N 333 TRP NE1 N Y N 334 TRP CE2 C Y N 335 TRP CE3 C Y N 336 TRP CZ2 C Y N 337 TRP CZ3 C Y N 338 TRP CH2 C Y N 339 TRP OXT O N N 340 TRP H H N N 341 TRP H2 H N N 342 TRP HA H N N 343 TRP HB2 H N N 344 TRP HB3 H N N 345 TRP HD1 H N N 346 TRP HE1 H N N 347 TRP HE3 H N N 348 TRP HZ2 H N N 349 TRP HZ3 H N N 350 TRP HH2 H N N 351 TRP HXT H N N 352 TYR N N N N 353 TYR CA C N S 354 TYR C C N N 355 TYR O O N N 356 TYR CB C N N 357 TYR CG C Y N 358 TYR CD1 C Y N 359 TYR CD2 C Y N 360 TYR CE1 C Y N 361 TYR CE2 C Y N 362 TYR CZ C Y N 363 TYR OH O N N 364 TYR OXT O N N 365 TYR H H N N 366 TYR H2 H N N 367 TYR HA H N N 368 TYR HB2 H N N 369 TYR HB3 H N N 370 TYR HD1 H N N 371 TYR HD2 H N N 372 TYR HE1 H N N 373 TYR HE2 H N N 374 TYR HH H N N 375 TYR HXT H N N 376 VAL N N N N 377 VAL CA C N S 378 VAL C C N N 379 VAL O O N N 380 VAL CB C N N 381 VAL CG1 C N N 382 VAL CG2 C N N 383 VAL OXT O N N 384 VAL H H N N 385 VAL H2 H N N 386 VAL HA H N N 387 VAL HB H N N 388 VAL HG11 H N N 389 VAL HG12 H N N 390 VAL HG13 H N N 391 VAL HG21 H N N 392 VAL HG22 H N N 393 VAL HG23 H N N 394 VAL HXT H N N 395 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACT C O doub N N 1 ACT C OXT sing N N 2 ACT C CH3 sing N N 3 ACT CH3 H1 sing N N 4 ACT CH3 H2 sing N N 5 ACT CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 ARG N CA sing N N 19 ARG N H sing N N 20 ARG N H2 sing N N 21 ARG CA C sing N N 22 ARG CA CB sing N N 23 ARG CA HA sing N N 24 ARG C O doub N N 25 ARG C OXT sing N N 26 ARG CB CG sing N N 27 ARG CB HB2 sing N N 28 ARG CB HB3 sing N N 29 ARG CG CD sing N N 30 ARG CG HG2 sing N N 31 ARG CG HG3 sing N N 32 ARG CD NE sing N N 33 ARG CD HD2 sing N N 34 ARG CD HD3 sing N N 35 ARG NE CZ sing N N 36 ARG NE HE sing N N 37 ARG CZ NH1 sing N N 38 ARG CZ NH2 doub N N 39 ARG NH1 HH11 sing N N 40 ARG NH1 HH12 sing N N 41 ARG NH2 HH21 sing N N 42 ARG NH2 HH22 sing N N 43 ARG OXT HXT sing N N 44 ASN N CA sing N N 45 ASN N H sing N N 46 ASN N H2 sing N N 47 ASN CA C sing N N 48 ASN CA CB sing N N 49 ASN CA HA sing N N 50 ASN C O doub N N 51 ASN C OXT sing N N 52 ASN CB CG sing N N 53 ASN CB HB2 sing N N 54 ASN CB HB3 sing N N 55 ASN CG OD1 doub N N 56 ASN CG ND2 sing N N 57 ASN ND2 HD21 sing N N 58 ASN ND2 HD22 sing N N 59 ASN OXT HXT sing N N 60 ASP N CA sing N N 61 ASP N H sing N N 62 ASP N H2 sing N N 63 ASP CA C sing N N 64 ASP CA CB sing N N 65 ASP CA HA sing N N 66 ASP C O doub N N 67 ASP C OXT sing N N 68 ASP CB CG sing N N 69 ASP CB HB2 sing N N 70 ASP CB HB3 sing N N 71 ASP CG OD1 doub N N 72 ASP CG OD2 sing N N 73 ASP OD2 HD2 sing N N 74 ASP OXT HXT sing N N 75 CYS N CA sing N N 76 CYS N H sing N N 77 CYS N H2 sing N N 78 CYS CA C sing N N 79 CYS CA CB sing N N 80 CYS CA HA sing N N 81 CYS C O doub N N 82 CYS C OXT sing N N 83 CYS CB SG sing N N 84 CYS CB HB2 sing N N 85 CYS CB HB3 sing N N 86 CYS SG HG sing N N 87 CYS OXT HXT sing N N 88 GLN N CA sing N N 89 GLN N H sing N N 90 GLN N H2 sing N N 91 GLN CA C sing N N 92 GLN CA CB sing N N 93 GLN CA HA sing N N 94 GLN C O doub N N 95 GLN C OXT sing N N 96 GLN CB CG sing N N 97 GLN CB HB2 sing N N 98 GLN CB HB3 sing N N 99 GLN CG CD sing N N 100 GLN CG HG2 sing N N 101 GLN CG HG3 sing N N 102 GLN CD OE1 doub N N 103 GLN CD NE2 sing N N 104 GLN NE2 HE21 sing N N 105 GLN NE2 HE22 sing N N 106 GLN OXT HXT sing N N 107 GLU N CA sing N N 108 GLU N H sing N N 109 GLU N H2 sing N N 110 GLU CA C sing N N 111 GLU CA CB sing N N 112 GLU CA HA sing N N 113 GLU C O doub N N 114 GLU C OXT sing N N 115 GLU CB CG sing N N 116 GLU CB HB2 sing N N 117 GLU CB HB3 sing N N 118 GLU CG CD sing N N 119 GLU CG HG2 sing N N 120 GLU CG HG3 sing N N 121 GLU CD OE1 doub N N 122 GLU CD OE2 sing N N 123 GLU OE2 HE2 sing N N 124 GLU OXT HXT sing N N 125 GLY N CA sing N N 126 GLY N H sing N N 127 GLY N H2 sing N N 128 GLY CA C sing N N 129 GLY CA HA2 sing N N 130 GLY CA HA3 sing N N 131 GLY C O doub N N 132 GLY C OXT sing N N 133 GLY OXT HXT sing N N 134 HIS N CA sing N N 135 HIS N H sing N N 136 HIS N H2 sing N N 137 HIS CA C sing N N 138 HIS CA CB sing N N 139 HIS CA HA sing N N 140 HIS C O doub N N 141 HIS C OXT sing N N 142 HIS CB CG sing N N 143 HIS CB HB2 sing N N 144 HIS CB HB3 sing N N 145 HIS CG ND1 sing Y N 146 HIS CG CD2 doub Y N 147 HIS ND1 CE1 doub Y N 148 HIS ND1 HD1 sing N N 149 HIS CD2 NE2 sing Y N 150 HIS CD2 HD2 sing N N 151 HIS CE1 NE2 sing Y N 152 HIS CE1 HE1 sing N N 153 HIS NE2 HE2 sing N N 154 HIS OXT HXT sing N N 155 ILE N CA sing N N 156 ILE N H sing N N 157 ILE N H2 sing N N 158 ILE CA C sing N N 159 ILE CA CB sing N N 160 ILE CA HA sing N N 161 ILE C O doub N N 162 ILE C OXT sing N N 163 ILE CB CG1 sing N N 164 ILE CB CG2 sing N N 165 ILE CB HB sing N N 166 ILE CG1 CD1 sing N N 167 ILE CG1 HG12 sing N N 168 ILE CG1 HG13 sing N N 169 ILE CG2 HG21 sing N N 170 ILE CG2 HG22 sing N N 171 ILE CG2 HG23 sing N N 172 ILE CD1 HD11 sing N N 173 ILE CD1 HD12 sing N N 174 ILE CD1 HD13 sing N N 175 ILE OXT HXT sing N N 176 LEU N CA sing N N 177 LEU N H sing N N 178 LEU N H2 sing N N 179 LEU CA C sing N N 180 LEU CA CB sing N N 181 LEU CA HA sing N N 182 LEU C O doub N N 183 LEU C OXT sing N N 184 LEU CB CG sing N N 185 LEU CB HB2 sing N N 186 LEU CB HB3 sing N N 187 LEU CG CD1 sing N N 188 LEU CG CD2 sing N N 189 LEU CG HG sing N N 190 LEU CD1 HD11 sing N N 191 LEU CD1 HD12 sing N N 192 LEU CD1 HD13 sing N N 193 LEU CD2 HD21 sing N N 194 LEU CD2 HD22 sing N N 195 LEU CD2 HD23 sing N N 196 LEU OXT HXT sing N N 197 LYS N CA sing N N 198 LYS N H sing N N 199 LYS N H2 sing N N 200 LYS CA C sing N N 201 LYS CA CB sing N N 202 LYS CA HA sing N N 203 LYS C O doub N N 204 LYS C OXT sing N N 205 LYS CB CG sing N N 206 LYS CB HB2 sing N N 207 LYS CB HB3 sing N N 208 LYS CG CD sing N N 209 LYS CG HG2 sing N N 210 LYS CG HG3 sing N N 211 LYS CD CE sing N N 212 LYS CD HD2 sing N N 213 LYS CD HD3 sing N N 214 LYS CE NZ sing N N 215 LYS CE HE2 sing N N 216 LYS CE HE3 sing N N 217 LYS NZ HZ1 sing N N 218 LYS NZ HZ2 sing N N 219 LYS NZ HZ3 sing N N 220 LYS OXT HXT sing N N 221 MET N CA sing N N 222 MET N H sing N N 223 MET N H2 sing N N 224 MET CA C sing N N 225 MET CA CB sing N N 226 MET CA HA sing N N 227 MET C O doub N N 228 MET C OXT sing N N 229 MET CB CG sing N N 230 MET CB HB2 sing N N 231 MET CB HB3 sing N N 232 MET CG SD sing N N 233 MET CG HG2 sing N N 234 MET CG HG3 sing N N 235 MET SD CE sing N N 236 MET CE HE1 sing N N 237 MET CE HE2 sing N N 238 MET CE HE3 sing N N 239 MET OXT HXT sing N N 240 PHE N CA sing N N 241 PHE N H sing N N 242 PHE N H2 sing N N 243 PHE CA C sing N N 244 PHE CA CB sing N N 245 PHE CA HA sing N N 246 PHE C O doub N N 247 PHE C OXT sing N N 248 PHE CB CG sing N N 249 PHE CB HB2 sing N N 250 PHE CB HB3 sing N N 251 PHE CG CD1 doub Y N 252 PHE CG CD2 sing Y N 253 PHE CD1 CE1 sing Y N 254 PHE CD1 HD1 sing N N 255 PHE CD2 CE2 doub Y N 256 PHE CD2 HD2 sing N N 257 PHE CE1 CZ doub Y N 258 PHE CE1 HE1 sing N N 259 PHE CE2 CZ sing Y N 260 PHE CE2 HE2 sing N N 261 PHE CZ HZ sing N N 262 PHE OXT HXT sing N N 263 PRO N CA sing N N 264 PRO N CD sing N N 265 PRO N H sing N N 266 PRO CA C sing N N 267 PRO CA CB sing N N 268 PRO CA HA sing N N 269 PRO C O doub N N 270 PRO C OXT sing N N 271 PRO CB CG sing N N 272 PRO CB HB2 sing N N 273 PRO CB HB3 sing N N 274 PRO CG CD sing N N 275 PRO CG HG2 sing N N 276 PRO CG HG3 sing N N 277 PRO CD HD2 sing N N 278 PRO CD HD3 sing N N 279 PRO OXT HXT sing N N 280 SER N CA sing N N 281 SER N H sing N N 282 SER N H2 sing N N 283 SER CA C sing N N 284 SER CA CB sing N N 285 SER CA HA sing N N 286 SER C O doub N N 287 SER C OXT sing N N 288 SER CB OG sing N N 289 SER CB HB2 sing N N 290 SER CB HB3 sing N N 291 SER OG HG sing N N 292 SER OXT HXT sing N N 293 THR N CA sing N N 294 THR N H sing N N 295 THR N H2 sing N N 296 THR CA C sing N N 297 THR CA CB sing N N 298 THR CA HA sing N N 299 THR C O doub N N 300 THR C OXT sing N N 301 THR CB OG1 sing N N 302 THR CB CG2 sing N N 303 THR CB HB sing N N 304 THR OG1 HG1 sing N N 305 THR CG2 HG21 sing N N 306 THR CG2 HG22 sing N N 307 THR CG2 HG23 sing N N 308 THR OXT HXT sing N N 309 TRP N CA sing N N 310 TRP N H sing N N 311 TRP N H2 sing N N 312 TRP CA C sing N N 313 TRP CA CB sing N N 314 TRP CA HA sing N N 315 TRP C O doub N N 316 TRP C OXT sing N N 317 TRP CB CG sing N N 318 TRP CB HB2 sing N N 319 TRP CB HB3 sing N N 320 TRP CG CD1 doub Y N 321 TRP CG CD2 sing Y N 322 TRP CD1 NE1 sing Y N 323 TRP CD1 HD1 sing N N 324 TRP CD2 CE2 doub Y N 325 TRP CD2 CE3 sing Y N 326 TRP NE1 CE2 sing Y N 327 TRP NE1 HE1 sing N N 328 TRP CE2 CZ2 sing Y N 329 TRP CE3 CZ3 doub Y N 330 TRP CE3 HE3 sing N N 331 TRP CZ2 CH2 doub Y N 332 TRP CZ2 HZ2 sing N N 333 TRP CZ3 CH2 sing Y N 334 TRP CZ3 HZ3 sing N N 335 TRP CH2 HH2 sing N N 336 TRP OXT HXT sing N N 337 TYR N CA sing N N 338 TYR N H sing N N 339 TYR N H2 sing N N 340 TYR CA C sing N N 341 TYR CA CB sing N N 342 TYR CA HA sing N N 343 TYR C O doub N N 344 TYR C OXT sing N N 345 TYR CB CG sing N N 346 TYR CB HB2 sing N N 347 TYR CB HB3 sing N N 348 TYR CG CD1 doub Y N 349 TYR CG CD2 sing Y N 350 TYR CD1 CE1 sing Y N 351 TYR CD1 HD1 sing N N 352 TYR CD2 CE2 doub Y N 353 TYR CD2 HD2 sing N N 354 TYR CE1 CZ doub Y N 355 TYR CE1 HE1 sing N N 356 TYR CE2 CZ sing Y N 357 TYR CE2 HE2 sing N N 358 TYR CZ OH sing N N 359 TYR OH HH sing N N 360 TYR OXT HXT sing N N 361 VAL N CA sing N N 362 VAL N H sing N N 363 VAL N H2 sing N N 364 VAL CA C sing N N 365 VAL CA CB sing N N 366 VAL CA HA sing N N 367 VAL C O doub N N 368 VAL C OXT sing N N 369 VAL CB CG1 sing N N 370 VAL CB CG2 sing N N 371 VAL CB HB sing N N 372 VAL CG1 HG11 sing N N 373 VAL CG1 HG12 sing N N 374 VAL CG1 HG13 sing N N 375 VAL CG2 HG21 sing N N 376 VAL CG2 HG22 sing N N 377 VAL CG2 HG23 sing N N 378 VAL OXT HXT sing N N 379 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ACETATE ION' ACT 3 'NICKEL (II) ION' NI # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1WA6 _pdbx_initial_refinement_model.details ? #