data_5TJC # _entry.id 5TJC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5TJC pdb_00005tjc 10.2210/pdb5tjc/pdb WWPDB D_1000224343 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 5TJB PDB . unspecified 5TJA PDB . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5TJC _pdbx_database_status.recvd_initial_deposition_date 2016-10-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Li, M.' 1 'Zhang, W.K.' 2 'Benvin, N.M.' 3 'Zhou, X.' 4 'Su, D.' 5 'Li, H.' 6 'Wang, S.' 7 'Michailidis, I.E.' 8 'Tong, L.' 9 'Li, X.' 10 'Yang, J.' 11 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat. Struct. Mol. Biol.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1545-9985 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 24 _citation.language ? _citation.page_first 205 _citation.page_last 213 _citation.title 'Structural basis of dual Ca(2+)/pH regulation of the endolysosomal TRPML1 channel.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/nsmb.3362 _citation.pdbx_database_id_PubMed 28112729 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Li, M.' 1 ? primary 'Zhang, W.K.' 2 ? primary 'Benvin, N.M.' 3 ? primary 'Zhou, X.' 4 ? primary 'Su, D.' 5 ? primary 'Li, H.' 6 ? primary 'Wang, S.' 7 ? primary 'Michailidis, I.E.' 8 ? primary 'Tong, L.' 9 ? primary 'Li, X.' 10 ? primary 'Yang, J.' 11 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5TJC _cell.details ? _cell.formula_units_Z ? _cell.length_a 182.811 _cell.length_a_esd ? _cell.length_b 182.811 _cell.length_b_esd ? _cell.length_c 182.811 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 96 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5TJC _symmetry.cell_setting ? _symmetry.Int_Tables_number 209 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'F 4 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Mucolipin-1 25195.057 1 ? ? 'UNP residues (84-296)' ? 2 water nat water 18.015 66 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name MG-2,Mucolipidin # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSGLSNQLAVTFREENTIAFRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYVRGGGDPWTNGS GLALCQRYYHRGHVDPANDTFDIDPMVVTDCIQVDPPERPPPPPSDDLTLLESSSSYKNLTLKFHKLVNVTIHFRLKTIN LQSLINNEIPDCYTFSVLITFDNKAHSGRIPISLETQAHIQECKHPSVFQHGDNSLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;GSGLSNQLAVTFREENTIAFRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYVRGGGDPWTNGS GLALCQRYYHRGHVDPANDTFDIDPMVVTDCIQVDPPERPPPPPSDDLTLLESSSSYKNLTLKFHKLVNVTIHFRLKTIN LQSLINNEIPDCYTFSVLITFDNKAHSGRIPISLETQAHIQECKHPSVFQHGDNSLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 GLY n 1 4 LEU n 1 5 SER n 1 6 ASN n 1 7 GLN n 1 8 LEU n 1 9 ALA n 1 10 VAL n 1 11 THR n 1 12 PHE n 1 13 ARG n 1 14 GLU n 1 15 GLU n 1 16 ASN n 1 17 THR n 1 18 ILE n 1 19 ALA n 1 20 PHE n 1 21 ARG n 1 22 HIS n 1 23 LEU n 1 24 PHE n 1 25 LEU n 1 26 LEU n 1 27 GLY n 1 28 TYR n 1 29 SER n 1 30 ASP n 1 31 GLY n 1 32 ALA n 1 33 ASP n 1 34 ASP n 1 35 THR n 1 36 PHE n 1 37 ALA n 1 38 ALA n 1 39 TYR n 1 40 THR n 1 41 ARG n 1 42 GLU n 1 43 GLN n 1 44 LEU n 1 45 TYR n 1 46 GLN n 1 47 ALA n 1 48 ILE n 1 49 PHE n 1 50 HIS n 1 51 ALA n 1 52 VAL n 1 53 ASP n 1 54 GLN n 1 55 TYR n 1 56 LEU n 1 57 ALA n 1 58 LEU n 1 59 PRO n 1 60 ASP n 1 61 VAL n 1 62 SER n 1 63 LEU n 1 64 GLY n 1 65 ARG n 1 66 TYR n 1 67 ALA n 1 68 TYR n 1 69 VAL n 1 70 ARG n 1 71 GLY n 1 72 GLY n 1 73 GLY n 1 74 ASP n 1 75 PRO n 1 76 TRP n 1 77 THR n 1 78 ASN n 1 79 GLY n 1 80 SER n 1 81 GLY n 1 82 LEU n 1 83 ALA n 1 84 LEU n 1 85 CYS n 1 86 GLN n 1 87 ARG n 1 88 TYR n 1 89 TYR n 1 90 HIS n 1 91 ARG n 1 92 GLY n 1 93 HIS n 1 94 VAL n 1 95 ASP n 1 96 PRO n 1 97 ALA n 1 98 ASN n 1 99 ASP n 1 100 THR n 1 101 PHE n 1 102 ASP n 1 103 ILE n 1 104 ASP n 1 105 PRO n 1 106 MET n 1 107 VAL n 1 108 VAL n 1 109 THR n 1 110 ASP n 1 111 CYS n 1 112 ILE n 1 113 GLN n 1 114 VAL n 1 115 ASP n 1 116 PRO n 1 117 PRO n 1 118 GLU n 1 119 ARG n 1 120 PRO n 1 121 PRO n 1 122 PRO n 1 123 PRO n 1 124 PRO n 1 125 SER n 1 126 ASP n 1 127 ASP n 1 128 LEU n 1 129 THR n 1 130 LEU n 1 131 LEU n 1 132 GLU n 1 133 SER n 1 134 SER n 1 135 SER n 1 136 SER n 1 137 TYR n 1 138 LYS n 1 139 ASN n 1 140 LEU n 1 141 THR n 1 142 LEU n 1 143 LYS n 1 144 PHE n 1 145 HIS n 1 146 LYS n 1 147 LEU n 1 148 VAL n 1 149 ASN n 1 150 VAL n 1 151 THR n 1 152 ILE n 1 153 HIS n 1 154 PHE n 1 155 ARG n 1 156 LEU n 1 157 LYS n 1 158 THR n 1 159 ILE n 1 160 ASN n 1 161 LEU n 1 162 GLN n 1 163 SER n 1 164 LEU n 1 165 ILE n 1 166 ASN n 1 167 ASN n 1 168 GLU n 1 169 ILE n 1 170 PRO n 1 171 ASP n 1 172 CYS n 1 173 TYR n 1 174 THR n 1 175 PHE n 1 176 SER n 1 177 VAL n 1 178 LEU n 1 179 ILE n 1 180 THR n 1 181 PHE n 1 182 ASP n 1 183 ASN n 1 184 LYS n 1 185 ALA n 1 186 HIS n 1 187 SER n 1 188 GLY n 1 189 ARG n 1 190 ILE n 1 191 PRO n 1 192 ILE n 1 193 SER n 1 194 LEU n 1 195 GLU n 1 196 THR n 1 197 GLN n 1 198 ALA n 1 199 HIS n 1 200 ILE n 1 201 GLN n 1 202 GLU n 1 203 CYS n 1 204 LYS n 1 205 HIS n 1 206 PRO n 1 207 SER n 1 208 VAL n 1 209 PHE n 1 210 GLN n 1 211 HIS n 1 212 GLY n 1 213 ASP n 1 214 ASN n 1 215 SER n 1 216 LEU n 1 217 GLU n 1 218 HIS n 1 219 HIS n 1 220 HIS n 1 221 HIS n 1 222 HIS n 1 223 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 223 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MCOLN1, ML4, MSTP080' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain DE3 _entity_src_gen.pdbx_host_org_variant 'Rosetta-gami 2' _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET26b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MCLN1_HUMAN _struct_ref.pdbx_db_accession Q9GZU1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GLSNQLAVTFREENTIAFRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYVRGGGDPWTNGSGL ALCQRYYHRGHVDPANDTFDIDPMVVTDCIQVDPPERPPPPPSDDLTLLESSSSYKNLTLKFHKLVNVTIHFRLKTINLQ SLINNEIPDCYTFSVLITFDNKAHSGRIPISLETQAHIQECKHPSVFQHGDNS ; _struct_ref.pdbx_align_begin 84 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5TJC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 215 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9GZU1 _struct_ref_seq.db_align_beg 84 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 296 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 84 _struct_ref_seq.pdbx_auth_seq_align_end 296 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5TJC GLY A 1 ? UNP Q9GZU1 ? ? 'expression tag' 82 1 1 5TJC SER A 2 ? UNP Q9GZU1 ? ? 'expression tag' 83 2 1 5TJC LEU A 216 ? UNP Q9GZU1 ? ? 'expression tag' 297 3 1 5TJC GLU A 217 ? UNP Q9GZU1 ? ? 'expression tag' 298 4 1 5TJC HIS A 218 ? UNP Q9GZU1 ? ? 'expression tag' 299 5 1 5TJC HIS A 219 ? UNP Q9GZU1 ? ? 'expression tag' 300 6 1 5TJC HIS A 220 ? UNP Q9GZU1 ? ? 'expression tag' 301 7 1 5TJC HIS A 221 ? UNP Q9GZU1 ? ? 'expression tag' 302 8 1 5TJC HIS A 222 ? UNP Q9GZU1 ? ? 'expression tag' 303 9 1 5TJC HIS A 223 ? UNP Q9GZU1 ? ? 'expression tag' 304 10 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5TJC _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.53 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.30 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100 mM magnesium sulfate, 4% PEG 3350, 100 mM HEPES at pH 7.5, macroseeding' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-11-19 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0750 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSLS BEAMLINE X29A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0750 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X29A _diffrn_source.pdbx_synchrotron_site NSLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5TJC _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.4 _reflns.d_resolution_low 20 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10548 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.2 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.059 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 22.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.40 _reflns_shell.d_res_low 2.49 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.7 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 98.6 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.34 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 4.1 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.0000 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 0.0000 _refine.B_iso_max 112.790 _refine.B_iso_mean 50.4821 _refine.B_iso_min 24.470 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5TJC _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.4000 _refine.ls_d_res_low 20.0000 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10121 _refine.ls_number_reflns_R_free 1033 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 94.3000 _refine.ls_percent_reflns_R_free 9.6000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2533 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2156 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol 47.6387 _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5TJA _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.4000 _refine_hist.d_res_low 20.0000 _refine_hist.pdbx_number_atoms_ligand 66 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1492 _refine_hist.pdbx_number_residues_total 176 _refine_hist.pdbx_B_iso_mean_ligand 47.81 _refine_hist.pdbx_number_atoms_protein 1426 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? ? ? c_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.385 ? ? ? c_angle_d ? ? 'X-RAY DIFFRACTION' ? 1.664 1.500 ? ? c_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.189 2.000 ? ? c_scbond_it ? ? 'X-RAY DIFFRACTION' ? 2.934 2.000 ? ? c_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 3.333 2.500 ? ? c_scangle_it ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.4000 2.4900 928 . 98 830 88.5000 . . . 0.3282 . 0.2768 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 2.4900 2.5800 938 . 87 851 90.4000 . . . 0.2860 . 0.2523 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 2.5800 2.7000 954 . 81 873 91.8000 . . . 0.3195 . 0.2708 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 2.7000 2.8400 993 . 100 893 94.0000 . . . 0.3214 . 0.2794 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 2.8400 3.0200 998 . 99 899 96.2000 . . . 0.2573 . 0.2295 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 3.0200 3.2500 1029 . 128 901 96.6000 . . . 0.2765 . 0.2143 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 3.2500 3.5800 1045 . 106 939 98.0000 . . . 0.2366 . 0.2038 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 3.5800 4.0900 1052 . 112 940 97.3000 . . . 0.2400 . 0.2042 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 4.0900 5.1400 1069 . 109 960 96.8000 . . . 0.2397 . 0.1803 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 5.1400 20.0000 1115 . 113 1002 93.0000 . . . 0.2228 . 0.2171 . . . . . . 10 . . . # loop_ _pdbx_xplor_file.pdbx_refine_id _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file 'X-RAY DIFFRACTION' 1 CNS_TOPPAR:protein_rep.param CNS_TOPPAR:protein.top 'X-RAY DIFFRACTION' 2 CNS_TOPPAR:dna-rna_rep.param CNS_TOPPAR:dna-rna.top 'X-RAY DIFFRACTION' 3 CNS_TOPPAR:water_rep.param CNS_TOPPAR:water.top 'X-RAY DIFFRACTION' 4 CNS_TOPPAR:ion.param CNS_TOPPAR:ion.top 'X-RAY DIFFRACTION' 5 CNS_TOPPAR:carbohydrate.param CNS_TOPPAR:carbohydrate.top # _struct.entry_id 5TJC _struct.title 'I-II linker of TRPML1 channel at pH 7.5' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5TJC _struct_keywords.text 'endolysosomal lumen, tetramer, calcium and pH regulation, TRANSPORT PROTEIN' _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 6 ? LEU A 25 ? ASN A 87 LEU A 106 1 ? 20 HELX_P HELX_P2 AA2 THR A 40 ? SER A 62 ? THR A 121 SER A 143 1 ? 23 HELX_P HELX_P3 AA3 LYS A 143 ? HIS A 145 ? LYS A 224 HIS A 226 5 ? 3 HELX_P HELX_P4 AA4 LEU A 161 ? ILE A 165 ? LEU A 242 ILE A 246 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 85 SG ? ? ? 1_555 A CYS 111 SG ? ? A CYS 166 A CYS 192 1_555 ? ? ? ? ? ? ? 2.051 ? ? disulf2 disulf ? ? A CYS 172 SG ? ? ? 1_555 A CYS 203 SG ? ? A CYS 253 A CYS 284 1_555 ? ? ? ? ? ? ? 2.033 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 37 ? ALA A 38 ? ALA A 118 ALA A 119 AA1 2 ILE A 190 ? GLN A 201 ? ILE A 271 GLN A 282 AA1 3 ASP A 171 ? ASP A 182 ? ASP A 252 ASP A 263 AA1 4 LEU A 147 ? ASN A 160 ? LEU A 228 ASN A 241 AA1 5 ALA A 67 ? TYR A 68 ? ALA A 148 TYR A 149 AA2 1 ALA A 37 ? ALA A 38 ? ALA A 118 ALA A 119 AA2 2 ILE A 190 ? GLN A 201 ? ILE A 271 GLN A 282 AA2 3 ASP A 171 ? ASP A 182 ? ASP A 252 ASP A 263 AA2 4 LEU A 147 ? ASN A 160 ? LEU A 228 ASN A 241 AA2 5 LEU A 82 ? ASP A 95 ? LEU A 163 ASP A 176 AA2 6 THR A 100 ? VAL A 114 ? THR A 181 VAL A 195 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ALA A 38 ? N ALA A 119 O ILE A 190 ? O ILE A 271 AA1 2 3 O GLU A 195 ? O GLU A 276 N LEU A 178 ? N LEU A 259 AA1 3 4 O PHE A 175 ? O PHE A 256 N LEU A 156 ? N LEU A 237 AA1 4 5 O LYS A 157 ? O LYS A 238 N ALA A 67 ? N ALA A 148 AA2 1 2 N ALA A 38 ? N ALA A 119 O ILE A 190 ? O ILE A 271 AA2 2 3 O GLU A 195 ? O GLU A 276 N LEU A 178 ? N LEU A 259 AA2 3 4 O PHE A 175 ? O PHE A 256 N LEU A 156 ? N LEU A 237 AA2 4 5 O VAL A 148 ? O VAL A 229 N ARG A 87 ? N ARG A 168 AA2 5 6 N TYR A 88 ? N TYR A 169 O VAL A 108 ? O VAL A 189 # _atom_sites.entry_id 5TJC _atom_sites.fract_transf_matrix[1][1] 0.005470 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.005470 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005470 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 82 ? ? ? A . n A 1 2 SER 2 83 ? ? ? A . n A 1 3 GLY 3 84 ? ? ? A . n A 1 4 LEU 4 85 ? ? ? A . n A 1 5 SER 5 86 ? ? ? A . n A 1 6 ASN 6 87 87 ASN ASN A . n A 1 7 GLN 7 88 88 GLN GLN A . n A 1 8 LEU 8 89 89 LEU LEU A . n A 1 9 ALA 9 90 90 ALA ALA A . n A 1 10 VAL 10 91 91 VAL VAL A . n A 1 11 THR 11 92 92 THR THR A . n A 1 12 PHE 12 93 93 PHE PHE A . n A 1 13 ARG 13 94 94 ARG ARG A . n A 1 14 GLU 14 95 95 GLU GLU A . n A 1 15 GLU 15 96 96 GLU GLU A . n A 1 16 ASN 16 97 97 ASN ASN A . n A 1 17 THR 17 98 98 THR THR A . n A 1 18 ILE 18 99 99 ILE ILE A . n A 1 19 ALA 19 100 100 ALA ALA A . n A 1 20 PHE 20 101 101 PHE PHE A . n A 1 21 ARG 21 102 102 ARG ARG A . n A 1 22 HIS 22 103 103 HIS HIS A . n A 1 23 LEU 23 104 104 LEU LEU A . n A 1 24 PHE 24 105 105 PHE PHE A . n A 1 25 LEU 25 106 106 LEU LEU A . n A 1 26 LEU 26 107 107 LEU LEU A . n A 1 27 GLY 27 108 108 GLY GLY A . n A 1 28 TYR 28 109 109 TYR TYR A . n A 1 29 SER 29 110 110 SER SER A . n A 1 30 ASP 30 111 111 ASP ASP A . n A 1 31 GLY 31 112 112 GLY GLY A . n A 1 32 ALA 32 113 113 ALA ALA A . n A 1 33 ASP 33 114 114 ASP ASP A . n A 1 34 ASP 34 115 115 ASP ASP A . n A 1 35 THR 35 116 116 THR THR A . n A 1 36 PHE 36 117 117 PHE PHE A . n A 1 37 ALA 37 118 118 ALA ALA A . n A 1 38 ALA 38 119 119 ALA ALA A . n A 1 39 TYR 39 120 120 TYR TYR A . n A 1 40 THR 40 121 121 THR THR A . n A 1 41 ARG 41 122 122 ARG ARG A . n A 1 42 GLU 42 123 123 GLU GLU A . n A 1 43 GLN 43 124 124 GLN GLN A . n A 1 44 LEU 44 125 125 LEU LEU A . n A 1 45 TYR 45 126 126 TYR TYR A . n A 1 46 GLN 46 127 127 GLN GLN A . n A 1 47 ALA 47 128 128 ALA ALA A . n A 1 48 ILE 48 129 129 ILE ILE A . n A 1 49 PHE 49 130 130 PHE PHE A . n A 1 50 HIS 50 131 131 HIS HIS A . n A 1 51 ALA 51 132 132 ALA ALA A . n A 1 52 VAL 52 133 133 VAL VAL A . n A 1 53 ASP 53 134 134 ASP ASP A . n A 1 54 GLN 54 135 135 GLN GLN A . n A 1 55 TYR 55 136 136 TYR TYR A . n A 1 56 LEU 56 137 137 LEU LEU A . n A 1 57 ALA 57 138 138 ALA ALA A . n A 1 58 LEU 58 139 139 LEU LEU A . n A 1 59 PRO 59 140 140 PRO PRO A . n A 1 60 ASP 60 141 141 ASP ASP A . n A 1 61 VAL 61 142 142 VAL VAL A . n A 1 62 SER 62 143 143 SER SER A . n A 1 63 LEU 63 144 144 LEU LEU A . n A 1 64 GLY 64 145 145 GLY GLY A . n A 1 65 ARG 65 146 146 ARG ARG A . n A 1 66 TYR 66 147 147 TYR TYR A . n A 1 67 ALA 67 148 148 ALA ALA A . n A 1 68 TYR 68 149 149 TYR TYR A . n A 1 69 VAL 69 150 150 VAL VAL A . n A 1 70 ARG 70 151 151 ARG ARG A . n A 1 71 GLY 71 152 ? ? ? A . n A 1 72 GLY 72 153 ? ? ? A . n A 1 73 GLY 73 154 ? ? ? A . n A 1 74 ASP 74 155 ? ? ? A . n A 1 75 PRO 75 156 ? ? ? A . n A 1 76 TRP 76 157 ? ? ? A . n A 1 77 THR 77 158 ? ? ? A . n A 1 78 ASN 78 159 ? ? ? A . n A 1 79 GLY 79 160 ? ? ? A . n A 1 80 SER 80 161 161 SER SER A . n A 1 81 GLY 81 162 162 GLY GLY A . n A 1 82 LEU 82 163 163 LEU LEU A . n A 1 83 ALA 83 164 164 ALA ALA A . n A 1 84 LEU 84 165 165 LEU LEU A . n A 1 85 CYS 85 166 166 CYS CYS A . n A 1 86 GLN 86 167 167 GLN GLN A . n A 1 87 ARG 87 168 168 ARG ARG A . n A 1 88 TYR 88 169 169 TYR TYR A . n A 1 89 TYR 89 170 170 TYR TYR A . n A 1 90 HIS 90 171 171 HIS HIS A . n A 1 91 ARG 91 172 172 ARG ARG A . n A 1 92 GLY 92 173 173 GLY GLY A . n A 1 93 HIS 93 174 174 HIS HIS A . n A 1 94 VAL 94 175 175 VAL VAL A . n A 1 95 ASP 95 176 176 ASP ASP A . n A 1 96 PRO 96 177 177 PRO PRO A . n A 1 97 ALA 97 178 178 ALA ALA A . n A 1 98 ASN 98 179 179 ASN ASN A . n A 1 99 ASP 99 180 180 ASP ASP A . n A 1 100 THR 100 181 181 THR THR A . n A 1 101 PHE 101 182 182 PHE PHE A . n A 1 102 ASP 102 183 183 ASP ASP A . n A 1 103 ILE 103 184 184 ILE ILE A . n A 1 104 ASP 104 185 185 ASP ASP A . n A 1 105 PRO 105 186 186 PRO PRO A . n A 1 106 MET 106 187 187 MET MET A . n A 1 107 VAL 107 188 188 VAL VAL A . n A 1 108 VAL 108 189 189 VAL VAL A . n A 1 109 THR 109 190 190 THR THR A . n A 1 110 ASP 110 191 191 ASP ASP A . n A 1 111 CYS 111 192 192 CYS CYS A . n A 1 112 ILE 112 193 193 ILE ILE A . n A 1 113 GLN 113 194 194 GLN GLN A . n A 1 114 VAL 114 195 195 VAL VAL A . n A 1 115 ASP 115 196 196 ASP ASP A . n A 1 116 PRO 116 197 197 PRO PRO A . n A 1 117 PRO 117 198 198 PRO PRO A . n A 1 118 GLU 118 199 199 GLU GLU A . n A 1 119 ARG 119 200 ? ? ? A . n A 1 120 PRO 120 201 ? ? ? A . n A 1 121 PRO 121 202 ? ? ? A . n A 1 122 PRO 122 203 ? ? ? A . n A 1 123 PRO 123 204 ? ? ? A . n A 1 124 PRO 124 205 ? ? ? A . n A 1 125 SER 125 206 ? ? ? A . n A 1 126 ASP 126 207 ? ? ? A . n A 1 127 ASP 127 208 ? ? ? A . n A 1 128 LEU 128 209 ? ? ? A . n A 1 129 THR 129 210 ? ? ? A . n A 1 130 LEU 130 211 ? ? ? A . n A 1 131 LEU 131 212 ? ? ? A . n A 1 132 GLU 132 213 ? ? ? A . n A 1 133 SER 133 214 ? ? ? A . n A 1 134 SER 134 215 ? ? ? A . n A 1 135 SER 135 216 ? ? ? A . n A 1 136 SER 136 217 ? ? ? A . n A 1 137 TYR 137 218 218 TYR TYR A . n A 1 138 LYS 138 219 219 LYS LYS A . n A 1 139 ASN 139 220 220 ASN ASN A . n A 1 140 LEU 140 221 221 LEU LEU A . n A 1 141 THR 141 222 222 THR THR A . n A 1 142 LEU 142 223 223 LEU LEU A . n A 1 143 LYS 143 224 224 LYS LYS A . n A 1 144 PHE 144 225 225 PHE PHE A . n A 1 145 HIS 145 226 226 HIS HIS A . n A 1 146 LYS 146 227 227 LYS LYS A . n A 1 147 LEU 147 228 228 LEU LEU A . n A 1 148 VAL 148 229 229 VAL VAL A . n A 1 149 ASN 149 230 230 ASN ASN A . n A 1 150 VAL 150 231 231 VAL VAL A . n A 1 151 THR 151 232 232 THR THR A . n A 1 152 ILE 152 233 233 ILE ILE A . n A 1 153 HIS 153 234 234 HIS HIS A . n A 1 154 PHE 154 235 235 PHE PHE A . n A 1 155 ARG 155 236 236 ARG ARG A . n A 1 156 LEU 156 237 237 LEU LEU A . n A 1 157 LYS 157 238 238 LYS LYS A . n A 1 158 THR 158 239 239 THR THR A . n A 1 159 ILE 159 240 240 ILE ILE A . n A 1 160 ASN 160 241 241 ASN ASN A . n A 1 161 LEU 161 242 242 LEU LEU A . n A 1 162 GLN 162 243 243 GLN GLN A . n A 1 163 SER 163 244 244 SER SER A . n A 1 164 LEU 164 245 245 LEU LEU A . n A 1 165 ILE 165 246 246 ILE ILE A . n A 1 166 ASN 166 247 247 ASN ASN A . n A 1 167 ASN 167 248 248 ASN ASN A . n A 1 168 GLU 168 249 249 GLU GLU A . n A 1 169 ILE 169 250 250 ILE ILE A . n A 1 170 PRO 170 251 251 PRO PRO A . n A 1 171 ASP 171 252 252 ASP ASP A . n A 1 172 CYS 172 253 253 CYS CYS A . n A 1 173 TYR 173 254 254 TYR TYR A . n A 1 174 THR 174 255 255 THR THR A . n A 1 175 PHE 175 256 256 PHE PHE A . n A 1 176 SER 176 257 257 SER SER A . n A 1 177 VAL 177 258 258 VAL VAL A . n A 1 178 LEU 178 259 259 LEU LEU A . n A 1 179 ILE 179 260 260 ILE ILE A . n A 1 180 THR 180 261 261 THR THR A . n A 1 181 PHE 181 262 262 PHE PHE A . n A 1 182 ASP 182 263 263 ASP ASP A . n A 1 183 ASN 183 264 264 ASN ASN A . n A 1 184 LYS 184 265 265 LYS LYS A . n A 1 185 ALA 185 266 266 ALA ALA A . n A 1 186 HIS 186 267 267 HIS HIS A . n A 1 187 SER 187 268 268 SER SER A . n A 1 188 GLY 188 269 269 GLY GLY A . n A 1 189 ARG 189 270 270 ARG ARG A . n A 1 190 ILE 190 271 271 ILE ILE A . n A 1 191 PRO 191 272 272 PRO PRO A . n A 1 192 ILE 192 273 273 ILE ILE A . n A 1 193 SER 193 274 274 SER SER A . n A 1 194 LEU 194 275 275 LEU LEU A . n A 1 195 GLU 195 276 276 GLU GLU A . n A 1 196 THR 196 277 277 THR THR A . n A 1 197 GLN 197 278 278 GLN GLN A . n A 1 198 ALA 198 279 279 ALA ALA A . n A 1 199 HIS 199 280 280 HIS HIS A . n A 1 200 ILE 200 281 281 ILE ILE A . n A 1 201 GLN 201 282 282 GLN GLN A . n A 1 202 GLU 202 283 283 GLU GLU A . n A 1 203 CYS 203 284 284 CYS CYS A . n A 1 204 LYS 204 285 285 LYS LYS A . n A 1 205 HIS 205 286 286 HIS HIS A . n A 1 206 PRO 206 287 287 PRO PRO A . n A 1 207 SER 207 288 288 SER SER A . n A 1 208 VAL 208 289 289 VAL VAL A . n A 1 209 PHE 209 290 ? ? ? A . n A 1 210 GLN 210 291 ? ? ? A . n A 1 211 HIS 211 292 ? ? ? A . n A 1 212 GLY 212 293 ? ? ? A . n A 1 213 ASP 213 294 ? ? ? A . n A 1 214 ASN 214 295 ? ? ? A . n A 1 215 SER 215 296 ? ? ? A . n A 1 216 LEU 216 297 ? ? ? A . n A 1 217 GLU 217 298 ? ? ? A . n A 1 218 HIS 218 299 ? ? ? A . n A 1 219 HIS 219 300 ? ? ? A . n A 1 220 HIS 220 301 ? ? ? A . n A 1 221 HIS 221 302 ? ? ? A . n A 1 222 HIS 222 303 ? ? ? A . n A 1 223 HIS 223 304 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 401 39 HOH WAT A . B 2 HOH 2 402 19 HOH WAT A . B 2 HOH 3 403 56 HOH WAT A . B 2 HOH 4 404 64 HOH WAT A . B 2 HOH 5 405 13 HOH WAT A . B 2 HOH 6 406 3 HOH WAT A . B 2 HOH 7 407 18 HOH WAT A . B 2 HOH 8 408 41 HOH WAT A . B 2 HOH 9 409 7 HOH WAT A . B 2 HOH 10 410 57 HOH WAT A . B 2 HOH 11 411 38 HOH WAT A . B 2 HOH 12 412 2 HOH WAT A . B 2 HOH 13 413 21 HOH WAT A . B 2 HOH 14 414 30 HOH WAT A . B 2 HOH 15 415 37 HOH WAT A . B 2 HOH 16 416 45 HOH WAT A . B 2 HOH 17 417 11 HOH WAT A . B 2 HOH 18 418 28 HOH WAT A . B 2 HOH 19 419 23 HOH WAT A . B 2 HOH 20 420 36 HOH WAT A . B 2 HOH 21 421 55 HOH WAT A . B 2 HOH 22 422 5 HOH WAT A . B 2 HOH 23 423 65 HOH WAT A . B 2 HOH 24 424 14 HOH WAT A . B 2 HOH 25 425 25 HOH WAT A . B 2 HOH 26 426 53 HOH WAT A . B 2 HOH 27 427 4 HOH WAT A . B 2 HOH 28 428 48 HOH WAT A . B 2 HOH 29 429 12 HOH WAT A . B 2 HOH 30 430 33 HOH WAT A . B 2 HOH 31 431 32 HOH WAT A . B 2 HOH 32 432 27 HOH WAT A . B 2 HOH 33 433 63 HOH WAT A . B 2 HOH 34 434 43 HOH WAT A . B 2 HOH 35 435 61 HOH WAT A . B 2 HOH 36 436 17 HOH WAT A . B 2 HOH 37 437 62 HOH WAT A . B 2 HOH 38 438 8 HOH WAT A . B 2 HOH 39 439 6 HOH WAT A . B 2 HOH 40 440 46 HOH WAT A . B 2 HOH 41 441 20 HOH WAT A . B 2 HOH 42 442 15 HOH WAT A . B 2 HOH 43 443 47 HOH WAT A . B 2 HOH 44 444 22 HOH WAT A . B 2 HOH 45 445 16 HOH WAT A . B 2 HOH 46 446 31 HOH WAT A . B 2 HOH 47 447 26 HOH WAT A . B 2 HOH 48 448 1 HOH WAT A . B 2 HOH 49 449 58 HOH WAT A . B 2 HOH 50 450 44 HOH WAT A . B 2 HOH 51 451 29 HOH WAT A . B 2 HOH 52 452 60 HOH WAT A . B 2 HOH 53 453 10 HOH WAT A . B 2 HOH 54 454 9 HOH WAT A . B 2 HOH 55 455 24 HOH WAT A . B 2 HOH 56 456 42 HOH WAT A . B 2 HOH 57 457 40 HOH WAT A . B 2 HOH 58 458 34 HOH WAT A . B 2 HOH 59 459 52 HOH WAT A . B 2 HOH 60 460 35 HOH WAT A . B 2 HOH 61 461 66 HOH WAT A . B 2 HOH 62 462 49 HOH WAT A . B 2 HOH 63 463 51 HOH WAT A . B 2 HOH 64 464 50 HOH WAT A . B 2 HOH 65 465 59 HOH WAT A . B 2 HOH 66 466 54 HOH WAT A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 11060 ? 1 MORE -75 ? 1 'SSA (A^2)' 32310 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 15_555 y,-x,z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 16_555 -y,x,z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-01-25 2 'Structure model' 1 1 2017-02-08 3 'Structure model' 1 2 2017-03-15 4 'Structure model' 1 3 2017-09-27 5 'Structure model' 1 4 2019-12-18 6 'Structure model' 1 5 2023-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Author supporting evidence' 4 5 'Structure model' 'Author supporting evidence' 5 6 'Structure model' 'Data collection' 6 6 'Structure model' 'Database references' 7 6 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_audit_support 2 5 'Structure model' pdbx_audit_support 3 6 'Structure model' chem_comp_atom 4 6 'Structure model' chem_comp_bond 5 6 'Structure model' database_2 6 6 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_audit_support.funding_organization' 2 5 'Structure model' '_pdbx_audit_support.funding_organization' 3 6 'Structure model' '_database_2.pdbx_DOI' 4 6 'Structure model' '_database_2.pdbx_database_accession' # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? CNS ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 180 ? ? 48.53 29.60 2 1 PRO A 198 ? ? -67.42 55.55 3 1 LYS A 227 ? ? -145.32 30.23 4 1 ASN A 230 ? ? 178.80 172.45 5 1 LYS A 285 ? ? -43.95 -71.13 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 82 ? A GLY 1 2 1 Y 1 A SER 83 ? A SER 2 3 1 Y 1 A GLY 84 ? A GLY 3 4 1 Y 1 A LEU 85 ? A LEU 4 5 1 Y 1 A SER 86 ? A SER 5 6 1 Y 1 A GLY 152 ? A GLY 71 7 1 Y 1 A GLY 153 ? A GLY 72 8 1 Y 1 A GLY 154 ? A GLY 73 9 1 Y 1 A ASP 155 ? A ASP 74 10 1 Y 1 A PRO 156 ? A PRO 75 11 1 Y 1 A TRP 157 ? A TRP 76 12 1 Y 1 A THR 158 ? A THR 77 13 1 Y 1 A ASN 159 ? A ASN 78 14 1 Y 1 A GLY 160 ? A GLY 79 15 1 Y 1 A ARG 200 ? A ARG 119 16 1 Y 1 A PRO 201 ? A PRO 120 17 1 Y 1 A PRO 202 ? A PRO 121 18 1 Y 1 A PRO 203 ? A PRO 122 19 1 Y 1 A PRO 204 ? A PRO 123 20 1 Y 1 A PRO 205 ? A PRO 124 21 1 Y 1 A SER 206 ? A SER 125 22 1 Y 1 A ASP 207 ? A ASP 126 23 1 Y 1 A ASP 208 ? A ASP 127 24 1 Y 1 A LEU 209 ? A LEU 128 25 1 Y 1 A THR 210 ? A THR 129 26 1 Y 1 A LEU 211 ? A LEU 130 27 1 Y 1 A LEU 212 ? A LEU 131 28 1 Y 1 A GLU 213 ? A GLU 132 29 1 Y 1 A SER 214 ? A SER 133 30 1 Y 1 A SER 215 ? A SER 134 31 1 Y 1 A SER 216 ? A SER 135 32 1 Y 1 A SER 217 ? A SER 136 33 1 Y 1 A PHE 290 ? A PHE 209 34 1 Y 1 A GLN 291 ? A GLN 210 35 1 Y 1 A HIS 292 ? A HIS 211 36 1 Y 1 A GLY 293 ? A GLY 212 37 1 Y 1 A ASP 294 ? A ASP 213 38 1 Y 1 A ASN 295 ? A ASN 214 39 1 Y 1 A SER 296 ? A SER 215 40 1 Y 1 A LEU 297 ? A LEU 216 41 1 Y 1 A GLU 298 ? A GLU 217 42 1 Y 1 A HIS 299 ? A HIS 218 43 1 Y 1 A HIS 300 ? A HIS 219 44 1 Y 1 A HIS 301 ? A HIS 220 45 1 Y 1 A HIS 302 ? A HIS 221 46 1 Y 1 A HIS 303 ? A HIS 222 47 1 Y 1 A HIS 304 ? A HIS 223 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' R01GM085234 1 'National Institutes of Health/National Institute of Neurological Disorders and Stroke (NIH/NINDS)' 'United States' RO1NS053494 2 'National Basic Research Program of China (973 Program)' China 2014CB910301 3 'National Natural Science Foundation of China (NSFC)' China 31370821 4 'Top Talents Program of Yunnan Province' China 2011HA012 5 'High-level Overseas Talents of Yunnan Province' China ? 6 'China Youth 1000-Talent Program of the State Council of China' China ? 7 'Beijing Advanced Innovation Center for Structural Biology' China ? 8 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5TJA _pdbx_initial_refinement_model.details ? #