data_5TGY # _entry.id 5TGY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5TGY pdb_00005tgy 10.2210/pdb5tgy/pdb WWPDB D_1000224141 ? ? BMRB 30186 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type BMRB 'NMR structure of holo-PS1' 30186 unspecified PDB . 5TGW unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5TGY _pdbx_database_status.recvd_initial_deposition_date 2016-09-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Polizzi, N.F.' 1 'Wu, Y.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Chem' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1755-4349 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 9 _citation.language ? _citation.page_first 1157 _citation.page_last 1164 _citation.title 'De novo design of a hyperstable non-natural protein-ligand complex with sub- angstrom accuracy.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/nchem.2846 _citation.pdbx_database_id_PubMed 29168496 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Polizzi, N.F.' 1 ? primary 'Wu, Y.' 2 ? primary 'Lemmin, T.' 3 ? primary 'Maxwell, A.M.' 4 ? primary 'Zhang, S.Q.' 5 ? primary 'Rawson, J.' 6 ? primary 'Beratan, D.N.' 7 ? primary 'Therien, M.J.' 8 ? primary 'DeGrado, W.F.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man PS1 12965.262 1 ? ? ? ? 2 non-polymer syn '[5,10,15,20-tetrakis(trifluoromethyl)porphyrinato(2-)-kappa~4~N~21~,N~22~,N~23~,N~24~]zinc' 645.737 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SEFEKLRQTGDELVQAFQRLREIFDKGDDDSLEQVLEEIEELIQKHRQLFDNRQEAADTEAAKQGDQWVQLFQRFREAID KGDKDSLEQLLEELEQALQKIRELAEKKN ; _entity_poly.pdbx_seq_one_letter_code_can ;SEFEKLRQTGDELVQAFQRLREIFDKGDDDSLEQVLEEIEELIQKHRQLFDNRQEAADTEAAKQGDQWVQLFQRFREAID KGDKDSLEQLLEELEQALQKIRELAEKKN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLU n 1 3 PHE n 1 4 GLU n 1 5 LYS n 1 6 LEU n 1 7 ARG n 1 8 GLN n 1 9 THR n 1 10 GLY n 1 11 ASP n 1 12 GLU n 1 13 LEU n 1 14 VAL n 1 15 GLN n 1 16 ALA n 1 17 PHE n 1 18 GLN n 1 19 ARG n 1 20 LEU n 1 21 ARG n 1 22 GLU n 1 23 ILE n 1 24 PHE n 1 25 ASP n 1 26 LYS n 1 27 GLY n 1 28 ASP n 1 29 ASP n 1 30 ASP n 1 31 SER n 1 32 LEU n 1 33 GLU n 1 34 GLN n 1 35 VAL n 1 36 LEU n 1 37 GLU n 1 38 GLU n 1 39 ILE n 1 40 GLU n 1 41 GLU n 1 42 LEU n 1 43 ILE n 1 44 GLN n 1 45 LYS n 1 46 HIS n 1 47 ARG n 1 48 GLN n 1 49 LEU n 1 50 PHE n 1 51 ASP n 1 52 ASN n 1 53 ARG n 1 54 GLN n 1 55 GLU n 1 56 ALA n 1 57 ALA n 1 58 ASP n 1 59 THR n 1 60 GLU n 1 61 ALA n 1 62 ALA n 1 63 LYS n 1 64 GLN n 1 65 GLY n 1 66 ASP n 1 67 GLN n 1 68 TRP n 1 69 VAL n 1 70 GLN n 1 71 LEU n 1 72 PHE n 1 73 GLN n 1 74 ARG n 1 75 PHE n 1 76 ARG n 1 77 GLU n 1 78 ALA n 1 79 ILE n 1 80 ASP n 1 81 LYS n 1 82 GLY n 1 83 ASP n 1 84 LYS n 1 85 ASP n 1 86 SER n 1 87 LEU n 1 88 GLU n 1 89 GLN n 1 90 LEU n 1 91 LEU n 1 92 GLU n 1 93 GLU n 1 94 LEU n 1 95 GLU n 1 96 GLN n 1 97 ALA n 1 98 LEU n 1 99 GLN n 1 100 LYS n 1 101 ILE n 1 102 ARG n 1 103 GLU n 1 104 LEU n 1 105 ALA n 1 106 GLU n 1 107 LYS n 1 108 LYS n 1 109 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 109 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 5TGY _struct_ref.pdbx_db_accession 5TGY _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5TGY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 109 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 5TGY _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 109 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 109 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 7BU non-polymer . '[5,10,15,20-tetrakis(trifluoromethyl)porphyrinato(2-)-kappa~4~N~21~,N~22~,N~23~,N~24~]zinc' '[5,10,15,20-Tetrakis(trifluoromethyl)porphinato]zinc(II)' 'C24 H8 F12 N4 Zn' 645.737 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D HNCACB' 1 isotropic 2 1 1 '3D CBCA(CO)NH' 1 isotropic 3 1 1 '3D HNCO' 1 isotropic 4 1 1 '3D CO(CA)NH' 1 isotropic 5 1 1 '3D CCH-TOCSY' 1 isotropic 6 1 1 '3D simultaneous NOESY' 1 isotropic 7 1 1 '2D 1H-13C HSQC aliphatic' 1 isotropic 8 1 1 '2D 1H-15N HSQC' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100 mM NaCl, 50 mM NaPi' _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '780 uM [U-100% 13C; U-100% 15N] holo-PS1, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label 15N13C _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE II' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 900 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 5TGY _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 5 # _pdbx_nmr_ensemble.entry_id 5TGY _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5TGY _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' AutoAssign ? 'Zimmerman, Moseley, Kulikowski and Montelione' 2 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 3 'peak picking' XEASY ? 'Bartels et al.' 4 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 5 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 6 'data analysis' TALOS ? 'Cornilescu, Delaglio and Bax' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5TGY _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5TGY _struct.title 'NMR structure of holo-PS1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5TGY _struct_keywords.text '4-helix bundle, coiled-coil, holoprotein, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 2 ? LYS A 26 ? GLU A 2 LYS A 26 1 ? 25 HELX_P HELX_P2 AA2 ASP A 28 ? ARG A 53 ? ASP A 28 ARG A 53 1 ? 26 HELX_P HELX_P3 AA3 ASP A 58 ? LYS A 81 ? ASP A 58 LYS A 81 1 ? 24 HELX_P HELX_P4 AA4 ASP A 83 ? GLU A 106 ? ASP A 83 GLU A 106 1 ? 24 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id metalc1 _struct_conn.conn_type_id metalc _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id HIS _struct_conn.ptnr1_label_seq_id 46 _struct_conn.ptnr1_label_atom_id NE2 _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id 7BU _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id ZN _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id HIS _struct_conn.ptnr1_auth_seq_id 46 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id 7BU _struct_conn.ptnr2_auth_seq_id 201 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.130 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id 7BU _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 18 _struct_site.details 'binding site for residue 7BU A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 18 LEU A 6 ? LEU A 6 . ? 1_555 ? 2 AC1 18 ARG A 7 ? ARG A 7 . ? 1_555 ? 3 AC1 18 GLY A 10 ? GLY A 10 . ? 1_555 ? 4 AC1 18 LEU A 13 ? LEU A 13 . ? 1_555 ? 5 AC1 18 HIS A 46 ? HIS A 46 . ? 1_555 ? 6 AC1 18 ARG A 47 ? ARG A 47 . ? 1_555 ? 7 AC1 18 PHE A 50 ? PHE A 50 . ? 1_555 ? 8 AC1 18 ALA A 56 ? ALA A 56 . ? 1_555 ? 9 AC1 18 ALA A 57 ? ALA A 57 . ? 1_555 ? 10 AC1 18 ALA A 62 ? ALA A 62 . ? 1_555 ? 11 AC1 18 GLY A 65 ? GLY A 65 . ? 1_555 ? 12 AC1 18 ASP A 66 ? ASP A 66 . ? 1_555 ? 13 AC1 18 TRP A 68 ? TRP A 68 . ? 1_555 ? 14 AC1 18 VAL A 69 ? VAL A 69 . ? 1_555 ? 15 AC1 18 LEU A 98 ? LEU A 98 . ? 1_555 ? 16 AC1 18 ILE A 101 ? ILE A 101 . ? 1_555 ? 17 AC1 18 ARG A 102 ? ARG A 102 . ? 1_555 ? 18 AC1 18 ALA A 105 ? ALA A 105 . ? 1_555 ? # _atom_sites.entry_id 5TGY _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C F H N O ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 TRP 68 68 68 TRP TRP A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 GLN 89 89 89 GLN GLN A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 ILE 101 101 101 ILE ILE A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 ASN 109 109 109 ASN ASN A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id 7BU _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 110 _pdbx_nonpoly_scheme.pdb_mon_id 7BU _pdbx_nonpoly_scheme.auth_mon_id POF _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 46 ? A HIS 46 ? 1_555 ZN ? B 7BU . ? A 7BU 201 ? 1_555 NB2 ? B 7BU . ? A 7BU 201 ? 1_555 101.5 ? 2 NE2 ? A HIS 46 ? A HIS 46 ? 1_555 ZN ? B 7BU . ? A 7BU 201 ? 1_555 NC3 ? B 7BU . ? A 7BU 201 ? 1_555 101.7 ? 3 NB2 ? B 7BU . ? A 7BU 201 ? 1_555 ZN ? B 7BU . ? A 7BU 201 ? 1_555 NC3 ? B 7BU . ? A 7BU 201 ? 1_555 88.1 ? 4 NE2 ? A HIS 46 ? A HIS 46 ? 1_555 ZN ? B 7BU . ? A 7BU 201 ? 1_555 NA1 ? B 7BU . ? A 7BU 201 ? 1_555 103.6 ? 5 NB2 ? B 7BU . ? A 7BU 201 ? 1_555 ZN ? B 7BU . ? A 7BU 201 ? 1_555 NA1 ? B 7BU . ? A 7BU 201 ? 1_555 87.3 ? 6 NC3 ? B 7BU . ? A 7BU 201 ? 1_555 ZN ? B 7BU . ? A 7BU 201 ? 1_555 NA1 ? B 7BU . ? A 7BU 201 ? 1_555 154.6 ? 7 NE2 ? A HIS 46 ? A HIS 46 ? 1_555 ZN ? B 7BU . ? A 7BU 201 ? 1_555 ND4 ? B 7BU . ? A 7BU 201 ? 1_555 101.7 ? 8 NB2 ? B 7BU . ? A 7BU 201 ? 1_555 ZN ? B 7BU . ? A 7BU 201 ? 1_555 ND4 ? B 7BU . ? A 7BU 201 ? 1_555 156.7 ? 9 NC3 ? B 7BU . ? A 7BU 201 ? 1_555 ZN ? B 7BU . ? A 7BU 201 ? 1_555 ND4 ? B 7BU . ? A 7BU 201 ? 1_555 87.0 ? 10 NA1 ? B 7BU . ? A 7BU 201 ? 1_555 ZN ? B 7BU . ? A 7BU 201 ? 1_555 ND4 ? B 7BU . ? A 7BU 201 ? 1_555 87.4 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-08-09 2 'Structure model' 1 1 2017-09-27 3 'Structure model' 1 2 2017-12-06 4 'Structure model' 1 3 2019-11-27 5 'Structure model' 1 4 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Author supporting evidence' 4 4 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 5 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 4 'Structure model' pdbx_audit_support 5 4 'Structure model' pdbx_nmr_spectrometer 6 5 'Structure model' database_2 7 5 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 3 'Structure model' '_citation.journal_abbrev' 3 3 'Structure model' '_citation.journal_volume' 4 3 'Structure model' '_citation.page_first' 5 3 'Structure model' '_citation.page_last' 6 3 'Structure model' '_citation.pdbx_database_id_DOI' 7 3 'Structure model' '_citation.pdbx_database_id_PubMed' 8 3 'Structure model' '_citation.title' 9 3 'Structure model' '_citation_author.name' 10 4 'Structure model' '_pdbx_audit_support.funding_organization' 11 4 'Structure model' '_pdbx_nmr_spectrometer.model' 12 5 'Structure model' '_database_2.pdbx_DOI' 13 5 'Structure model' '_database_2.pdbx_database_accession' 14 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 holo-PS1 780 ? uM '[U-100% 13C; U-100% 15N]' 2 holo-PS1 780 ? uM '[10% 13C; U-100% 15N]' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE2 A GLU 103 ? ? HZ2 A LYS 107 ? ? 1.58 2 2 HH12 A ARG 47 ? ? OD2 A ASP 66 ? ? 1.60 3 4 OD1 A ASP 58 ? ? HZ3 A LYS 108 ? ? 1.56 4 4 H1 A SER 1 ? ? OE2 A GLU 55 ? ? 1.57 5 8 OD2 A ASP 58 ? ? HZ3 A LYS 107 ? ? 1.58 6 10 OD1 A ASP 58 ? ? HZ3 A LYS 107 ? ? 1.57 7 11 OD1 A ASP 83 ? ? HG A SER 86 ? ? 1.59 8 13 OE1 A GLU 41 ? ? HZ1 A LYS 45 ? ? 1.57 9 20 OE2 A GLU 60 ? ? HZ1 A LYS 63 ? ? 1.58 10 20 OE1 A GLU 12 ? ? HZ2 A LYS 45 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 55 ? ? -105.41 -62.38 2 1 ALA A 56 ? ? 65.88 167.32 3 1 ASP A 58 ? ? 174.22 158.75 4 2 ARG A 53 ? ? -133.75 -65.92 5 2 GLN A 54 ? ? 65.12 153.14 6 2 ALA A 57 ? ? -147.87 -159.31 7 2 LYS A 107 ? ? -163.68 -108.19 8 2 LYS A 108 ? ? 157.70 -59.00 9 3 ALA A 57 ? ? 68.92 -67.49 10 3 LYS A 107 ? ? -79.28 33.16 11 3 LYS A 108 ? ? -135.82 -84.70 12 4 ARG A 53 ? ? -174.62 34.60 13 4 GLN A 54 ? ? 73.95 -57.78 14 4 GLU A 55 ? ? 70.21 -52.79 15 4 LYS A 107 ? ? -176.46 99.60 16 6 GLU A 2 ? ? -168.98 -31.90 17 6 ASN A 52 ? ? -97.36 -74.90 18 6 GLN A 54 ? ? -93.38 -89.57 19 6 ALA A 57 ? ? 71.19 -54.57 20 7 GLU A 55 ? ? 56.27 70.91 21 7 ALA A 57 ? ? -138.96 -120.37 22 7 LYS A 108 ? ? -52.22 106.01 23 8 GLU A 2 ? ? -133.23 -62.07 24 8 GLU A 55 ? ? 67.41 -53.34 25 8 ALA A 57 ? ? 72.81 -31.34 26 8 LYS A 107 ? ? 59.43 -84.94 27 9 ASN A 52 ? ? -77.16 -83.66 28 9 GLN A 54 ? ? 72.75 -68.87 29 10 GLU A 55 ? ? -85.06 31.42 30 10 LYS A 107 ? ? 53.98 -79.22 31 10 LYS A 108 ? ? 66.77 84.82 32 11 GLU A 2 ? ? 58.79 77.16 33 11 ARG A 53 ? ? -145.21 -12.43 34 11 GLN A 54 ? ? 66.30 155.97 35 11 GLU A 55 ? ? -145.82 28.91 36 11 ALA A 56 ? ? 64.68 -81.84 37 11 ALA A 57 ? ? 60.60 -81.90 38 11 LYS A 107 ? ? 70.46 -31.51 39 11 LYS A 108 ? ? 173.99 -42.48 40 12 ASN A 52 ? ? -80.11 39.02 41 12 ARG A 53 ? ? 70.49 -80.17 42 12 GLN A 54 ? ? 57.33 -155.88 43 12 ALA A 57 ? ? 65.92 -71.70 44 12 LYS A 107 ? ? 46.86 -91.26 45 13 ASN A 52 ? ? -64.51 -70.29 46 13 GLN A 54 ? ? 75.80 153.12 47 13 LYS A 108 ? ? 40.79 85.82 48 14 ARG A 53 ? ? 75.67 72.72 49 14 ASP A 58 ? ? -178.33 147.14 50 14 LYS A 108 ? ? 66.64 -42.62 51 15 ASP A 58 ? ? -172.64 139.34 52 15 LYS A 107 ? ? 58.33 -81.35 53 16 ARG A 53 ? ? -152.03 -38.99 54 16 GLN A 54 ? ? 80.05 -45.85 55 16 GLU A 55 ? ? -32.49 112.13 56 16 ALA A 57 ? ? 70.83 -45.08 57 16 LYS A 107 ? ? -171.74 98.22 58 16 LYS A 108 ? ? -165.36 -58.48 59 17 GLU A 2 ? ? 72.51 -9.50 60 17 ALA A 57 ? ? 68.48 -177.92 61 17 LYS A 108 ? ? 68.85 141.74 62 18 GLU A 2 ? ? 64.80 102.40 63 18 ARG A 53 ? ? -157.96 84.38 64 18 GLU A 55 ? ? -37.39 107.29 65 19 LYS A 108 ? ? 68.70 -59.79 66 20 GLU A 55 ? ? 57.78 -161.98 67 20 ALA A 57 ? ? 69.68 -54.83 68 20 LYS A 108 ? ? 63.05 172.36 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Science Foundation (NSF, United States)' 'United States' CHE-1413333 1 'National Science Foundation (NSF, United States)' 'United States' CHE-1413295 2 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM-071628 3 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM-048043 4 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name '[5,10,15,20-tetrakis(trifluoromethyl)porphyrinato(2-)-kappa~4~N~21~,N~22~,N~23~,N~24~]zinc' _pdbx_entity_nonpoly.comp_id 7BU #