data_5TOI # _entry.id 5TOI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5TOI pdb_00005toi 10.2210/pdb5toi/pdb WWPDB D_1000224539 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 5TOH _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5TOI _pdbx_database_status.recvd_initial_deposition_date 2016-10-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bruhn, J.F.' 1 'Tickle, I.J.' 2 'Bricogne, G.' 3 'Saphire, E.O.' 4 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Virol.' _citation.journal_id_ASTM JOVIAM _citation.journal_id_CSD 0825 _citation.journal_id_ISSN 1098-5514 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 91 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal Structure of the Marburg Virus VP35 Oligomerization Domain.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1128/JVI.01085-16 _citation.pdbx_database_id_PubMed 27847355 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bruhn, J.F.' 1 ? primary 'Kirchdoerfer, R.N.' 2 ? primary 'Urata, S.M.' 3 ? primary 'Li, S.' 4 ? primary 'Tickle, I.J.' 5 ? primary 'Bricogne, G.' 6 ? primary 'Saphire, E.O.' 7 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5TOI _cell.details ? _cell.formula_units_Z ? _cell.length_a 46.490 _cell.length_a_esd ? _cell.length_b 46.490 _cell.length_b_esd ? _cell.length_c 310.930 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5TOI _symmetry.cell_setting ? _symmetry.Int_Tables_number 93 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 42 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Polymerase cofactor VP35' 8205.597 3 ? ? 'UNP residues 60-130' ? 2 water nat water 18.015 14 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GDIIWDQLIVKRTLADLLIPINRQISDIQSTLSEVTTRVHEIERQLHEITPVLKMGRTLEAISKGMSEMLAK _entity_poly.pdbx_seq_one_letter_code_can GDIIWDQLIVKRTLADLLIPINRQISDIQSTLSEVTTRVHEIERQLHEITPVLKMGRTLEAISKGMSEMLAK _entity_poly.pdbx_strand_id A,B,C _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ASP n 1 3 ILE n 1 4 ILE n 1 5 TRP n 1 6 ASP n 1 7 GLN n 1 8 LEU n 1 9 ILE n 1 10 VAL n 1 11 LYS n 1 12 ARG n 1 13 THR n 1 14 LEU n 1 15 ALA n 1 16 ASP n 1 17 LEU n 1 18 LEU n 1 19 ILE n 1 20 PRO n 1 21 ILE n 1 22 ASN n 1 23 ARG n 1 24 GLN n 1 25 ILE n 1 26 SER n 1 27 ASP n 1 28 ILE n 1 29 GLN n 1 30 SER n 1 31 THR n 1 32 LEU n 1 33 SER n 1 34 GLU n 1 35 VAL n 1 36 THR n 1 37 THR n 1 38 ARG n 1 39 VAL n 1 40 HIS n 1 41 GLU n 1 42 ILE n 1 43 GLU n 1 44 ARG n 1 45 GLN n 1 46 LEU n 1 47 HIS n 1 48 GLU n 1 49 ILE n 1 50 THR n 1 51 PRO n 1 52 VAL n 1 53 LEU n 1 54 LYS n 1 55 MET n 1 56 GLY n 1 57 ARG n 1 58 THR n 1 59 LEU n 1 60 GLU n 1 61 ALA n 1 62 ILE n 1 63 SER n 1 64 LYS n 1 65 GLY n 1 66 MET n 1 67 SER n 1 68 GLU n 1 69 MET n 1 70 LEU n 1 71 ALA n 1 72 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 72 _entity_src_gen.gene_src_common_name MARV _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene VP35 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain Musoke-80 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Lake Victoria marburgvirus (strain Musoke-80)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 33727 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code VP35_MABVM _struct_ref.pdbx_db_accession P35259 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code DIIWDQLIVKRTLADLLIPINRQISDIQSTLSEVTTRVHEIERQLHEITPVLKMGRTLEAISKGMSEMLAK _struct_ref.pdbx_align_begin 60 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5TOI A 2 ? 72 ? P35259 60 ? 130 ? 2 72 2 1 5TOI B 2 ? 72 ? P35259 60 ? 130 ? 2 72 3 1 5TOI C 2 ? 72 ? P35259 60 ? 130 ? 2 72 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5TOI GLY A 1 ? UNP P35259 ? ? 'expression tag' 1 1 2 5TOI GLY B 1 ? UNP P35259 ? ? 'expression tag' 1 2 3 5TOI GLY C 1 ? UNP P35259 ? ? 'expression tag' 1 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5TOI _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.41 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 63.96 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295.5 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M K/Na tartrate and 40% 2-methyl-2,4-pentanediol (MPD)' _exptl_crystal_grow.pdbx_pH_range '8.4 - 9.1' # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 325 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-04-26 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL12-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL12-2 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate 46.9 _reflns.entry_id 5TOI _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.19 _reflns.d_resolution_low 46.49 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6946 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 34.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.0 _reflns.pdbx_Rmerge_I_obs 0.492 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.993 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.19 _reflns_shell.d_res_low 2.31 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.9 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 1.0 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.649 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.0 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.418 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 1.5153 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 1.5153 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -3.0305 _refine.B_iso_max 151.430 _refine.B_iso_mean 66.1900 _refine.B_iso_min 3.290 _refine.correlation_coeff_Fo_to_Fc 0.8740 _refine.correlation_coeff_Fo_to_Fc_free 0.8690 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5TOI _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.1900 _refine.ls_d_res_low 42.4200 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6945 _refine.ls_number_reflns_R_free 704 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 36.9000 _refine.ls_percent_reflns_R_free 10.1400 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.3150 _refine.ls_R_factor_R_free 0.3420 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.3120 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5TOH _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI 0.5180 _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 5TOI _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.680 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.1900 _refine_hist.d_res_low 42.4200 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 14 _refine_hist.number_atoms_total 1676 _refine_hist.pdbx_number_residues_total 208 _refine_hist.pdbx_B_iso_mean_solvent 18.15 _refine_hist.pdbx_number_atoms_protein 1662 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? ? ? 807 ? t_dihedral_angle_d 2.000 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? 45 ? t_trig_c_planes 2.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 482 ? t_gen_planes 5.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 3430 ? t_it 20.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 0 ? t_nbd 5.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? 248 ? t_chiral_improper_torsion 5.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 3449 ? t_ideal_dist_contact 4.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? 0.009 ? 3430 ? t_bond_d 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 0.930 ? 6258 ? t_angle_deg 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 4.990 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 16.360 ? ? ? t_other_torsion ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.1900 _refine_ls_shell.d_res_low 2.4500 _refine_ls_shell.number_reflns_all 200 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 23 _refine_ls_shell.number_reflns_R_work 177 _refine_ls_shell.percent_reflns_obs 3.8500 _refine_ls_shell.percent_reflns_R_free 11.5000 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3550 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.3250 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 5 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5TOI _struct.title 'Crystal Structure of the Marburg Virus VP35 Oligomerization Domain P4222' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5TOI _struct_keywords.text 'polymerase cofactor, coiled coil, oligomerization, trimer, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 2 ? E N N 2 ? F N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 2 ? GLU A 48 ? ASP A 2 GLU A 48 1 ? 47 HELX_P HELX_P2 AA2 ILE A 49 ? MET A 69 ? ILE A 49 MET A 69 1 ? 21 HELX_P HELX_P3 AA3 ASP B 2 ? MET B 69 ? ASP B 2 MET B 69 1 ? 68 HELX_P HELX_P4 AA4 ASP C 2 ? LEU C 70 ? ASP C 2 LEU C 70 1 ? 69 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 5TOI _atom_sites.fract_transf_matrix[1][1] 0.021510 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021510 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.003216 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 TRP 5 5 5 TRP TRP A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 HIS 47 47 47 HIS HIS A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 MET 55 55 55 MET MET A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 MET 66 66 66 MET MET A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 MET 69 69 69 MET MET A . n A 1 70 LEU 70 70 ? ? ? A . n A 1 71 ALA 71 71 ? ? ? A . n A 1 72 LYS 72 72 ? ? ? A . n B 1 1 GLY 1 1 1 GLY GLY B . n B 1 2 ASP 2 2 2 ASP ASP B . n B 1 3 ILE 3 3 3 ILE ILE B . n B 1 4 ILE 4 4 4 ILE ILE B . n B 1 5 TRP 5 5 5 TRP TRP B . n B 1 6 ASP 6 6 6 ASP ASP B . n B 1 7 GLN 7 7 7 GLN GLN B . n B 1 8 LEU 8 8 8 LEU LEU B . n B 1 9 ILE 9 9 9 ILE ILE B . n B 1 10 VAL 10 10 10 VAL VAL B . n B 1 11 LYS 11 11 11 LYS LYS B . n B 1 12 ARG 12 12 12 ARG ARG B . n B 1 13 THR 13 13 13 THR THR B . n B 1 14 LEU 14 14 14 LEU LEU B . n B 1 15 ALA 15 15 15 ALA ALA B . n B 1 16 ASP 16 16 16 ASP ASP B . n B 1 17 LEU 17 17 17 LEU LEU B . n B 1 18 LEU 18 18 18 LEU LEU B . n B 1 19 ILE 19 19 19 ILE ILE B . n B 1 20 PRO 20 20 20 PRO PRO B . n B 1 21 ILE 21 21 21 ILE ILE B . n B 1 22 ASN 22 22 22 ASN ASN B . n B 1 23 ARG 23 23 23 ARG ARG B . n B 1 24 GLN 24 24 24 GLN GLN B . n B 1 25 ILE 25 25 25 ILE ILE B . n B 1 26 SER 26 26 26 SER SER B . n B 1 27 ASP 27 27 27 ASP ASP B . n B 1 28 ILE 28 28 28 ILE ILE B . n B 1 29 GLN 29 29 29 GLN GLN B . n B 1 30 SER 30 30 30 SER SER B . n B 1 31 THR 31 31 31 THR THR B . n B 1 32 LEU 32 32 32 LEU LEU B . n B 1 33 SER 33 33 33 SER SER B . n B 1 34 GLU 34 34 34 GLU GLU B . n B 1 35 VAL 35 35 35 VAL VAL B . n B 1 36 THR 36 36 36 THR THR B . n B 1 37 THR 37 37 37 THR THR B . n B 1 38 ARG 38 38 38 ARG ARG B . n B 1 39 VAL 39 39 39 VAL VAL B . n B 1 40 HIS 40 40 40 HIS HIS B . n B 1 41 GLU 41 41 41 GLU GLU B . n B 1 42 ILE 42 42 42 ILE ILE B . n B 1 43 GLU 43 43 43 GLU GLU B . n B 1 44 ARG 44 44 44 ARG ARG B . n B 1 45 GLN 45 45 45 GLN GLN B . n B 1 46 LEU 46 46 46 LEU LEU B . n B 1 47 HIS 47 47 47 HIS HIS B . n B 1 48 GLU 48 48 48 GLU GLU B . n B 1 49 ILE 49 49 49 ILE ILE B . n B 1 50 THR 50 50 50 THR THR B . n B 1 51 PRO 51 51 51 PRO PRO B . n B 1 52 VAL 52 52 52 VAL VAL B . n B 1 53 LEU 53 53 53 LEU LEU B . n B 1 54 LYS 54 54 54 LYS LYS B . n B 1 55 MET 55 55 55 MET MET B . n B 1 56 GLY 56 56 56 GLY GLY B . n B 1 57 ARG 57 57 57 ARG ARG B . n B 1 58 THR 58 58 58 THR THR B . n B 1 59 LEU 59 59 59 LEU LEU B . n B 1 60 GLU 60 60 60 GLU GLU B . n B 1 61 ALA 61 61 61 ALA ALA B . n B 1 62 ILE 62 62 62 ILE ILE B . n B 1 63 SER 63 63 63 SER SER B . n B 1 64 LYS 64 64 64 LYS LYS B . n B 1 65 GLY 65 65 65 GLY GLY B . n B 1 66 MET 66 66 66 MET MET B . n B 1 67 SER 67 67 67 SER SER B . n B 1 68 GLU 68 68 68 GLU GLU B . n B 1 69 MET 69 69 69 MET MET B . n B 1 70 LEU 70 70 70 LEU LEU B . n B 1 71 ALA 71 71 ? ? ? B . n B 1 72 LYS 72 72 ? ? ? B . n C 1 1 GLY 1 1 1 GLY GLY C . n C 1 2 ASP 2 2 2 ASP ASP C . n C 1 3 ILE 3 3 3 ILE ILE C . n C 1 4 ILE 4 4 4 ILE ILE C . n C 1 5 TRP 5 5 5 TRP TRP C . n C 1 6 ASP 6 6 6 ASP ASP C . n C 1 7 GLN 7 7 7 GLN GLN C . n C 1 8 LEU 8 8 8 LEU LEU C . n C 1 9 ILE 9 9 9 ILE ILE C . n C 1 10 VAL 10 10 10 VAL VAL C . n C 1 11 LYS 11 11 11 LYS LYS C . n C 1 12 ARG 12 12 12 ARG ARG C . n C 1 13 THR 13 13 13 THR THR C . n C 1 14 LEU 14 14 14 LEU LEU C . n C 1 15 ALA 15 15 15 ALA ALA C . n C 1 16 ASP 16 16 16 ASP ASP C . n C 1 17 LEU 17 17 17 LEU LEU C . n C 1 18 LEU 18 18 18 LEU LEU C . n C 1 19 ILE 19 19 19 ILE ILE C . n C 1 20 PRO 20 20 20 PRO PRO C . n C 1 21 ILE 21 21 21 ILE ILE C . n C 1 22 ASN 22 22 22 ASN ASN C . n C 1 23 ARG 23 23 23 ARG ARG C . n C 1 24 GLN 24 24 24 GLN GLN C . n C 1 25 ILE 25 25 25 ILE ILE C . n C 1 26 SER 26 26 26 SER SER C . n C 1 27 ASP 27 27 27 ASP ASP C . n C 1 28 ILE 28 28 28 ILE ILE C . n C 1 29 GLN 29 29 29 GLN GLN C . n C 1 30 SER 30 30 30 SER SER C . n C 1 31 THR 31 31 31 THR THR C . n C 1 32 LEU 32 32 32 LEU LEU C . n C 1 33 SER 33 33 33 SER SER C . n C 1 34 GLU 34 34 34 GLU GLU C . n C 1 35 VAL 35 35 35 VAL VAL C . n C 1 36 THR 36 36 36 THR THR C . n C 1 37 THR 37 37 37 THR THR C . n C 1 38 ARG 38 38 38 ARG ARG C . n C 1 39 VAL 39 39 39 VAL VAL C . n C 1 40 HIS 40 40 40 HIS HIS C . n C 1 41 GLU 41 41 41 GLU GLU C . n C 1 42 ILE 42 42 42 ILE ILE C . n C 1 43 GLU 43 43 43 GLU GLU C . n C 1 44 ARG 44 44 44 ARG ARG C . n C 1 45 GLN 45 45 45 GLN GLN C . n C 1 46 LEU 46 46 46 LEU LEU C . n C 1 47 HIS 47 47 47 HIS HIS C . n C 1 48 GLU 48 48 48 GLU GLU C . n C 1 49 ILE 49 49 49 ILE ILE C . n C 1 50 THR 50 50 50 THR THR C . n C 1 51 PRO 51 51 51 PRO PRO C . n C 1 52 VAL 52 52 52 VAL VAL C . n C 1 53 LEU 53 53 53 LEU LEU C . n C 1 54 LYS 54 54 54 LYS LYS C . n C 1 55 MET 55 55 55 MET MET C . n C 1 56 GLY 56 56 56 GLY GLY C . n C 1 57 ARG 57 57 57 ARG ARG C . n C 1 58 THR 58 58 58 THR THR C . n C 1 59 LEU 59 59 59 LEU LEU C . n C 1 60 GLU 60 60 60 GLU GLU C . n C 1 61 ALA 61 61 61 ALA ALA C . n C 1 62 ILE 62 62 62 ILE ILE C . n C 1 63 SER 63 63 63 SER SER C . n C 1 64 LYS 64 64 64 LYS LYS C . n C 1 65 GLY 65 65 65 GLY GLY C . n C 1 66 MET 66 66 66 MET MET C . n C 1 67 SER 67 67 67 SER SER C . n C 1 68 GLU 68 68 68 GLU GLU C . n C 1 69 MET 69 69 69 MET MET C . n C 1 70 LEU 70 70 70 LEU LEU C . n C 1 71 ALA 71 71 ? ? ? C . n C 1 72 LYS 72 72 ? ? ? C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 2 HOH 1 101 26 HOH HOH A . D 2 HOH 2 102 33 HOH HOH A . D 2 HOH 3 103 12 HOH HOH A . D 2 HOH 4 104 4 HOH HOH A . D 2 HOH 5 105 40 HOH HOH A . D 2 HOH 6 106 37 HOH HOH A . E 2 HOH 1 101 45 HOH HOH B . E 2 HOH 2 102 16 HOH HOH B . E 2 HOH 3 103 43 HOH HOH B . E 2 HOH 4 104 42 HOH HOH B . E 2 HOH 5 105 9 HOH HOH B . F 2 HOH 1 101 32 HOH HOH C . F 2 HOH 2 102 27 HOH HOH C . F 2 HOH 3 103 22 HOH HOH C . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5470 ? 1 MORE -54 ? 1 'SSA (A^2)' 15600 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-11-09 2 'Structure model' 1 1 2016-11-30 3 'Structure model' 1 2 2017-01-11 4 'Structure model' 1 3 2017-02-08 5 'Structure model' 1 4 2017-09-27 6 'Structure model' 1 5 2019-12-04 7 'Structure model' 1 6 2023-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 5 'Structure model' 'Author supporting evidence' 5 5 'Structure model' 'Refinement description' 6 6 'Structure model' 'Author supporting evidence' 7 7 'Structure model' 'Data collection' 8 7 'Structure model' 'Database references' 9 7 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' pdbx_audit_support 2 5 'Structure model' software 3 6 'Structure model' pdbx_audit_support 4 7 'Structure model' chem_comp_atom 5 7 'Structure model' chem_comp_bond 6 7 'Structure model' database_2 7 7 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_pdbx_audit_support.funding_organization' 2 6 'Structure model' '_pdbx_audit_support.funding_organization' 3 7 'Structure model' '_database_2.pdbx_DOI' 4 7 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? STARANISO ? ? ? . 5 ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.11.7 6 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OE1 _pdbx_validate_symm_contact.auth_asym_id_1 B _pdbx_validate_symm_contact.auth_comp_id_1 GLN _pdbx_validate_symm_contact.auth_seq_id_1 7 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 NE2 _pdbx_validate_symm_contact.auth_asym_id_2 B _pdbx_validate_symm_contact.auth_comp_id_2 GLN _pdbx_validate_symm_contact.auth_seq_id_2 7 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 6_565 _pdbx_validate_symm_contact.dist 1.51 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 1 ? A GLY 1 2 1 Y 1 A LEU 70 ? A LEU 70 3 1 Y 1 A ALA 71 ? A ALA 71 4 1 Y 1 A LYS 72 ? A LYS 72 5 1 Y 1 B ALA 71 ? B ALA 71 6 1 Y 1 B LYS 72 ? B LYS 72 7 1 Y 1 C ALA 71 ? C ALA 71 8 1 Y 1 C LYS 72 ? C LYS 72 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PRO N N N N 236 PRO CA C N S 237 PRO C C N N 238 PRO O O N N 239 PRO CB C N N 240 PRO CG C N N 241 PRO CD C N N 242 PRO OXT O N N 243 PRO H H N N 244 PRO HA H N N 245 PRO HB2 H N N 246 PRO HB3 H N N 247 PRO HG2 H N N 248 PRO HG3 H N N 249 PRO HD2 H N N 250 PRO HD3 H N N 251 PRO HXT H N N 252 SER N N N N 253 SER CA C N S 254 SER C C N N 255 SER O O N N 256 SER CB C N N 257 SER OG O N N 258 SER OXT O N N 259 SER H H N N 260 SER H2 H N N 261 SER HA H N N 262 SER HB2 H N N 263 SER HB3 H N N 264 SER HG H N N 265 SER HXT H N N 266 THR N N N N 267 THR CA C N S 268 THR C C N N 269 THR O O N N 270 THR CB C N R 271 THR OG1 O N N 272 THR CG2 C N N 273 THR OXT O N N 274 THR H H N N 275 THR H2 H N N 276 THR HA H N N 277 THR HB H N N 278 THR HG1 H N N 279 THR HG21 H N N 280 THR HG22 H N N 281 THR HG23 H N N 282 THR HXT H N N 283 TRP N N N N 284 TRP CA C N S 285 TRP C C N N 286 TRP O O N N 287 TRP CB C N N 288 TRP CG C Y N 289 TRP CD1 C Y N 290 TRP CD2 C Y N 291 TRP NE1 N Y N 292 TRP CE2 C Y N 293 TRP CE3 C Y N 294 TRP CZ2 C Y N 295 TRP CZ3 C Y N 296 TRP CH2 C Y N 297 TRP OXT O N N 298 TRP H H N N 299 TRP H2 H N N 300 TRP HA H N N 301 TRP HB2 H N N 302 TRP HB3 H N N 303 TRP HD1 H N N 304 TRP HE1 H N N 305 TRP HE3 H N N 306 TRP HZ2 H N N 307 TRP HZ3 H N N 308 TRP HH2 H N N 309 TRP HXT H N N 310 VAL N N N N 311 VAL CA C N S 312 VAL C C N N 313 VAL O O N N 314 VAL CB C N N 315 VAL CG1 C N N 316 VAL CG2 C N N 317 VAL OXT O N N 318 VAL H H N N 319 VAL H2 H N N 320 VAL HA H N N 321 VAL HB H N N 322 VAL HG11 H N N 323 VAL HG12 H N N 324 VAL HG13 H N N 325 VAL HG21 H N N 326 VAL HG22 H N N 327 VAL HG23 H N N 328 VAL HXT H N N 329 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PRO N CA sing N N 224 PRO N CD sing N N 225 PRO N H sing N N 226 PRO CA C sing N N 227 PRO CA CB sing N N 228 PRO CA HA sing N N 229 PRO C O doub N N 230 PRO C OXT sing N N 231 PRO CB CG sing N N 232 PRO CB HB2 sing N N 233 PRO CB HB3 sing N N 234 PRO CG CD sing N N 235 PRO CG HG2 sing N N 236 PRO CG HG3 sing N N 237 PRO CD HD2 sing N N 238 PRO CD HD3 sing N N 239 PRO OXT HXT sing N N 240 SER N CA sing N N 241 SER N H sing N N 242 SER N H2 sing N N 243 SER CA C sing N N 244 SER CA CB sing N N 245 SER CA HA sing N N 246 SER C O doub N N 247 SER C OXT sing N N 248 SER CB OG sing N N 249 SER CB HB2 sing N N 250 SER CB HB3 sing N N 251 SER OG HG sing N N 252 SER OXT HXT sing N N 253 THR N CA sing N N 254 THR N H sing N N 255 THR N H2 sing N N 256 THR CA C sing N N 257 THR CA CB sing N N 258 THR CA HA sing N N 259 THR C O doub N N 260 THR C OXT sing N N 261 THR CB OG1 sing N N 262 THR CB CG2 sing N N 263 THR CB HB sing N N 264 THR OG1 HG1 sing N N 265 THR CG2 HG21 sing N N 266 THR CG2 HG22 sing N N 267 THR CG2 HG23 sing N N 268 THR OXT HXT sing N N 269 TRP N CA sing N N 270 TRP N H sing N N 271 TRP N H2 sing N N 272 TRP CA C sing N N 273 TRP CA CB sing N N 274 TRP CA HA sing N N 275 TRP C O doub N N 276 TRP C OXT sing N N 277 TRP CB CG sing N N 278 TRP CB HB2 sing N N 279 TRP CB HB3 sing N N 280 TRP CG CD1 doub Y N 281 TRP CG CD2 sing Y N 282 TRP CD1 NE1 sing Y N 283 TRP CD1 HD1 sing N N 284 TRP CD2 CE2 doub Y N 285 TRP CD2 CE3 sing Y N 286 TRP NE1 CE2 sing Y N 287 TRP NE1 HE1 sing N N 288 TRP CE2 CZ2 sing Y N 289 TRP CE3 CZ3 doub Y N 290 TRP CE3 HE3 sing N N 291 TRP CZ2 CH2 doub Y N 292 TRP CZ2 HZ2 sing N N 293 TRP CZ3 CH2 sing Y N 294 TRP CZ3 HZ3 sing N N 295 TRP CH2 HH2 sing N N 296 TRP OXT HXT sing N N 297 VAL N CA sing N N 298 VAL N H sing N N 299 VAL N H2 sing N N 300 VAL CA C sing N N 301 VAL CA CB sing N N 302 VAL CA HA sing N N 303 VAL C O doub N N 304 VAL C OXT sing N N 305 VAL CB CG1 sing N N 306 VAL CB CG2 sing N N 307 VAL CB HB sing N N 308 VAL CG1 HG11 sing N N 309 VAL CG1 HG12 sing N N 310 VAL CG1 HG13 sing N N 311 VAL CG2 HG21 sing N N 312 VAL CG2 HG22 sing N N 313 VAL CG2 HG23 sing N N 314 VAL OXT HXT sing N N 315 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' 'T32 AI007606' 1 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' 'R01 AI118016' 2 'Burroughs Wellcome Fund' 'United States' ? 3 'Department of Energy (DOE, United States)' 'United States' DE-AC02-76SF00515 4 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' P41GM103393 5 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5TOH _pdbx_initial_refinement_model.details ? #