data_5TJQ # _entry.id 5TJQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.284 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5TJQ WWPDB D_1000224372 # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 5TJ7 unspecified PDB . 5TJ8 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5TJQ _pdbx_database_status.recvd_initial_deposition_date 2016-10-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Chen, Z.' 1 0000-0001-9925-872X 'Gabelli, S.B.' 2 0000-0003-1205-5204 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Mol. Cell' _citation.journal_id_ASTM MOCEFL _citation.journal_id_CSD 2168 _citation.journal_id_ISSN 1097-4164 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 66 _citation.language ? _citation.page_first 345 _citation.page_last 357.e6 _citation.title 'A Tunable Brake for HECT Ubiquitin Ligases.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.molcel.2017.03.020 _citation.pdbx_database_id_PubMed 28475870 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Chen, Z.' 1 primary 'Jiang, H.' 2 primary 'Xu, W.' 3 primary 'Li, X.' 4 primary 'Dempsey, D.R.' 5 primary 'Zhang, X.' 6 primary 'Devreotes, P.' 7 primary 'Wolberger, C.' 8 primary 'Amzel, L.M.' 9 primary 'Gabelli, S.B.' 10 primary 'Cole, P.A.' 11 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5TJQ _cell.details ? _cell.formula_units_Z ? _cell.length_a 61.041 _cell.length_a_esd ? _cell.length_b 62.581 _cell.length_b_esd ? _cell.length_c 102.372 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5TJQ _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'NEDD4-like E3 ubiquitin-protein ligase WWP2,NEDD4-like E3 ubiquitin-protein ligase WWP2' 53441.539 1 2.3.2.26,2.3.2.26 ? ? ? 2 water nat water 18.015 11 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Atrophin-1-interacting protein 2,AIP2,HECT-type E3 ubiquitin transferase WWP2,WW domain-containing protein 2,Atrophin-1-interacting protein 2,AIP2,HECT-type E3 ubiquitin transferase WWP2,WW domain-containing protein 2 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPGWEKRTDPRGRFYYVDHNTRTTTWQRPTAEYVRNYEQWQSQRNQLQGAMQHFSQRFLYQSSSASQGSPGAYDRSFRWK YHQFRFLCHSNALPSHVKISVSRQTLFEDSFQQIMNMKPYDLRRRLYIIMRGEEGLDYGGIAREWFFLLSHEVLNPMYCL FEYAGKNNYCLQINPASSINPDHLTYFRFIGRFIAMALYHGKFIDTGFTLPFYKRMLNKRPTLKDLESIDPEFYNSIVWI KENNLEECGLELYFIQDMEILGKVTTHELKEGGESIRVTEENKEEYIMLLTDWRFTRGVEEQTKAFLDGFNEVAPLEWLR YFDEKELELMLCGMQEIDMSDWQKSTIYRHYTKNSKQIQWFWQVVKEMDNEKRIRLLQFVTGTCRLPVGGFAELIGSNGP QKFCIDKVGKETWLPRSHTCFNRLDLPPYKSYEQLREKLLYAIEETE ; _entity_poly.pdbx_seq_one_letter_code_can ;GPGWEKRTDPRGRFYYVDHNTRTTTWQRPTAEYVRNYEQWQSQRNQLQGAMQHFSQRFLYQSSSASQGSPGAYDRSFRWK YHQFRFLCHSNALPSHVKISVSRQTLFEDSFQQIMNMKPYDLRRRLYIIMRGEEGLDYGGIAREWFFLLSHEVLNPMYCL FEYAGKNNYCLQINPASSINPDHLTYFRFIGRFIAMALYHGKFIDTGFTLPFYKRMLNKRPTLKDLESIDPEFYNSIVWI KENNLEECGLELYFIQDMEILGKVTTHELKEGGESIRVTEENKEEYIMLLTDWRFTRGVEEQTKAFLDGFNEVAPLEWLR YFDEKELELMLCGMQEIDMSDWQKSTIYRHYTKNSKQIQWFWQVVKEMDNEKRIRLLQFVTGTCRLPVGGFAELIGSNGP QKFCIDKVGKETWLPRSHTCFNRLDLPPYKSYEQLREKLLYAIEETE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 GLY n 1 4 TRP n 1 5 GLU n 1 6 LYS n 1 7 ARG n 1 8 THR n 1 9 ASP n 1 10 PRO n 1 11 ARG n 1 12 GLY n 1 13 ARG n 1 14 PHE n 1 15 TYR n 1 16 TYR n 1 17 VAL n 1 18 ASP n 1 19 HIS n 1 20 ASN n 1 21 THR n 1 22 ARG n 1 23 THR n 1 24 THR n 1 25 THR n 1 26 TRP n 1 27 GLN n 1 28 ARG n 1 29 PRO n 1 30 THR n 1 31 ALA n 1 32 GLU n 1 33 TYR n 1 34 VAL n 1 35 ARG n 1 36 ASN n 1 37 TYR n 1 38 GLU n 1 39 GLN n 1 40 TRP n 1 41 GLN n 1 42 SER n 1 43 GLN n 1 44 ARG n 1 45 ASN n 1 46 GLN n 1 47 LEU n 1 48 GLN n 1 49 GLY n 1 50 ALA n 1 51 MET n 1 52 GLN n 1 53 HIS n 1 54 PHE n 1 55 SER n 1 56 GLN n 1 57 ARG n 1 58 PHE n 1 59 LEU n 1 60 TYR n 1 61 GLN n 1 62 SER n 1 63 SER n 1 64 SER n 1 65 ALA n 1 66 SER n 1 67 GLN n 1 68 GLY n 1 69 SER n 1 70 PRO n 1 71 GLY n 1 72 ALA n 1 73 TYR n 1 74 ASP n 1 75 ARG n 1 76 SER n 1 77 PHE n 1 78 ARG n 1 79 TRP n 1 80 LYS n 1 81 TYR n 1 82 HIS n 1 83 GLN n 1 84 PHE n 1 85 ARG n 1 86 PHE n 1 87 LEU n 1 88 CYS n 1 89 HIS n 1 90 SER n 1 91 ASN n 1 92 ALA n 1 93 LEU n 1 94 PRO n 1 95 SER n 1 96 HIS n 1 97 VAL n 1 98 LYS n 1 99 ILE n 1 100 SER n 1 101 VAL n 1 102 SER n 1 103 ARG n 1 104 GLN n 1 105 THR n 1 106 LEU n 1 107 PHE n 1 108 GLU n 1 109 ASP n 1 110 SER n 1 111 PHE n 1 112 GLN n 1 113 GLN n 1 114 ILE n 1 115 MET n 1 116 ASN n 1 117 MET n 1 118 LYS n 1 119 PRO n 1 120 TYR n 1 121 ASP n 1 122 LEU n 1 123 ARG n 1 124 ARG n 1 125 ARG n 1 126 LEU n 1 127 TYR n 1 128 ILE n 1 129 ILE n 1 130 MET n 1 131 ARG n 1 132 GLY n 1 133 GLU n 1 134 GLU n 1 135 GLY n 1 136 LEU n 1 137 ASP n 1 138 TYR n 1 139 GLY n 1 140 GLY n 1 141 ILE n 1 142 ALA n 1 143 ARG n 1 144 GLU n 1 145 TRP n 1 146 PHE n 1 147 PHE n 1 148 LEU n 1 149 LEU n 1 150 SER n 1 151 HIS n 1 152 GLU n 1 153 VAL n 1 154 LEU n 1 155 ASN n 1 156 PRO n 1 157 MET n 1 158 TYR n 1 159 CYS n 1 160 LEU n 1 161 PHE n 1 162 GLU n 1 163 TYR n 1 164 ALA n 1 165 GLY n 1 166 LYS n 1 167 ASN n 1 168 ASN n 1 169 TYR n 1 170 CYS n 1 171 LEU n 1 172 GLN n 1 173 ILE n 1 174 ASN n 1 175 PRO n 1 176 ALA n 1 177 SER n 1 178 SER n 1 179 ILE n 1 180 ASN n 1 181 PRO n 1 182 ASP n 1 183 HIS n 1 184 LEU n 1 185 THR n 1 186 TYR n 1 187 PHE n 1 188 ARG n 1 189 PHE n 1 190 ILE n 1 191 GLY n 1 192 ARG n 1 193 PHE n 1 194 ILE n 1 195 ALA n 1 196 MET n 1 197 ALA n 1 198 LEU n 1 199 TYR n 1 200 HIS n 1 201 GLY n 1 202 LYS n 1 203 PHE n 1 204 ILE n 1 205 ASP n 1 206 THR n 1 207 GLY n 1 208 PHE n 1 209 THR n 1 210 LEU n 1 211 PRO n 1 212 PHE n 1 213 TYR n 1 214 LYS n 1 215 ARG n 1 216 MET n 1 217 LEU n 1 218 ASN n 1 219 LYS n 1 220 ARG n 1 221 PRO n 1 222 THR n 1 223 LEU n 1 224 LYS n 1 225 ASP n 1 226 LEU n 1 227 GLU n 1 228 SER n 1 229 ILE n 1 230 ASP n 1 231 PRO n 1 232 GLU n 1 233 PHE n 1 234 TYR n 1 235 ASN n 1 236 SER n 1 237 ILE n 1 238 VAL n 1 239 TRP n 1 240 ILE n 1 241 LYS n 1 242 GLU n 1 243 ASN n 1 244 ASN n 1 245 LEU n 1 246 GLU n 1 247 GLU n 1 248 CYS n 1 249 GLY n 1 250 LEU n 1 251 GLU n 1 252 LEU n 1 253 TYR n 1 254 PHE n 1 255 ILE n 1 256 GLN n 1 257 ASP n 1 258 MET n 1 259 GLU n 1 260 ILE n 1 261 LEU n 1 262 GLY n 1 263 LYS n 1 264 VAL n 1 265 THR n 1 266 THR n 1 267 HIS n 1 268 GLU n 1 269 LEU n 1 270 LYS n 1 271 GLU n 1 272 GLY n 1 273 GLY n 1 274 GLU n 1 275 SER n 1 276 ILE n 1 277 ARG n 1 278 VAL n 1 279 THR n 1 280 GLU n 1 281 GLU n 1 282 ASN n 1 283 LYS n 1 284 GLU n 1 285 GLU n 1 286 TYR n 1 287 ILE n 1 288 MET n 1 289 LEU n 1 290 LEU n 1 291 THR n 1 292 ASP n 1 293 TRP n 1 294 ARG n 1 295 PHE n 1 296 THR n 1 297 ARG n 1 298 GLY n 1 299 VAL n 1 300 GLU n 1 301 GLU n 1 302 GLN n 1 303 THR n 1 304 LYS n 1 305 ALA n 1 306 PHE n 1 307 LEU n 1 308 ASP n 1 309 GLY n 1 310 PHE n 1 311 ASN n 1 312 GLU n 1 313 VAL n 1 314 ALA n 1 315 PRO n 1 316 LEU n 1 317 GLU n 1 318 TRP n 1 319 LEU n 1 320 ARG n 1 321 TYR n 1 322 PHE n 1 323 ASP n 1 324 GLU n 1 325 LYS n 1 326 GLU n 1 327 LEU n 1 328 GLU n 1 329 LEU n 1 330 MET n 1 331 LEU n 1 332 CYS n 1 333 GLY n 1 334 MET n 1 335 GLN n 1 336 GLU n 1 337 ILE n 1 338 ASP n 1 339 MET n 1 340 SER n 1 341 ASP n 1 342 TRP n 1 343 GLN n 1 344 LYS n 1 345 SER n 1 346 THR n 1 347 ILE n 1 348 TYR n 1 349 ARG n 1 350 HIS n 1 351 TYR n 1 352 THR n 1 353 LYS n 1 354 ASN n 1 355 SER n 1 356 LYS n 1 357 GLN n 1 358 ILE n 1 359 GLN n 1 360 TRP n 1 361 PHE n 1 362 TRP n 1 363 GLN n 1 364 VAL n 1 365 VAL n 1 366 LYS n 1 367 GLU n 1 368 MET n 1 369 ASP n 1 370 ASN n 1 371 GLU n 1 372 LYS n 1 373 ARG n 1 374 ILE n 1 375 ARG n 1 376 LEU n 1 377 LEU n 1 378 GLN n 1 379 PHE n 1 380 VAL n 1 381 THR n 1 382 GLY n 1 383 THR n 1 384 CYS n 1 385 ARG n 1 386 LEU n 1 387 PRO n 1 388 VAL n 1 389 GLY n 1 390 GLY n 1 391 PHE n 1 392 ALA n 1 393 GLU n 1 394 LEU n 1 395 ILE n 1 396 GLY n 1 397 SER n 1 398 ASN n 1 399 GLY n 1 400 PRO n 1 401 GLN n 1 402 LYS n 1 403 PHE n 1 404 CYS n 1 405 ILE n 1 406 ASP n 1 407 LYS n 1 408 VAL n 1 409 GLY n 1 410 LYS n 1 411 GLU n 1 412 THR n 1 413 TRP n 1 414 LEU n 1 415 PRO n 1 416 ARG n 1 417 SER n 1 418 HIS n 1 419 THR n 1 420 CYS n 1 421 PHE n 1 422 ASN n 1 423 ARG n 1 424 LEU n 1 425 ASP n 1 426 LEU n 1 427 PRO n 1 428 PRO n 1 429 TYR n 1 430 LYS n 1 431 SER n 1 432 TYR n 1 433 GLU n 1 434 GLN n 1 435 LEU n 1 436 ARG n 1 437 GLU n 1 438 LYS n 1 439 LEU n 1 440 LEU n 1 441 TYR n 1 442 ALA n 1 443 ILE n 1 444 GLU n 1 445 GLU n 1 446 THR n 1 447 GLU n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 66 Human ? WWP2 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 'BL21(DE3) codon plus' ? ? ? ? ? ? ? plasmid ? ? ? pGEX6P-2 ? ? 1 2 sample 'Biological sequence' 67 447 Human ? WWP2 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 'BL21(DE3) codon plus' ? ? ? ? ? ? ? plasmid ? ? ? pGEX6P-2 ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP WWP2_HUMAN O00308 ? 1 PGWEKRTDPRGRFYYVDHNTRTTTWQRPTAEYVRNYEQWQSQRNQLQGAMQHFSQRFLYQSSSAS 334 2 UNP WWP2_HUMAN O00308 ? 1 ;QGSPGAYDRSFRWKYHQFRFLCHSNALPSHVKISVSRQTLFEDSFQQIMNMKPYDLRRRLYIIMRGEEGLDYGGIAREWF FLLSHEVLNPMYCLFEYAGKNNYCLQINPASSINPDHLTYFRFIGRFIAMALYHGKFIDTGFTLPFYKRMLNKRPTLKDL ESIDPEFYNSIVWIKENNLEECGLELYFIQDMEILGKVTTHELKEGGESIRVTEENKEEYIMLLTDWRFTRGVEEQTKAF LDGFNEVAPLEWLRYFDEKELELMLCGMQEIDMSDWQKSTIYRHYTKNSKQIQWFWQVVKEMDNEKRIRLLQFVTGTCRL PVGGFAELIGSNGPQKFCIDKVGKETWLPRSHTCFNRLDLPPYKSYEQLREKLLYAIEETE ; 485 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5TJQ A 2 ? 66 ? O00308 334 ? 398 ? 420 484 2 2 5TJQ A 67 ? 447 ? O00308 485 ? 865 ? 485 865 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 5TJQ _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code O00308 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 419 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5TJQ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.83 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 32.76 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity 0.629 _exptl_crystal.pdbx_mosaicity_esd 0.005 # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M MMT (DL-malic acid, MES, Tris-base in molar ratio of 1:2:2) pH 6.0, 25% PEG1500' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-06-12 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 5.0.2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 5.0.2 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5TJQ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.750 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10662 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.000 _reflns.pdbx_Rmerge_I_obs 0.064 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.900 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.896 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.071 _reflns.pdbx_Rpim_I_all 0.029 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 63592 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.750 2.800 ? ? ? ? ? 504 ? 98.600 ? ? ? ? 0.463 ? ? ? ? ? ? ? ? 5.200 ? 0.470 ? ? 0.513 0.216 ? 1 1 0.834 ? 2.800 2.850 ? ? ? ? ? 537 ? 99.300 ? ? ? ? 0.421 ? ? ? ? ? ? ? ? 5.300 ? 0.481 ? ? 0.468 0.199 ? 2 1 0.905 ? 2.850 2.900 ? ? ? ? ? 520 ? 99.800 ? ? ? ? 0.404 ? ? ? ? ? ? ? ? 5.700 ? 0.499 ? ? 0.445 0.184 ? 3 1 0.908 ? 2.900 2.960 ? ? ? ? ? 505 ? 100.000 ? ? ? ? 0.354 ? ? ? ? ? ? ? ? 5.700 ? 0.532 ? ? 0.390 0.161 ? 4 1 0.938 ? 2.960 3.030 ? ? ? ? ? 531 ? 100.000 ? ? ? ? 0.271 ? ? ? ? ? ? ? ? 6.300 ? 0.509 ? ? 0.296 0.116 ? 5 1 0.969 ? 3.030 3.100 ? ? ? ? ? 528 ? 100.000 ? ? ? ? 0.239 ? ? ? ? ? ? ? ? 6.500 ? 0.515 ? ? 0.259 0.100 ? 6 1 0.982 ? 3.100 3.170 ? ? ? ? ? 524 ? 99.800 ? ? ? ? 0.213 ? ? ? ? ? ? ? ? 6.400 ? 0.561 ? ? 0.232 0.091 ? 7 1 0.980 ? 3.170 3.260 ? ? ? ? ? 533 ? 99.800 ? ? ? ? 0.176 ? ? ? ? ? ? ? ? 6.400 ? 0.605 ? ? 0.191 0.074 ? 8 1 0.983 ? 3.260 3.360 ? ? ? ? ? 539 ? 100.000 ? ? ? ? 0.138 ? ? ? ? ? ? ? ? 6.200 ? 0.642 ? ? 0.151 0.060 ? 9 1 0.993 ? 3.360 3.460 ? ? ? ? ? 519 ? 99.400 ? ? ? ? 0.111 ? ? ? ? ? ? ? ? 6.000 ? 0.689 ? ? 0.122 0.050 ? 10 1 0.994 ? 3.460 3.590 ? ? ? ? ? 527 ? 99.800 ? ? ? ? 0.108 ? ? ? ? ? ? ? ? 6.000 ? 0.777 ? ? 0.119 0.048 ? 11 1 0.993 ? 3.590 3.730 ? ? ? ? ? 534 ? 99.800 ? ? ? ? 0.087 ? ? ? ? ? ? ? ? 6.000 ? 0.910 ? ? 0.095 0.038 ? 12 1 0.996 ? 3.730 3.900 ? ? ? ? ? 542 ? 100.000 ? ? ? ? 0.073 ? ? ? ? ? ? ? ? 6.300 ? 0.911 ? ? 0.079 0.031 ? 13 1 0.996 ? 3.900 4.110 ? ? ? ? ? 537 ? 99.800 ? ? ? ? 0.059 ? ? ? ? ? ? ? ? 6.200 ? 0.979 ? ? 0.065 0.026 ? 14 1 0.998 ? 4.110 4.360 ? ? ? ? ? 535 ? 99.300 ? ? ? ? 0.055 ? ? ? ? ? ? ? ? 6.100 ? 1.167 ? ? 0.061 0.025 ? 15 1 0.998 ? 4.360 4.700 ? ? ? ? ? 530 ? 98.300 ? ? ? ? 0.049 ? ? ? ? ? ? ? ? 5.700 ? 1.304 ? ? 0.054 0.022 ? 16 1 0.998 ? 4.700 5.170 ? ? ? ? ? 547 ? 98.400 ? ? ? ? 0.046 ? ? ? ? ? ? ? ? 5.900 ? 1.261 ? ? 0.051 0.021 ? 17 1 0.998 ? 5.170 5.920 ? ? ? ? ? 543 ? 98.900 ? ? ? ? 0.047 ? ? ? ? ? ? ? ? 6.100 ? 1.290 ? ? 0.052 0.021 ? 18 1 0.998 ? 5.920 7.460 ? ? ? ? ? 561 ? 98.800 ? ? ? ? 0.047 ? ? ? ? ? ? ? ? 5.700 ? 1.512 ? ? 0.052 0.022 ? 19 1 0.996 ? 7.460 50.000 ? ? ? ? ? 566 ? 92.800 ? ? ? ? 0.043 ? ? ? ? ? ? ? ? 5.400 ? 2.284 ? ? 0.048 0.021 ? 20 1 0.998 ? # _refine.aniso_B[1][1] -0.7200 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] -5.0100 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 5.7300 _refine.B_iso_max 206.260 _refine.B_iso_mean 87.3230 _refine.B_iso_min 42.930 _refine.correlation_coeff_Fo_to_Fc 0.9420 _refine.correlation_coeff_Fo_to_Fc_free 0.8550 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5TJQ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.7500 _refine.ls_d_res_low 50.0 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10094 _refine.ls_number_reflns_R_free 483 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.0800 _refine.ls_percent_reflns_R_free 4.6000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2290 _refine.ls_R_factor_R_free 0.3170 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2249 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free 0.3170 _refine.ls_wR_factor_R_work 0.2249 _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4Y07 _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.4900 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 20.1660 _refine.overall_SU_ML 0.3940 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free 0.4899 _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set 0.7514 _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.7500 _refine_hist.d_res_low 50.0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 11 _refine_hist.number_atoms_total 3056 _refine_hist.pdbx_number_residues_total 361 _refine_hist.pdbx_B_iso_mean_solvent 63.08 _refine_hist.pdbx_number_atoms_protein 3045 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 0.019 3142 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.003 0.020 2954 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.425 1.951 4235 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.037 3.000 6793 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.074 5.000 361 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 35.519 23.494 166 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 16.938 15.000 573 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 17.645 15.000 24 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.080 0.200 435 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 3510 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 790 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.7500 _refine_ls_shell.d_res_low 2.8210 _refine_ls_shell.number_reflns_all 750 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 24 _refine_ls_shell.number_reflns_R_work 726 _refine_ls_shell.percent_reflns_obs 99.2100 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3960 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3250 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5TJQ _struct.title 'Structure of WWP2 2,3-linker-HECT' _struct.pdbx_descriptor 'NEDD4-like E3 ubiquitin-protein ligase WWP2 (E.C.2.3.2.26)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5TJQ _struct_keywords.text 'WWP2, HECT Domain, WW2, WWP1, ITCH, autoinhibition, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 76 ? ASN A 91 ? SER A 494 ASN A 509 1 ? 16 HELX_P HELX_P2 AA2 THR A 105 ? ASN A 116 ? THR A 523 ASN A 534 1 ? 12 HELX_P HELX_P3 AA3 MET A 117 ? LYS A 118 ? MET A 535 LYS A 536 5 ? 2 HELX_P HELX_P4 AA4 PRO A 119 ? ARG A 124 ? PRO A 537 ARG A 542 5 ? 6 HELX_P HELX_P5 AA5 ILE A 141 ? VAL A 153 ? ILE A 559 VAL A 571 1 ? 13 HELX_P HELX_P6 AA6 LEU A 154 ? CYS A 159 ? LEU A 572 CYS A 577 5 ? 6 HELX_P HELX_P7 AA7 PRO A 175 ? ASN A 180 ? PRO A 593 ASN A 598 5 ? 6 HELX_P HELX_P8 AA8 ASP A 182 ? HIS A 200 ? ASP A 600 HIS A 618 1 ? 19 HELX_P HELX_P9 AA9 THR A 209 ? LEU A 217 ? THR A 627 LEU A 635 1 ? 9 HELX_P HELX_P10 AB1 THR A 222 ? ASP A 230 ? THR A 640 ASP A 648 1 ? 9 HELX_P HELX_P11 AB2 ASP A 230 ? GLU A 242 ? ASP A 648 GLU A 660 1 ? 13 HELX_P HELX_P12 AB3 ASN A 282 ? ARG A 297 ? ASN A 700 ARG A 715 1 ? 16 HELX_P HELX_P13 AB4 GLU A 300 ? ALA A 314 ? GLU A 718 ALA A 732 1 ? 15 HELX_P HELX_P14 AB5 PRO A 315 ? ARG A 320 ? PRO A 733 ARG A 738 5 ? 6 HELX_P HELX_P15 AB6 ASP A 323 ? GLY A 333 ? ASP A 741 GLY A 751 1 ? 11 HELX_P HELX_P16 AB7 ASP A 338 ? SER A 345 ? ASP A 756 SER A 763 1 ? 8 HELX_P HELX_P17 AB8 SER A 355 ? MET A 368 ? SER A 773 MET A 786 1 ? 14 HELX_P HELX_P18 AB9 ASP A 369 ? GLY A 382 ? ASP A 787 GLY A 800 1 ? 14 HELX_P HELX_P19 AC1 GLY A 389 ? GLU A 393 ? GLY A 807 GLU A 811 5 ? 5 HELX_P HELX_P20 AC2 SER A 431 ? THR A 446 ? SER A 849 THR A 864 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id HIS _struct_conn.ptnr1_label_seq_id 82 _struct_conn.ptnr1_label_atom_id CE1 _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id GLU _struct_conn.ptnr2_label_seq_id 246 _struct_conn.ptnr2_label_atom_id OE2 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id HIS _struct_conn.ptnr1_auth_seq_id 500 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id GLU _struct_conn.ptnr2_auth_seq_id 664 _struct_conn.ptnr2_symmetry 1_655 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.314 _struct_conn.pdbx_value_order ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? AA3 ? 4 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA2 1 2 ? anti-parallel AA3 1 2 ? parallel AA3 2 3 ? parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 HIS A 96 ? SER A 100 ? HIS A 514 SER A 518 AA1 2 ARG A 125 ? ILE A 129 ? ARG A 543 ILE A 547 AA2 1 PHE A 161 ? TYR A 163 ? PHE A 579 TYR A 581 AA2 2 LEU A 171 ? ILE A 173 ? LEU A 589 ILE A 591 AA3 1 THR A 346 ? ARG A 349 ? THR A 764 ARG A 767 AA3 2 PHE A 403 ? ASP A 406 ? PHE A 821 ASP A 824 AA3 3 ARG A 423 ? ASP A 425 ? ARG A 841 ASP A 843 AA3 4 ARG A 416 ? HIS A 418 ? ARG A 834 HIS A 836 AA4 1 ILE A 395 ? GLY A 396 ? ILE A 813 GLY A 814 AA4 2 GLY A 399 ? PRO A 400 ? GLY A 817 PRO A 818 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 97 ? N VAL A 515 O ARG A 125 ? O ARG A 543 AA2 1 2 N GLU A 162 ? N GLU A 580 O GLN A 172 ? O GLN A 590 AA3 1 2 N ILE A 347 ? N ILE A 765 O PHE A 403 ? O PHE A 821 AA3 2 3 N CYS A 404 ? N CYS A 822 O LEU A 424 ? O LEU A 842 AA3 3 4 O ASP A 425 ? O ASP A 843 N ARG A 416 ? N ARG A 834 AA4 1 2 N GLY A 396 ? N GLY A 814 O GLY A 399 ? O GLY A 817 # _atom_sites.entry_id 5TJQ _atom_sites.fract_transf_matrix[1][1] 0.016382 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015979 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009768 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N NA O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 419 ? ? ? A . n A 1 2 PRO 2 420 ? ? ? A . n A 1 3 GLY 3 421 ? ? ? A . n A 1 4 TRP 4 422 ? ? ? A . n A 1 5 GLU 5 423 ? ? ? A . n A 1 6 LYS 6 424 ? ? ? A . n A 1 7 ARG 7 425 ? ? ? A . n A 1 8 THR 8 426 ? ? ? A . n A 1 9 ASP 9 427 ? ? ? A . n A 1 10 PRO 10 428 ? ? ? A . n A 1 11 ARG 11 429 ? ? ? A . n A 1 12 GLY 12 430 ? ? ? A . n A 1 13 ARG 13 431 ? ? ? A . n A 1 14 PHE 14 432 ? ? ? A . n A 1 15 TYR 15 433 ? ? ? A . n A 1 16 TYR 16 434 ? ? ? A . n A 1 17 VAL 17 435 ? ? ? A . n A 1 18 ASP 18 436 ? ? ? A . n A 1 19 HIS 19 437 ? ? ? A . n A 1 20 ASN 20 438 ? ? ? A . n A 1 21 THR 21 439 ? ? ? A . n A 1 22 ARG 22 440 ? ? ? A . n A 1 23 THR 23 441 ? ? ? A . n A 1 24 THR 24 442 ? ? ? A . n A 1 25 THR 25 443 ? ? ? A . n A 1 26 TRP 26 444 ? ? ? A . n A 1 27 GLN 27 445 ? ? ? A . n A 1 28 ARG 28 446 ? ? ? A . n A 1 29 PRO 29 447 ? ? ? A . n A 1 30 THR 30 448 ? ? ? A . n A 1 31 ALA 31 449 ? ? ? A . n A 1 32 GLU 32 450 ? ? ? A . n A 1 33 TYR 33 451 ? ? ? A . n A 1 34 VAL 34 452 ? ? ? A . n A 1 35 ARG 35 453 ? ? ? A . n A 1 36 ASN 36 454 ? ? ? A . n A 1 37 TYR 37 455 ? ? ? A . n A 1 38 GLU 38 456 ? ? ? A . n A 1 39 GLN 39 457 ? ? ? A . n A 1 40 TRP 40 458 ? ? ? A . n A 1 41 GLN 41 459 ? ? ? A . n A 1 42 SER 42 460 ? ? ? A . n A 1 43 GLN 43 461 ? ? ? A . n A 1 44 ARG 44 462 ? ? ? A . n A 1 45 ASN 45 463 ? ? ? A . n A 1 46 GLN 46 464 ? ? ? A . n A 1 47 LEU 47 465 ? ? ? A . n A 1 48 GLN 48 466 ? ? ? A . n A 1 49 GLY 49 467 ? ? ? A . n A 1 50 ALA 50 468 ? ? ? A . n A 1 51 MET 51 469 ? ? ? A . n A 1 52 GLN 52 470 ? ? ? A . n A 1 53 HIS 53 471 ? ? ? A . n A 1 54 PHE 54 472 ? ? ? A . n A 1 55 SER 55 473 ? ? ? A . n A 1 56 GLN 56 474 ? ? ? A . n A 1 57 ARG 57 475 ? ? ? A . n A 1 58 PHE 58 476 ? ? ? A . n A 1 59 LEU 59 477 ? ? ? A . n A 1 60 TYR 60 478 ? ? ? A . n A 1 61 GLN 61 479 ? ? ? A . n A 1 62 SER 62 480 ? ? ? A . n A 1 63 SER 63 481 ? ? ? A . n A 1 64 SER 64 482 ? ? ? A . n A 1 65 ALA 65 483 ? ? ? A . n A 1 66 SER 66 484 ? ? ? A . n A 1 67 GLN 67 485 ? ? ? A . n A 1 68 GLY 68 486 ? ? ? A . n A 1 69 SER 69 487 ? ? ? A . n A 1 70 PRO 70 488 ? ? ? A . n A 1 71 GLY 71 489 ? ? ? A . n A 1 72 ALA 72 490 ? ? ? A . n A 1 73 TYR 73 491 ? ? ? A . n A 1 74 ASP 74 492 492 ASP ASP A . n A 1 75 ARG 75 493 493 ARG ARG A . n A 1 76 SER 76 494 494 SER SER A . n A 1 77 PHE 77 495 495 PHE PHE A . n A 1 78 ARG 78 496 496 ARG ARG A . n A 1 79 TRP 79 497 497 TRP TRP A . n A 1 80 LYS 80 498 498 LYS LYS A . n A 1 81 TYR 81 499 499 TYR TYR A . n A 1 82 HIS 82 500 500 HIS HIS A . n A 1 83 GLN 83 501 501 GLN GLN A . n A 1 84 PHE 84 502 502 PHE PHE A . n A 1 85 ARG 85 503 503 ARG ARG A . n A 1 86 PHE 86 504 504 PHE PHE A . n A 1 87 LEU 87 505 505 LEU LEU A . n A 1 88 CYS 88 506 506 CYS CYS A . n A 1 89 HIS 89 507 507 HIS HIS A . n A 1 90 SER 90 508 508 SER SER A . n A 1 91 ASN 91 509 509 ASN ASN A . n A 1 92 ALA 92 510 510 ALA ALA A . n A 1 93 LEU 93 511 511 LEU LEU A . n A 1 94 PRO 94 512 512 PRO PRO A . n A 1 95 SER 95 513 513 SER SER A . n A 1 96 HIS 96 514 514 HIS HIS A . n A 1 97 VAL 97 515 515 VAL VAL A . n A 1 98 LYS 98 516 516 LYS LYS A . n A 1 99 ILE 99 517 517 ILE ILE A . n A 1 100 SER 100 518 518 SER SER A . n A 1 101 VAL 101 519 519 VAL VAL A . n A 1 102 SER 102 520 520 SER SER A . n A 1 103 ARG 103 521 521 ARG ARG A . n A 1 104 GLN 104 522 522 GLN GLN A . n A 1 105 THR 105 523 523 THR THR A . n A 1 106 LEU 106 524 524 LEU LEU A . n A 1 107 PHE 107 525 525 PHE PHE A . n A 1 108 GLU 108 526 526 GLU GLU A . n A 1 109 ASP 109 527 527 ASP ASP A . n A 1 110 SER 110 528 528 SER SER A . n A 1 111 PHE 111 529 529 PHE PHE A . n A 1 112 GLN 112 530 530 GLN GLN A . n A 1 113 GLN 113 531 531 GLN GLN A . n A 1 114 ILE 114 532 532 ILE ILE A . n A 1 115 MET 115 533 533 MET MET A . n A 1 116 ASN 116 534 534 ASN ASN A . n A 1 117 MET 117 535 535 MET MET A . n A 1 118 LYS 118 536 536 LYS LYS A . n A 1 119 PRO 119 537 537 PRO PRO A . n A 1 120 TYR 120 538 538 TYR TYR A . n A 1 121 ASP 121 539 539 ASP ASP A . n A 1 122 LEU 122 540 540 LEU LEU A . n A 1 123 ARG 123 541 541 ARG ARG A . n A 1 124 ARG 124 542 542 ARG ARG A . n A 1 125 ARG 125 543 543 ARG ARG A . n A 1 126 LEU 126 544 544 LEU LEU A . n A 1 127 TYR 127 545 545 TYR TYR A . n A 1 128 ILE 128 546 546 ILE ILE A . n A 1 129 ILE 129 547 547 ILE ILE A . n A 1 130 MET 130 548 548 MET MET A . n A 1 131 ARG 131 549 549 ARG ARG A . n A 1 132 GLY 132 550 550 GLY GLY A . n A 1 133 GLU 133 551 551 GLU GLU A . n A 1 134 GLU 134 552 552 GLU GLU A . n A 1 135 GLY 135 553 553 GLY GLY A . n A 1 136 LEU 136 554 ? ? ? A . n A 1 137 ASP 137 555 ? ? ? A . n A 1 138 TYR 138 556 ? ? ? A . n A 1 139 GLY 139 557 ? ? ? A . n A 1 140 GLY 140 558 558 GLY GLY A . n A 1 141 ILE 141 559 559 ILE ILE A . n A 1 142 ALA 142 560 560 ALA ALA A . n A 1 143 ARG 143 561 561 ARG ARG A . n A 1 144 GLU 144 562 562 GLU GLU A . n A 1 145 TRP 145 563 563 TRP TRP A . n A 1 146 PHE 146 564 564 PHE PHE A . n A 1 147 PHE 147 565 565 PHE PHE A . n A 1 148 LEU 148 566 566 LEU LEU A . n A 1 149 LEU 149 567 567 LEU LEU A . n A 1 150 SER 150 568 568 SER SER A . n A 1 151 HIS 151 569 569 HIS HIS A . n A 1 152 GLU 152 570 570 GLU GLU A . n A 1 153 VAL 153 571 571 VAL VAL A . n A 1 154 LEU 154 572 572 LEU LEU A . n A 1 155 ASN 155 573 573 ASN ASN A . n A 1 156 PRO 156 574 574 PRO PRO A . n A 1 157 MET 157 575 575 MET MET A . n A 1 158 TYR 158 576 576 TYR TYR A . n A 1 159 CYS 159 577 577 CYS CYS A . n A 1 160 LEU 160 578 578 LEU LEU A . n A 1 161 PHE 161 579 579 PHE PHE A . n A 1 162 GLU 162 580 580 GLU GLU A . n A 1 163 TYR 163 581 581 TYR TYR A . n A 1 164 ALA 164 582 582 ALA ALA A . n A 1 165 GLY 165 583 583 GLY GLY A . n A 1 166 LYS 166 584 584 LYS LYS A . n A 1 167 ASN 167 585 585 ASN ASN A . n A 1 168 ASN 168 586 586 ASN ASN A . n A 1 169 TYR 169 587 587 TYR TYR A . n A 1 170 CYS 170 588 588 CYS CYS A . n A 1 171 LEU 171 589 589 LEU LEU A . n A 1 172 GLN 172 590 590 GLN GLN A . n A 1 173 ILE 173 591 591 ILE ILE A . n A 1 174 ASN 174 592 592 ASN ASN A . n A 1 175 PRO 175 593 593 PRO PRO A . n A 1 176 ALA 176 594 594 ALA ALA A . n A 1 177 SER 177 595 595 SER SER A . n A 1 178 SER 178 596 596 SER SER A . n A 1 179 ILE 179 597 597 ILE ILE A . n A 1 180 ASN 180 598 598 ASN ASN A . n A 1 181 PRO 181 599 599 PRO PRO A . n A 1 182 ASP 182 600 600 ASP ASP A . n A 1 183 HIS 183 601 601 HIS HIS A . n A 1 184 LEU 184 602 602 LEU LEU A . n A 1 185 THR 185 603 603 THR THR A . n A 1 186 TYR 186 604 604 TYR TYR A . n A 1 187 PHE 187 605 605 PHE PHE A . n A 1 188 ARG 188 606 606 ARG ARG A . n A 1 189 PHE 189 607 607 PHE PHE A . n A 1 190 ILE 190 608 608 ILE ILE A . n A 1 191 GLY 191 609 609 GLY GLY A . n A 1 192 ARG 192 610 610 ARG ARG A . n A 1 193 PHE 193 611 611 PHE PHE A . n A 1 194 ILE 194 612 612 ILE ILE A . n A 1 195 ALA 195 613 613 ALA ALA A . n A 1 196 MET 196 614 614 MET MET A . n A 1 197 ALA 197 615 615 ALA ALA A . n A 1 198 LEU 198 616 616 LEU LEU A . n A 1 199 TYR 199 617 617 TYR TYR A . n A 1 200 HIS 200 618 618 HIS HIS A . n A 1 201 GLY 201 619 619 GLY GLY A . n A 1 202 LYS 202 620 620 LYS LYS A . n A 1 203 PHE 203 621 621 PHE PHE A . n A 1 204 ILE 204 622 622 ILE ILE A . n A 1 205 ASP 205 623 623 ASP ASP A . n A 1 206 THR 206 624 624 THR THR A . n A 1 207 GLY 207 625 625 GLY GLY A . n A 1 208 PHE 208 626 626 PHE PHE A . n A 1 209 THR 209 627 627 THR THR A . n A 1 210 LEU 210 628 628 LEU LEU A . n A 1 211 PRO 211 629 629 PRO PRO A . n A 1 212 PHE 212 630 630 PHE PHE A . n A 1 213 TYR 213 631 631 TYR TYR A . n A 1 214 LYS 214 632 632 LYS LYS A . n A 1 215 ARG 215 633 633 ARG ARG A . n A 1 216 MET 216 634 634 MET MET A . n A 1 217 LEU 217 635 635 LEU LEU A . n A 1 218 ASN 218 636 636 ASN ASN A . n A 1 219 LYS 219 637 637 LYS LYS A . n A 1 220 ARG 220 638 638 ARG ARG A . n A 1 221 PRO 221 639 639 PRO PRO A . n A 1 222 THR 222 640 640 THR THR A . n A 1 223 LEU 223 641 641 LEU LEU A . n A 1 224 LYS 224 642 642 LYS LYS A . n A 1 225 ASP 225 643 643 ASP ASP A . n A 1 226 LEU 226 644 644 LEU LEU A . n A 1 227 GLU 227 645 645 GLU GLU A . n A 1 228 SER 228 646 646 SER SER A . n A 1 229 ILE 229 647 647 ILE ILE A . n A 1 230 ASP 230 648 648 ASP ASP A . n A 1 231 PRO 231 649 649 PRO PRO A . n A 1 232 GLU 232 650 650 GLU GLU A . n A 1 233 PHE 233 651 651 PHE PHE A . n A 1 234 TYR 234 652 652 TYR TYR A . n A 1 235 ASN 235 653 653 ASN ASN A . n A 1 236 SER 236 654 654 SER SER A . n A 1 237 ILE 237 655 655 ILE ILE A . n A 1 238 VAL 238 656 656 VAL VAL A . n A 1 239 TRP 239 657 657 TRP TRP A . n A 1 240 ILE 240 658 658 ILE ILE A . n A 1 241 LYS 241 659 659 LYS LYS A . n A 1 242 GLU 242 660 660 GLU GLU A . n A 1 243 ASN 243 661 661 ASN ASN A . n A 1 244 ASN 244 662 662 ASN ASN A . n A 1 245 LEU 245 663 663 LEU LEU A . n A 1 246 GLU 246 664 664 GLU GLU A . n A 1 247 GLU 247 665 665 GLU GLU A . n A 1 248 CYS 248 666 666 CYS CYS A . n A 1 249 GLY 249 667 667 GLY GLY A . n A 1 250 LEU 250 668 668 LEU LEU A . n A 1 251 GLU 251 669 669 GLU GLU A . n A 1 252 LEU 252 670 670 LEU LEU A . n A 1 253 TYR 253 671 671 TYR TYR A . n A 1 254 PHE 254 672 672 PHE PHE A . n A 1 255 ILE 255 673 673 ILE ILE A . n A 1 256 GLN 256 674 674 GLN GLN A . n A 1 257 ASP 257 675 675 ASP ASP A . n A 1 258 MET 258 676 676 MET MET A . n A 1 259 GLU 259 677 677 GLU GLU A . n A 1 260 ILE 260 678 678 ILE ILE A . n A 1 261 LEU 261 679 679 LEU LEU A . n A 1 262 GLY 262 680 680 GLY GLY A . n A 1 263 LYS 263 681 681 LYS LYS A . n A 1 264 VAL 264 682 ? ? ? A . n A 1 265 THR 265 683 ? ? ? A . n A 1 266 THR 266 684 ? ? ? A . n A 1 267 HIS 267 685 ? ? ? A . n A 1 268 GLU 268 686 ? ? ? A . n A 1 269 LEU 269 687 ? ? ? A . n A 1 270 LYS 270 688 ? ? ? A . n A 1 271 GLU 271 689 ? ? ? A . n A 1 272 GLY 272 690 690 GLY GLY A . n A 1 273 GLY 273 691 691 GLY GLY A . n A 1 274 GLU 274 692 692 GLU GLU A . n A 1 275 SER 275 693 693 SER SER A . n A 1 276 ILE 276 694 694 ILE ILE A . n A 1 277 ARG 277 695 695 ARG ARG A . n A 1 278 VAL 278 696 696 VAL VAL A . n A 1 279 THR 279 697 697 THR THR A . n A 1 280 GLU 280 698 698 GLU GLU A . n A 1 281 GLU 281 699 699 GLU GLU A . n A 1 282 ASN 282 700 700 ASN ASN A . n A 1 283 LYS 283 701 701 LYS LYS A . n A 1 284 GLU 284 702 702 GLU GLU A . n A 1 285 GLU 285 703 703 GLU GLU A . n A 1 286 TYR 286 704 704 TYR TYR A . n A 1 287 ILE 287 705 705 ILE ILE A . n A 1 288 MET 288 706 706 MET MET A . n A 1 289 LEU 289 707 707 LEU LEU A . n A 1 290 LEU 290 708 708 LEU LEU A . n A 1 291 THR 291 709 709 THR THR A . n A 1 292 ASP 292 710 710 ASP ASP A . n A 1 293 TRP 293 711 711 TRP TRP A . n A 1 294 ARG 294 712 712 ARG ARG A . n A 1 295 PHE 295 713 713 PHE PHE A . n A 1 296 THR 296 714 714 THR THR A . n A 1 297 ARG 297 715 715 ARG ARG A . n A 1 298 GLY 298 716 716 GLY GLY A . n A 1 299 VAL 299 717 717 VAL VAL A . n A 1 300 GLU 300 718 718 GLU GLU A . n A 1 301 GLU 301 719 719 GLU GLU A . n A 1 302 GLN 302 720 720 GLN GLN A . n A 1 303 THR 303 721 721 THR THR A . n A 1 304 LYS 304 722 722 LYS LYS A . n A 1 305 ALA 305 723 723 ALA ALA A . n A 1 306 PHE 306 724 724 PHE PHE A . n A 1 307 LEU 307 725 725 LEU LEU A . n A 1 308 ASP 308 726 726 ASP ASP A . n A 1 309 GLY 309 727 727 GLY GLY A . n A 1 310 PHE 310 728 728 PHE PHE A . n A 1 311 ASN 311 729 729 ASN ASN A . n A 1 312 GLU 312 730 730 GLU GLU A . n A 1 313 VAL 313 731 731 VAL VAL A . n A 1 314 ALA 314 732 732 ALA ALA A . n A 1 315 PRO 315 733 733 PRO PRO A . n A 1 316 LEU 316 734 734 LEU LEU A . n A 1 317 GLU 317 735 735 GLU GLU A . n A 1 318 TRP 318 736 736 TRP TRP A . n A 1 319 LEU 319 737 737 LEU LEU A . n A 1 320 ARG 320 738 738 ARG ARG A . n A 1 321 TYR 321 739 739 TYR TYR A . n A 1 322 PHE 322 740 740 PHE PHE A . n A 1 323 ASP 323 741 741 ASP ASP A . n A 1 324 GLU 324 742 742 GLU GLU A . n A 1 325 LYS 325 743 743 LYS LYS A . n A 1 326 GLU 326 744 744 GLU GLU A . n A 1 327 LEU 327 745 745 LEU LEU A . n A 1 328 GLU 328 746 746 GLU GLU A . n A 1 329 LEU 329 747 747 LEU LEU A . n A 1 330 MET 330 748 748 MET MET A . n A 1 331 LEU 331 749 749 LEU LEU A . n A 1 332 CYS 332 750 750 CYS CYS A . n A 1 333 GLY 333 751 751 GLY GLY A . n A 1 334 MET 334 752 752 MET MET A . n A 1 335 GLN 335 753 753 GLN GLN A . n A 1 336 GLU 336 754 754 GLU GLU A . n A 1 337 ILE 337 755 755 ILE ILE A . n A 1 338 ASP 338 756 756 ASP ASP A . n A 1 339 MET 339 757 757 MET MET A . n A 1 340 SER 340 758 758 SER SER A . n A 1 341 ASP 341 759 759 ASP ASP A . n A 1 342 TRP 342 760 760 TRP TRP A . n A 1 343 GLN 343 761 761 GLN GLN A . n A 1 344 LYS 344 762 762 LYS LYS A . n A 1 345 SER 345 763 763 SER SER A . n A 1 346 THR 346 764 764 THR THR A . n A 1 347 ILE 347 765 765 ILE ILE A . n A 1 348 TYR 348 766 766 TYR TYR A . n A 1 349 ARG 349 767 767 ARG ARG A . n A 1 350 HIS 350 768 768 HIS HIS A . n A 1 351 TYR 351 769 769 TYR TYR A . n A 1 352 THR 352 770 770 THR THR A . n A 1 353 LYS 353 771 771 LYS LYS A . n A 1 354 ASN 354 772 772 ASN ASN A . n A 1 355 SER 355 773 773 SER SER A . n A 1 356 LYS 356 774 774 LYS LYS A . n A 1 357 GLN 357 775 775 GLN GLN A . n A 1 358 ILE 358 776 776 ILE ILE A . n A 1 359 GLN 359 777 777 GLN GLN A . n A 1 360 TRP 360 778 778 TRP TRP A . n A 1 361 PHE 361 779 779 PHE PHE A . n A 1 362 TRP 362 780 780 TRP TRP A . n A 1 363 GLN 363 781 781 GLN GLN A . n A 1 364 VAL 364 782 782 VAL VAL A . n A 1 365 VAL 365 783 783 VAL VAL A . n A 1 366 LYS 366 784 784 LYS LYS A . n A 1 367 GLU 367 785 785 GLU GLU A . n A 1 368 MET 368 786 786 MET MET A . n A 1 369 ASP 369 787 787 ASP ASP A . n A 1 370 ASN 370 788 788 ASN ASN A . n A 1 371 GLU 371 789 789 GLU GLU A . n A 1 372 LYS 372 790 790 LYS LYS A . n A 1 373 ARG 373 791 791 ARG ARG A . n A 1 374 ILE 374 792 792 ILE ILE A . n A 1 375 ARG 375 793 793 ARG ARG A . n A 1 376 LEU 376 794 794 LEU LEU A . n A 1 377 LEU 377 795 795 LEU LEU A . n A 1 378 GLN 378 796 796 GLN GLN A . n A 1 379 PHE 379 797 797 PHE PHE A . n A 1 380 VAL 380 798 798 VAL VAL A . n A 1 381 THR 381 799 799 THR THR A . n A 1 382 GLY 382 800 800 GLY GLY A . n A 1 383 THR 383 801 801 THR THR A . n A 1 384 CYS 384 802 802 CYS CYS A . n A 1 385 ARG 385 803 803 ARG ARG A . n A 1 386 LEU 386 804 804 LEU LEU A . n A 1 387 PRO 387 805 805 PRO PRO A . n A 1 388 VAL 388 806 806 VAL VAL A . n A 1 389 GLY 389 807 807 GLY GLY A . n A 1 390 GLY 390 808 808 GLY GLY A . n A 1 391 PHE 391 809 809 PHE PHE A . n A 1 392 ALA 392 810 810 ALA ALA A . n A 1 393 GLU 393 811 811 GLU GLU A . n A 1 394 LEU 394 812 812 LEU LEU A . n A 1 395 ILE 395 813 813 ILE ILE A . n A 1 396 GLY 396 814 814 GLY GLY A . n A 1 397 SER 397 815 815 SER SER A . n A 1 398 ASN 398 816 816 ASN ASN A . n A 1 399 GLY 399 817 817 GLY GLY A . n A 1 400 PRO 400 818 818 PRO PRO A . n A 1 401 GLN 401 819 819 GLN GLN A . n A 1 402 LYS 402 820 820 LYS LYS A . n A 1 403 PHE 403 821 821 PHE PHE A . n A 1 404 CYS 404 822 822 CYS CYS A . n A 1 405 ILE 405 823 823 ILE ILE A . n A 1 406 ASP 406 824 824 ASP ASP A . n A 1 407 LYS 407 825 825 LYS LYS A . n A 1 408 VAL 408 826 826 VAL VAL A . n A 1 409 GLY 409 827 827 GLY GLY A . n A 1 410 LYS 410 828 828 LYS LYS A . n A 1 411 GLU 411 829 829 GLU GLU A . n A 1 412 THR 412 830 830 THR THR A . n A 1 413 TRP 413 831 831 TRP TRP A . n A 1 414 LEU 414 832 832 LEU LEU A . n A 1 415 PRO 415 833 833 PRO PRO A . n A 1 416 ARG 416 834 834 ARG ARG A . n A 1 417 SER 417 835 835 SER SER A . n A 1 418 HIS 418 836 836 HIS HIS A . n A 1 419 THR 419 837 837 THR THR A . n A 1 420 CYS 420 838 838 CYS CYS A . n A 1 421 PHE 421 839 839 PHE PHE A . n A 1 422 ASN 422 840 840 ASN ASN A . n A 1 423 ARG 423 841 841 ARG ARG A . n A 1 424 LEU 424 842 842 LEU LEU A . n A 1 425 ASP 425 843 843 ASP ASP A . n A 1 426 LEU 426 844 844 LEU LEU A . n A 1 427 PRO 427 845 845 PRO PRO A . n A 1 428 PRO 428 846 846 PRO PRO A . n A 1 429 TYR 429 847 847 TYR TYR A . n A 1 430 LYS 430 848 848 LYS LYS A . n A 1 431 SER 431 849 849 SER SER A . n A 1 432 TYR 432 850 850 TYR TYR A . n A 1 433 GLU 433 851 851 GLU GLU A . n A 1 434 GLN 434 852 852 GLN GLN A . n A 1 435 LEU 435 853 853 LEU LEU A . n A 1 436 ARG 436 854 854 ARG ARG A . n A 1 437 GLU 437 855 855 GLU GLU A . n A 1 438 LYS 438 856 856 LYS LYS A . n A 1 439 LEU 439 857 857 LEU LEU A . n A 1 440 LEU 440 858 858 LEU LEU A . n A 1 441 TYR 441 859 859 TYR TYR A . n A 1 442 ALA 442 860 860 ALA ALA A . n A 1 443 ILE 443 861 861 ILE ILE A . n A 1 444 GLU 444 862 862 GLU GLU A . n A 1 445 GLU 445 863 863 GLU GLU A . n A 1 446 THR 446 864 864 THR THR A . n A 1 447 GLU 447 865 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 901 1 HOH HOH A . B 2 HOH 2 902 2 HOH HOH A . B 2 HOH 3 903 7 HOH HOH A . B 2 HOH 4 904 10 HOH HOH A . B 2 HOH 5 905 4 HOH HOH A . B 2 HOH 6 906 3 HOH HOH A . B 2 HOH 7 907 9 HOH HOH A . B 2 HOH 8 908 6 HOH HOH A . B 2 HOH 9 909 11 HOH HOH A . B 2 HOH 10 910 8 HOH HOH A . B 2 HOH 11 911 5 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-05-31 2 'Structure model' 1 1 2017-08-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Data collection' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category diffrn_detector # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_diffrn_detector.detector' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? . 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DENZO ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 5 ? phasing ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? . 6 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A TRP 831 ? ? OH A TYR 847 ? ? 1.66 2 1 O A VAL 656 ? ? OE1 A GLU 660 ? ? 1.99 3 1 NZ A LYS 637 ? ? OE2 A GLU 742 ? ? 2.18 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 OE2 A GLU 562 ? ? 1_555 OE2 A GLU 698 ? ? 3_646 1.98 2 1 ND1 A HIS 500 ? ? 1_555 OE2 A GLU 664 ? ? 1_655 2.03 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 513 ? ? 65.11 -146.81 2 1 PHE A 529 ? ? -46.82 -72.42 3 1 LYS A 536 ? ? 81.81 134.85 4 1 ARG A 549 ? ? 97.03 -49.12 5 1 ASN A 585 ? ? 35.18 60.10 6 1 CYS A 588 ? ? 79.58 73.56 7 1 ASN A 661 ? ? 87.33 110.16 8 1 ASN A 662 ? ? 3.05 -66.12 9 1 LEU A 663 ? ? 101.56 -6.59 10 1 LEU A 670 ? ? 56.77 73.90 11 1 PHE A 672 ? ? -74.99 46.14 12 1 LEU A 679 ? ? 51.93 2.41 13 1 ILE A 694 ? ? 70.92 172.08 14 1 SER A 763 ? ? -105.34 44.55 15 1 ASN A 816 ? ? -106.76 54.50 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 419 ? A GLY 1 2 1 Y 1 A PRO 420 ? A PRO 2 3 1 Y 1 A GLY 421 ? A GLY 3 4 1 Y 1 A TRP 422 ? A TRP 4 5 1 Y 1 A GLU 423 ? A GLU 5 6 1 Y 1 A LYS 424 ? A LYS 6 7 1 Y 1 A ARG 425 ? A ARG 7 8 1 Y 1 A THR 426 ? A THR 8 9 1 Y 1 A ASP 427 ? A ASP 9 10 1 Y 1 A PRO 428 ? A PRO 10 11 1 Y 1 A ARG 429 ? A ARG 11 12 1 Y 1 A GLY 430 ? A GLY 12 13 1 Y 1 A ARG 431 ? A ARG 13 14 1 Y 1 A PHE 432 ? A PHE 14 15 1 Y 1 A TYR 433 ? A TYR 15 16 1 Y 1 A TYR 434 ? A TYR 16 17 1 Y 1 A VAL 435 ? A VAL 17 18 1 Y 1 A ASP 436 ? A ASP 18 19 1 Y 1 A HIS 437 ? A HIS 19 20 1 Y 1 A ASN 438 ? A ASN 20 21 1 Y 1 A THR 439 ? A THR 21 22 1 Y 1 A ARG 440 ? A ARG 22 23 1 Y 1 A THR 441 ? A THR 23 24 1 Y 1 A THR 442 ? A THR 24 25 1 Y 1 A THR 443 ? A THR 25 26 1 Y 1 A TRP 444 ? A TRP 26 27 1 Y 1 A GLN 445 ? A GLN 27 28 1 Y 1 A ARG 446 ? A ARG 28 29 1 Y 1 A PRO 447 ? A PRO 29 30 1 Y 1 A THR 448 ? A THR 30 31 1 Y 1 A ALA 449 ? A ALA 31 32 1 Y 1 A GLU 450 ? A GLU 32 33 1 Y 1 A TYR 451 ? A TYR 33 34 1 Y 1 A VAL 452 ? A VAL 34 35 1 Y 1 A ARG 453 ? A ARG 35 36 1 Y 1 A ASN 454 ? A ASN 36 37 1 Y 1 A TYR 455 ? A TYR 37 38 1 Y 1 A GLU 456 ? A GLU 38 39 1 Y 1 A GLN 457 ? A GLN 39 40 1 Y 1 A TRP 458 ? A TRP 40 41 1 Y 1 A GLN 459 ? A GLN 41 42 1 Y 1 A SER 460 ? A SER 42 43 1 Y 1 A GLN 461 ? A GLN 43 44 1 Y 1 A ARG 462 ? A ARG 44 45 1 Y 1 A ASN 463 ? A ASN 45 46 1 Y 1 A GLN 464 ? A GLN 46 47 1 Y 1 A LEU 465 ? A LEU 47 48 1 Y 1 A GLN 466 ? A GLN 48 49 1 Y 1 A GLY 467 ? A GLY 49 50 1 Y 1 A ALA 468 ? A ALA 50 51 1 Y 1 A MET 469 ? A MET 51 52 1 Y 1 A GLN 470 ? A GLN 52 53 1 Y 1 A HIS 471 ? A HIS 53 54 1 Y 1 A PHE 472 ? A PHE 54 55 1 Y 1 A SER 473 ? A SER 55 56 1 Y 1 A GLN 474 ? A GLN 56 57 1 Y 1 A ARG 475 ? A ARG 57 58 1 Y 1 A PHE 476 ? A PHE 58 59 1 Y 1 A LEU 477 ? A LEU 59 60 1 Y 1 A TYR 478 ? A TYR 60 61 1 Y 1 A GLN 479 ? A GLN 61 62 1 Y 1 A SER 480 ? A SER 62 63 1 Y 1 A SER 481 ? A SER 63 64 1 Y 1 A SER 482 ? A SER 64 65 1 Y 1 A ALA 483 ? A ALA 65 66 1 Y 1 A SER 484 ? A SER 66 67 1 Y 1 A GLN 485 ? A GLN 67 68 1 Y 1 A GLY 486 ? A GLY 68 69 1 Y 1 A SER 487 ? A SER 69 70 1 Y 1 A PRO 488 ? A PRO 70 71 1 Y 1 A GLY 489 ? A GLY 71 72 1 Y 1 A ALA 490 ? A ALA 72 73 1 Y 1 A TYR 491 ? A TYR 73 74 1 Y 1 A LEU 554 ? A LEU 136 75 1 Y 1 A ASP 555 ? A ASP 137 76 1 Y 1 A TYR 556 ? A TYR 138 77 1 Y 1 A GLY 557 ? A GLY 139 78 1 Y 1 A VAL 682 ? A VAL 264 79 1 Y 1 A THR 683 ? A THR 265 80 1 Y 1 A THR 684 ? A THR 266 81 1 Y 1 A HIS 685 ? A HIS 267 82 1 Y 1 A GLU 686 ? A GLU 268 83 1 Y 1 A LEU 687 ? A LEU 269 84 1 Y 1 A LYS 688 ? A LYS 270 85 1 Y 1 A GLU 689 ? A GLU 271 86 1 Y 1 A GLU 865 ? A GLU 447 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #