data_5TPJ # _entry.id 5TPJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5TPJ pdb_00005tpj 10.2210/pdb5tpj/pdb WWPDB D_1000224596 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-01-25 2 'Structure model' 1 1 2017-02-01 3 'Structure model' 1 2 2017-09-20 4 'Structure model' 1 3 2019-12-04 5 'Structure model' 1 4 2024-03-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Author supporting evidence' 3 4 'Structure model' 'Author supporting evidence' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_audit_support 2 4 'Structure model' pdbx_audit_support 3 5 'Structure model' chem_comp_atom 4 5 'Structure model' chem_comp_bond 5 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_audit_support.funding_organization' 2 4 'Structure model' '_pdbx_audit_support.funding_organization' 3 5 'Structure model' '_database_2.pdbx_DOI' 4 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5TPJ _pdbx_database_status.recvd_initial_deposition_date 2016-10-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 5TPH _pdbx_database_related.db_name PDB _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Basanta, B.' 1 'Oberdorfer, G.' 2 'Marcos, E.' 3 'Chidyausiku, T.M.' 4 'Sankaran, B.' 5 'Baker, D.' 6 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Science _citation.journal_id_ASTM SCIEAS _citation.journal_id_CSD 0038 _citation.journal_id_ISSN 1095-9203 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 355 _citation.language ? _citation.page_first 201 _citation.page_last 206 _citation.title 'Principles for designing proteins with cavities formed by curved beta sheets.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1126/science.aah7389 _citation.pdbx_database_id_PubMed 28082595 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Marcos, E.' 1 ? primary 'Basanta, B.' 2 ? primary 'Chidyausiku, T.M.' 3 ? primary 'Tang, Y.' 4 ? primary 'Oberdorfer, G.' 5 ? primary 'Liu, G.' 6 ? primary 'Swapna, G.V.' 7 ? primary 'Guan, R.' 8 ? primary 'Silva, D.A.' 9 ? primary 'Dou, J.' 10 ? primary 'Pereira, J.H.' 11 ? primary 'Xiao, R.' 12 ? primary 'Sankaran, B.' 13 ? primary 'Zwart, P.H.' 14 ? primary 'Montelione, G.T.' 15 ? primary 'Baker, D.' 16 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'denovo NTF2' 14927.178 1 ? ? ? ? 2 water nat water 18.015 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMSREEIRKVVEEMVRKLKQGSPEDISKYLSPDVRLEVGNYTFEGSEQVTKFWRMLTKFVDRVEVRKVQVDGNHVRVE VEVEWNGKKWTFEVEVEVRNGKIKRIRLQVDPEFKKVVQNIWNLL ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMSREEIRKVVEEMVRKLKQGSPEDISKYLSPDVRLEVGNYTFEGSEQVTKFWRMLTKFVDRVEVRKVQVDGNHVRVE VEVEWNGKKWTFEVEVEVRNGKIKRIRLQVDPEFKKVVQNIWNLL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 SER n 1 6 ARG n 1 7 GLU n 1 8 GLU n 1 9 ILE n 1 10 ARG n 1 11 LYS n 1 12 VAL n 1 13 VAL n 1 14 GLU n 1 15 GLU n 1 16 MET n 1 17 VAL n 1 18 ARG n 1 19 LYS n 1 20 LEU n 1 21 LYS n 1 22 GLN n 1 23 GLY n 1 24 SER n 1 25 PRO n 1 26 GLU n 1 27 ASP n 1 28 ILE n 1 29 SER n 1 30 LYS n 1 31 TYR n 1 32 LEU n 1 33 SER n 1 34 PRO n 1 35 ASP n 1 36 VAL n 1 37 ARG n 1 38 LEU n 1 39 GLU n 1 40 VAL n 1 41 GLY n 1 42 ASN n 1 43 TYR n 1 44 THR n 1 45 PHE n 1 46 GLU n 1 47 GLY n 1 48 SER n 1 49 GLU n 1 50 GLN n 1 51 VAL n 1 52 THR n 1 53 LYS n 1 54 PHE n 1 55 TRP n 1 56 ARG n 1 57 MET n 1 58 LEU n 1 59 THR n 1 60 LYS n 1 61 PHE n 1 62 VAL n 1 63 ASP n 1 64 ARG n 1 65 VAL n 1 66 GLU n 1 67 VAL n 1 68 ARG n 1 69 LYS n 1 70 VAL n 1 71 GLN n 1 72 VAL n 1 73 ASP n 1 74 GLY n 1 75 ASN n 1 76 HIS n 1 77 VAL n 1 78 ARG n 1 79 VAL n 1 80 GLU n 1 81 VAL n 1 82 GLU n 1 83 VAL n 1 84 GLU n 1 85 TRP n 1 86 ASN n 1 87 GLY n 1 88 LYS n 1 89 LYS n 1 90 TRP n 1 91 THR n 1 92 PHE n 1 93 GLU n 1 94 VAL n 1 95 GLU n 1 96 VAL n 1 97 GLU n 1 98 VAL n 1 99 ARG n 1 100 ASN n 1 101 GLY n 1 102 LYS n 1 103 ILE n 1 104 LYS n 1 105 ARG n 1 106 ILE n 1 107 ARG n 1 108 LEU n 1 109 GLN n 1 110 VAL n 1 111 ASP n 1 112 PRO n 1 113 GLU n 1 114 PHE n 1 115 LYS n 1 116 LYS n 1 117 VAL n 1 118 VAL n 1 119 GLN n 1 120 ASN n 1 121 ILE n 1 122 TRP n 1 123 ASN n 1 124 LEU n 1 125 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 125 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 SER 2 -1 ? ? ? A . n A 1 3 HIS 3 0 ? ? ? A . n A 1 4 MET 4 1 1 MET MET A . n A 1 5 SER 5 2 2 SER SER A . n A 1 6 ARG 6 3 3 ARG ARG A . n A 1 7 GLU 7 4 4 GLU GLU A . n A 1 8 GLU 8 5 5 GLU GLU A . n A 1 9 ILE 9 6 6 ILE ILE A . n A 1 10 ARG 10 7 7 ARG ARG A . n A 1 11 LYS 11 8 8 LYS LYS A . n A 1 12 VAL 12 9 9 VAL VAL A . n A 1 13 VAL 13 10 10 VAL VAL A . n A 1 14 GLU 14 11 11 GLU GLU A . n A 1 15 GLU 15 12 12 GLU GLU A . n A 1 16 MET 16 13 13 MET MET A . n A 1 17 VAL 17 14 14 VAL VAL A . n A 1 18 ARG 18 15 15 ARG ARG A . n A 1 19 LYS 19 16 16 LYS LYS A . n A 1 20 LEU 20 17 17 LEU LEU A . n A 1 21 LYS 21 18 18 LYS LYS A . n A 1 22 GLN 22 19 19 GLN GLN A . n A 1 23 GLY 23 20 20 GLY GLY A . n A 1 24 SER 24 21 21 SER SER A . n A 1 25 PRO 25 22 22 PRO PRO A . n A 1 26 GLU 26 23 23 GLU GLU A . n A 1 27 ASP 27 24 24 ASP ASP A . n A 1 28 ILE 28 25 25 ILE ILE A . n A 1 29 SER 29 26 26 SER SER A . n A 1 30 LYS 30 27 27 LYS LYS A . n A 1 31 TYR 31 28 28 TYR TYR A . n A 1 32 LEU 32 29 29 LEU LEU A . n A 1 33 SER 33 30 30 SER SER A . n A 1 34 PRO 34 31 31 PRO PRO A . n A 1 35 ASP 35 32 32 ASP ASP A . n A 1 36 VAL 36 33 33 VAL VAL A . n A 1 37 ARG 37 34 34 ARG ARG A . n A 1 38 LEU 38 35 35 LEU LEU A . n A 1 39 GLU 39 36 36 GLU GLU A . n A 1 40 VAL 40 37 37 VAL VAL A . n A 1 41 GLY 41 38 38 GLY GLY A . n A 1 42 ASN 42 39 39 ASN ASN A . n A 1 43 TYR 43 40 40 TYR TYR A . n A 1 44 THR 44 41 41 THR THR A . n A 1 45 PHE 45 42 42 PHE PHE A . n A 1 46 GLU 46 43 43 GLU GLU A . n A 1 47 GLY 47 44 44 GLY GLY A . n A 1 48 SER 48 45 45 SER SER A . n A 1 49 GLU 49 46 46 GLU GLU A . n A 1 50 GLN 50 47 47 GLN GLN A . n A 1 51 VAL 51 48 48 VAL VAL A . n A 1 52 THR 52 49 49 THR THR A . n A 1 53 LYS 53 50 50 LYS LYS A . n A 1 54 PHE 54 51 51 PHE PHE A . n A 1 55 TRP 55 52 52 TRP TRP A . n A 1 56 ARG 56 53 53 ARG ARG A . n A 1 57 MET 57 54 54 MET MET A . n A 1 58 LEU 58 55 55 LEU LEU A . n A 1 59 THR 59 56 56 THR THR A . n A 1 60 LYS 60 57 57 LYS LYS A . n A 1 61 PHE 61 58 58 PHE PHE A . n A 1 62 VAL 62 59 59 VAL VAL A . n A 1 63 ASP 63 60 60 ASP ASP A . n A 1 64 ARG 64 61 61 ARG ARG A . n A 1 65 VAL 65 62 62 VAL VAL A . n A 1 66 GLU 66 63 63 GLU GLU A . n A 1 67 VAL 67 64 64 VAL VAL A . n A 1 68 ARG 68 65 65 ARG ARG A . n A 1 69 LYS 69 66 66 LYS LYS A . n A 1 70 VAL 70 67 67 VAL VAL A . n A 1 71 GLN 71 68 68 GLN GLN A . n A 1 72 VAL 72 69 69 VAL VAL A . n A 1 73 ASP 73 70 70 ASP ASP A . n A 1 74 GLY 74 71 71 GLY GLY A . n A 1 75 ASN 75 72 72 ASN ASN A . n A 1 76 HIS 76 73 73 HIS HIS A . n A 1 77 VAL 77 74 74 VAL VAL A . n A 1 78 ARG 78 75 75 ARG ARG A . n A 1 79 VAL 79 76 76 VAL VAL A . n A 1 80 GLU 80 77 77 GLU GLU A . n A 1 81 VAL 81 78 78 VAL VAL A . n A 1 82 GLU 82 79 79 GLU GLU A . n A 1 83 VAL 83 80 80 VAL VAL A . n A 1 84 GLU 84 81 81 GLU GLU A . n A 1 85 TRP 85 82 82 TRP TRP A . n A 1 86 ASN 86 83 83 ASN ASN A . n A 1 87 GLY 87 84 84 GLY GLY A . n A 1 88 LYS 88 85 85 LYS LYS A . n A 1 89 LYS 89 86 86 LYS LYS A . n A 1 90 TRP 90 87 87 TRP TRP A . n A 1 91 THR 91 88 88 THR THR A . n A 1 92 PHE 92 89 89 PHE PHE A . n A 1 93 GLU 93 90 90 GLU GLU A . n A 1 94 VAL 94 91 91 VAL VAL A . n A 1 95 GLU 95 92 92 GLU GLU A . n A 1 96 VAL 96 93 93 VAL VAL A . n A 1 97 GLU 97 94 94 GLU GLU A . n A 1 98 VAL 98 95 95 VAL VAL A . n A 1 99 ARG 99 96 96 ARG ARG A . n A 1 100 ASN 100 97 97 ASN ASN A . n A 1 101 GLY 101 98 98 GLY GLY A . n A 1 102 LYS 102 99 99 LYS LYS A . n A 1 103 ILE 103 100 100 ILE ILE A . n A 1 104 LYS 104 101 101 LYS LYS A . n A 1 105 ARG 105 102 102 ARG ARG A . n A 1 106 ILE 106 103 103 ILE ILE A . n A 1 107 ARG 107 104 104 ARG ARG A . n A 1 108 LEU 108 105 105 LEU LEU A . n A 1 109 GLN 109 106 106 GLN GLN A . n A 1 110 VAL 110 107 107 VAL VAL A . n A 1 111 ASP 111 108 108 ASP ASP A . n A 1 112 PRO 112 109 109 PRO PRO A . n A 1 113 GLU 113 110 110 GLU GLU A . n A 1 114 PHE 114 111 111 PHE PHE A . n A 1 115 LYS 115 112 112 LYS LYS A . n A 1 116 LYS 116 113 113 LYS LYS A . n A 1 117 VAL 117 114 114 VAL VAL A . n A 1 118 VAL 118 115 115 VAL VAL A . n A 1 119 GLN 119 116 116 GLN GLN A . n A 1 120 ASN 120 117 117 ASN ASN A . n A 1 121 ILE 121 118 118 ILE ILE A . n A 1 122 TRP 122 119 119 TRP TRP A . n A 1 123 ASN 123 120 120 ASN ASN A . n A 1 124 LEU 124 121 121 LEU LEU A . n A 1 125 LEU 125 122 122 LEU LEU A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id HOH _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 1 _pdbx_nonpoly_scheme.pdb_mon_id HOH _pdbx_nonpoly_scheme.auth_mon_id HOH _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A MET 1 ? CG ? A MET 4 CG 2 1 Y 1 A MET 1 ? SD ? A MET 4 SD 3 1 Y 1 A MET 1 ? CE ? A MET 4 CE 4 1 Y 1 A GLU 5 ? CG ? A GLU 8 CG 5 1 Y 1 A GLU 5 ? CD ? A GLU 8 CD 6 1 Y 1 A GLU 5 ? OE1 ? A GLU 8 OE1 7 1 Y 1 A GLU 5 ? OE2 ? A GLU 8 OE2 8 1 Y 1 A LYS 8 ? CG ? A LYS 11 CG 9 1 Y 1 A LYS 8 ? CD ? A LYS 11 CD 10 1 Y 1 A LYS 8 ? CE ? A LYS 11 CE 11 1 Y 1 A LYS 8 ? NZ ? A LYS 11 NZ 12 1 Y 1 A LYS 18 ? CG ? A LYS 21 CG 13 1 Y 1 A LYS 18 ? CD ? A LYS 21 CD 14 1 Y 1 A LYS 18 ? CE ? A LYS 21 CE 15 1 Y 1 A LYS 18 ? NZ ? A LYS 21 NZ 16 1 Y 1 A GLN 19 ? CG ? A GLN 22 CG 17 1 Y 1 A GLN 19 ? CD ? A GLN 22 CD 18 1 Y 1 A GLN 19 ? OE1 ? A GLN 22 OE1 19 1 Y 1 A GLN 19 ? NE2 ? A GLN 22 NE2 20 1 Y 1 A GLU 23 ? CG ? A GLU 26 CG 21 1 Y 1 A GLU 23 ? CD ? A GLU 26 CD 22 1 Y 1 A GLU 23 ? OE1 ? A GLU 26 OE1 23 1 Y 1 A GLU 23 ? OE2 ? A GLU 26 OE2 24 1 Y 1 A ARG 61 ? CG ? A ARG 64 CG 25 1 Y 1 A ARG 61 ? CD ? A ARG 64 CD 26 1 Y 1 A ARG 61 ? NE ? A ARG 64 NE 27 1 Y 1 A ARG 61 ? CZ ? A ARG 64 CZ 28 1 Y 1 A ARG 61 ? NH1 ? A ARG 64 NH1 29 1 Y 1 A ARG 61 ? NH2 ? A ARG 64 NH2 30 1 Y 1 A GLU 81 ? CG ? A GLU 84 CG 31 1 Y 1 A GLU 81 ? CD ? A GLU 84 CD 32 1 Y 1 A GLU 81 ? OE1 ? A GLU 84 OE1 33 1 Y 1 A GLU 81 ? OE2 ? A GLU 84 OE2 34 1 Y 1 A LYS 86 ? CG ? A LYS 89 CG 35 1 Y 1 A LYS 86 ? CD ? A LYS 89 CD 36 1 Y 1 A LYS 86 ? CE ? A LYS 89 CE 37 1 Y 1 A LYS 86 ? NZ ? A LYS 89 NZ 38 1 Y 1 A GLU 94 ? CG ? A GLU 97 CG 39 1 Y 1 A GLU 94 ? CD ? A GLU 97 CD 40 1 Y 1 A GLU 94 ? OE1 ? A GLU 97 OE1 41 1 Y 1 A GLU 94 ? OE2 ? A GLU 97 OE2 42 1 Y 1 A ASN 97 ? CG ? A ASN 100 CG 43 1 Y 1 A ASN 97 ? OD1 ? A ASN 100 OD1 44 1 Y 1 A ASN 97 ? ND2 ? A ASN 100 ND2 45 1 Y 1 A LYS 101 ? CG ? A LYS 104 CG 46 1 Y 1 A LYS 101 ? CD ? A LYS 104 CD 47 1 Y 1 A LYS 101 ? CE ? A LYS 104 CE 48 1 Y 1 A LYS 101 ? NZ ? A LYS 104 NZ 49 1 Y 1 A GLU 110 ? CG ? A GLU 113 CG 50 1 Y 1 A GLU 110 ? CD ? A GLU 113 CD 51 1 Y 1 A GLU 110 ? OE1 ? A GLU 113 OE1 52 1 Y 1 A GLU 110 ? OE2 ? A GLU 113 OE2 53 1 Y 1 A LYS 112 ? CG ? A LYS 115 CG 54 1 Y 1 A LYS 112 ? CD ? A LYS 115 CD 55 1 Y 1 A LYS 112 ? CE ? A LYS 115 CE 56 1 Y 1 A LYS 112 ? NZ ? A LYS 115 NZ 57 1 Y 1 A LYS 113 ? CG ? A LYS 116 CG 58 1 Y 1 A LYS 113 ? CD ? A LYS 116 CD 59 1 Y 1 A LYS 113 ? CE ? A LYS 116 CE 60 1 Y 1 A LYS 113 ? NZ ? A LYS 116 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? dev_1616 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? 7.1.0 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.2.8 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.5.6 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5TPJ _cell.details ? _cell.formula_units_Z ? _cell.length_a 49.810 _cell.length_a_esd ? _cell.length_b 49.810 _cell.length_b_esd ? _cell.length_c 113.110 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5TPJ _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5TPJ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.40 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.65 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M ammonium citrate dibasic and 30% PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-06-01 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 8.2.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 8.2.1 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5TPJ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.10 _reflns.d_resolution_low 56.56 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 2927 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.7 _reflns.pdbx_Rmerge_I_obs 0.072 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 21.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5TPJ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.101 _refine.ls_d_res_low 45.586 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 2881 _refine.ls_number_reflns_R_free 269 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.59 _refine.ls_percent_reflns_R_free 9.34 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2251 _refine.ls_R_factor_R_free 0.2648 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2209 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.87 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.27 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 970 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 1 _refine_hist.number_atoms_total 971 _refine_hist.d_res_high 3.101 _refine_hist.d_res_low 45.586 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 988 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.977 ? 1340 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 15.982 ? 359 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.038 ? 153 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 171 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.1008 3.9063 . . 138 1250 100.00 . . . 0.3090 . 0.2537 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.9063 45.5906 . . 131 1362 100.00 . . . 0.2416 . 0.2071 . . . . . . . . . . # _struct.entry_id 5TPJ _struct.title 'Crystal structure of a de novo designed protein with curved beta-sheet' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5TPJ _struct_keywords.text 'de novo NTF2, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 5TPJ _struct_ref.pdbx_db_accession 5TPJ _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5TPJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 125 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 5TPJ _struct_ref_seq.db_align_beg -2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 122 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -2 _struct_ref_seq.pdbx_auth_seq_align_end 122 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 5 ? LYS A 19 ? SER A 2 LYS A 16 1 ? 15 HELX_P HELX_P2 AA2 GLU A 26 ? LYS A 30 ? GLU A 23 LYS A 27 5 ? 5 HELX_P HELX_P3 AA3 GLY A 47 ? LYS A 60 ? GLY A 44 LYS A 57 1 ? 14 HELX_P HELX_P4 AA4 ASP A 111 ? LEU A 125 ? ASP A 108 LEU A 122 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 43 ? GLU A 46 ? TYR A 40 GLU A 43 AA1 2 LEU A 32 ? VAL A 40 ? LEU A 29 VAL A 37 AA1 3 LYS A 102 ? GLN A 109 ? LYS A 99 GLN A 106 AA1 4 LYS A 88 ? ARG A 99 ? LYS A 85 ARG A 96 AA1 5 HIS A 76 ? TRP A 85 ? HIS A 73 TRP A 82 AA1 6 ARG A 64 ? ASP A 73 ? ARG A 61 ASP A 70 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O PHE A 45 ? O PHE A 42 N LEU A 38 ? N LEU A 35 AA1 2 3 N GLU A 39 ? N GLU A 36 O LEU A 108 ? O LEU A 105 AA1 3 4 O ARG A 107 ? O ARG A 104 N GLU A 95 ? N GLU A 92 AA1 4 5 O VAL A 96 ? O VAL A 93 N VAL A 77 ? N VAL A 74 AA1 5 6 O ARG A 78 ? O ARG A 75 N GLN A 71 ? N GLN A 68 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 23 ? ? 75.46 -1.79 2 1 PRO A 109 ? ? -25.47 -48.97 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A SER -1 ? A SER 2 3 1 Y 1 A HIS 0 ? A HIS 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASN N N N N 28 ASN CA C N S 29 ASN C C N N 30 ASN O O N N 31 ASN CB C N N 32 ASN CG C N N 33 ASN OD1 O N N 34 ASN ND2 N N N 35 ASN OXT O N N 36 ASN H H N N 37 ASN H2 H N N 38 ASN HA H N N 39 ASN HB2 H N N 40 ASN HB3 H N N 41 ASN HD21 H N N 42 ASN HD22 H N N 43 ASN HXT H N N 44 ASP N N N N 45 ASP CA C N S 46 ASP C C N N 47 ASP O O N N 48 ASP CB C N N 49 ASP CG C N N 50 ASP OD1 O N N 51 ASP OD2 O N N 52 ASP OXT O N N 53 ASP H H N N 54 ASP H2 H N N 55 ASP HA H N N 56 ASP HB2 H N N 57 ASP HB3 H N N 58 ASP HD2 H N N 59 ASP HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLU N N N N 81 GLU CA C N S 82 GLU C C N N 83 GLU O O N N 84 GLU CB C N N 85 GLU CG C N N 86 GLU CD C N N 87 GLU OE1 O N N 88 GLU OE2 O N N 89 GLU OXT O N N 90 GLU H H N N 91 GLU H2 H N N 92 GLU HA H N N 93 GLU HB2 H N N 94 GLU HB3 H N N 95 GLU HG2 H N N 96 GLU HG3 H N N 97 GLU HE2 H N N 98 GLU HXT H N N 99 GLY N N N N 100 GLY CA C N N 101 GLY C C N N 102 GLY O O N N 103 GLY OXT O N N 104 GLY H H N N 105 GLY H2 H N N 106 GLY HA2 H N N 107 GLY HA3 H N N 108 GLY HXT H N N 109 HIS N N N N 110 HIS CA C N S 111 HIS C C N N 112 HIS O O N N 113 HIS CB C N N 114 HIS CG C Y N 115 HIS ND1 N Y N 116 HIS CD2 C Y N 117 HIS CE1 C Y N 118 HIS NE2 N Y N 119 HIS OXT O N N 120 HIS H H N N 121 HIS H2 H N N 122 HIS HA H N N 123 HIS HB2 H N N 124 HIS HB3 H N N 125 HIS HD1 H N N 126 HIS HD2 H N N 127 HIS HE1 H N N 128 HIS HE2 H N N 129 HIS HXT H N N 130 HOH O O N N 131 HOH H1 H N N 132 HOH H2 H N N 133 ILE N N N N 134 ILE CA C N S 135 ILE C C N N 136 ILE O O N N 137 ILE CB C N S 138 ILE CG1 C N N 139 ILE CG2 C N N 140 ILE CD1 C N N 141 ILE OXT O N N 142 ILE H H N N 143 ILE H2 H N N 144 ILE HA H N N 145 ILE HB H N N 146 ILE HG12 H N N 147 ILE HG13 H N N 148 ILE HG21 H N N 149 ILE HG22 H N N 150 ILE HG23 H N N 151 ILE HD11 H N N 152 ILE HD12 H N N 153 ILE HD13 H N N 154 ILE HXT H N N 155 LEU N N N N 156 LEU CA C N S 157 LEU C C N N 158 LEU O O N N 159 LEU CB C N N 160 LEU CG C N N 161 LEU CD1 C N N 162 LEU CD2 C N N 163 LEU OXT O N N 164 LEU H H N N 165 LEU H2 H N N 166 LEU HA H N N 167 LEU HB2 H N N 168 LEU HB3 H N N 169 LEU HG H N N 170 LEU HD11 H N N 171 LEU HD12 H N N 172 LEU HD13 H N N 173 LEU HD21 H N N 174 LEU HD22 H N N 175 LEU HD23 H N N 176 LEU HXT H N N 177 LYS N N N N 178 LYS CA C N S 179 LYS C C N N 180 LYS O O N N 181 LYS CB C N N 182 LYS CG C N N 183 LYS CD C N N 184 LYS CE C N N 185 LYS NZ N N N 186 LYS OXT O N N 187 LYS H H N N 188 LYS H2 H N N 189 LYS HA H N N 190 LYS HB2 H N N 191 LYS HB3 H N N 192 LYS HG2 H N N 193 LYS HG3 H N N 194 LYS HD2 H N N 195 LYS HD3 H N N 196 LYS HE2 H N N 197 LYS HE3 H N N 198 LYS HZ1 H N N 199 LYS HZ2 H N N 200 LYS HZ3 H N N 201 LYS HXT H N N 202 MET N N N N 203 MET CA C N S 204 MET C C N N 205 MET O O N N 206 MET CB C N N 207 MET CG C N N 208 MET SD S N N 209 MET CE C N N 210 MET OXT O N N 211 MET H H N N 212 MET H2 H N N 213 MET HA H N N 214 MET HB2 H N N 215 MET HB3 H N N 216 MET HG2 H N N 217 MET HG3 H N N 218 MET HE1 H N N 219 MET HE2 H N N 220 MET HE3 H N N 221 MET HXT H N N 222 PHE N N N N 223 PHE CA C N S 224 PHE C C N N 225 PHE O O N N 226 PHE CB C N N 227 PHE CG C Y N 228 PHE CD1 C Y N 229 PHE CD2 C Y N 230 PHE CE1 C Y N 231 PHE CE2 C Y N 232 PHE CZ C Y N 233 PHE OXT O N N 234 PHE H H N N 235 PHE H2 H N N 236 PHE HA H N N 237 PHE HB2 H N N 238 PHE HB3 H N N 239 PHE HD1 H N N 240 PHE HD2 H N N 241 PHE HE1 H N N 242 PHE HE2 H N N 243 PHE HZ H N N 244 PHE HXT H N N 245 PRO N N N N 246 PRO CA C N S 247 PRO C C N N 248 PRO O O N N 249 PRO CB C N N 250 PRO CG C N N 251 PRO CD C N N 252 PRO OXT O N N 253 PRO H H N N 254 PRO HA H N N 255 PRO HB2 H N N 256 PRO HB3 H N N 257 PRO HG2 H N N 258 PRO HG3 H N N 259 PRO HD2 H N N 260 PRO HD3 H N N 261 PRO HXT H N N 262 SER N N N N 263 SER CA C N S 264 SER C C N N 265 SER O O N N 266 SER CB C N N 267 SER OG O N N 268 SER OXT O N N 269 SER H H N N 270 SER H2 H N N 271 SER HA H N N 272 SER HB2 H N N 273 SER HB3 H N N 274 SER HG H N N 275 SER HXT H N N 276 THR N N N N 277 THR CA C N S 278 THR C C N N 279 THR O O N N 280 THR CB C N R 281 THR OG1 O N N 282 THR CG2 C N N 283 THR OXT O N N 284 THR H H N N 285 THR H2 H N N 286 THR HA H N N 287 THR HB H N N 288 THR HG1 H N N 289 THR HG21 H N N 290 THR HG22 H N N 291 THR HG23 H N N 292 THR HXT H N N 293 TRP N N N N 294 TRP CA C N S 295 TRP C C N N 296 TRP O O N N 297 TRP CB C N N 298 TRP CG C Y N 299 TRP CD1 C Y N 300 TRP CD2 C Y N 301 TRP NE1 N Y N 302 TRP CE2 C Y N 303 TRP CE3 C Y N 304 TRP CZ2 C Y N 305 TRP CZ3 C Y N 306 TRP CH2 C Y N 307 TRP OXT O N N 308 TRP H H N N 309 TRP H2 H N N 310 TRP HA H N N 311 TRP HB2 H N N 312 TRP HB3 H N N 313 TRP HD1 H N N 314 TRP HE1 H N N 315 TRP HE3 H N N 316 TRP HZ2 H N N 317 TRP HZ3 H N N 318 TRP HH2 H N N 319 TRP HXT H N N 320 TYR N N N N 321 TYR CA C N S 322 TYR C C N N 323 TYR O O N N 324 TYR CB C N N 325 TYR CG C Y N 326 TYR CD1 C Y N 327 TYR CD2 C Y N 328 TYR CE1 C Y N 329 TYR CE2 C Y N 330 TYR CZ C Y N 331 TYR OH O N N 332 TYR OXT O N N 333 TYR H H N N 334 TYR H2 H N N 335 TYR HA H N N 336 TYR HB2 H N N 337 TYR HB3 H N N 338 TYR HD1 H N N 339 TYR HD2 H N N 340 TYR HE1 H N N 341 TYR HE2 H N N 342 TYR HH H N N 343 TYR HXT H N N 344 VAL N N N N 345 VAL CA C N S 346 VAL C C N N 347 VAL O O N N 348 VAL CB C N N 349 VAL CG1 C N N 350 VAL CG2 C N N 351 VAL OXT O N N 352 VAL H H N N 353 VAL H2 H N N 354 VAL HA H N N 355 VAL HB H N N 356 VAL HG11 H N N 357 VAL HG12 H N N 358 VAL HG13 H N N 359 VAL HG21 H N N 360 VAL HG22 H N N 361 VAL HG23 H N N 362 VAL HXT H N N 363 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASN N CA sing N N 27 ASN N H sing N N 28 ASN N H2 sing N N 29 ASN CA C sing N N 30 ASN CA CB sing N N 31 ASN CA HA sing N N 32 ASN C O doub N N 33 ASN C OXT sing N N 34 ASN CB CG sing N N 35 ASN CB HB2 sing N N 36 ASN CB HB3 sing N N 37 ASN CG OD1 doub N N 38 ASN CG ND2 sing N N 39 ASN ND2 HD21 sing N N 40 ASN ND2 HD22 sing N N 41 ASN OXT HXT sing N N 42 ASP N CA sing N N 43 ASP N H sing N N 44 ASP N H2 sing N N 45 ASP CA C sing N N 46 ASP CA CB sing N N 47 ASP CA HA sing N N 48 ASP C O doub N N 49 ASP C OXT sing N N 50 ASP CB CG sing N N 51 ASP CB HB2 sing N N 52 ASP CB HB3 sing N N 53 ASP CG OD1 doub N N 54 ASP CG OD2 sing N N 55 ASP OD2 HD2 sing N N 56 ASP OXT HXT sing N N 57 GLN N CA sing N N 58 GLN N H sing N N 59 GLN N H2 sing N N 60 GLN CA C sing N N 61 GLN CA CB sing N N 62 GLN CA HA sing N N 63 GLN C O doub N N 64 GLN C OXT sing N N 65 GLN CB CG sing N N 66 GLN CB HB2 sing N N 67 GLN CB HB3 sing N N 68 GLN CG CD sing N N 69 GLN CG HG2 sing N N 70 GLN CG HG3 sing N N 71 GLN CD OE1 doub N N 72 GLN CD NE2 sing N N 73 GLN NE2 HE21 sing N N 74 GLN NE2 HE22 sing N N 75 GLN OXT HXT sing N N 76 GLU N CA sing N N 77 GLU N H sing N N 78 GLU N H2 sing N N 79 GLU CA C sing N N 80 GLU CA CB sing N N 81 GLU CA HA sing N N 82 GLU C O doub N N 83 GLU C OXT sing N N 84 GLU CB CG sing N N 85 GLU CB HB2 sing N N 86 GLU CB HB3 sing N N 87 GLU CG CD sing N N 88 GLU CG HG2 sing N N 89 GLU CG HG3 sing N N 90 GLU CD OE1 doub N N 91 GLU CD OE2 sing N N 92 GLU OE2 HE2 sing N N 93 GLU OXT HXT sing N N 94 GLY N CA sing N N 95 GLY N H sing N N 96 GLY N H2 sing N N 97 GLY CA C sing N N 98 GLY CA HA2 sing N N 99 GLY CA HA3 sing N N 100 GLY C O doub N N 101 GLY C OXT sing N N 102 GLY OXT HXT sing N N 103 HIS N CA sing N N 104 HIS N H sing N N 105 HIS N H2 sing N N 106 HIS CA C sing N N 107 HIS CA CB sing N N 108 HIS CA HA sing N N 109 HIS C O doub N N 110 HIS C OXT sing N N 111 HIS CB CG sing N N 112 HIS CB HB2 sing N N 113 HIS CB HB3 sing N N 114 HIS CG ND1 sing Y N 115 HIS CG CD2 doub Y N 116 HIS ND1 CE1 doub Y N 117 HIS ND1 HD1 sing N N 118 HIS CD2 NE2 sing Y N 119 HIS CD2 HD2 sing N N 120 HIS CE1 NE2 sing Y N 121 HIS CE1 HE1 sing N N 122 HIS NE2 HE2 sing N N 123 HIS OXT HXT sing N N 124 HOH O H1 sing N N 125 HOH O H2 sing N N 126 ILE N CA sing N N 127 ILE N H sing N N 128 ILE N H2 sing N N 129 ILE CA C sing N N 130 ILE CA CB sing N N 131 ILE CA HA sing N N 132 ILE C O doub N N 133 ILE C OXT sing N N 134 ILE CB CG1 sing N N 135 ILE CB CG2 sing N N 136 ILE CB HB sing N N 137 ILE CG1 CD1 sing N N 138 ILE CG1 HG12 sing N N 139 ILE CG1 HG13 sing N N 140 ILE CG2 HG21 sing N N 141 ILE CG2 HG22 sing N N 142 ILE CG2 HG23 sing N N 143 ILE CD1 HD11 sing N N 144 ILE CD1 HD12 sing N N 145 ILE CD1 HD13 sing N N 146 ILE OXT HXT sing N N 147 LEU N CA sing N N 148 LEU N H sing N N 149 LEU N H2 sing N N 150 LEU CA C sing N N 151 LEU CA CB sing N N 152 LEU CA HA sing N N 153 LEU C O doub N N 154 LEU C OXT sing N N 155 LEU CB CG sing N N 156 LEU CB HB2 sing N N 157 LEU CB HB3 sing N N 158 LEU CG CD1 sing N N 159 LEU CG CD2 sing N N 160 LEU CG HG sing N N 161 LEU CD1 HD11 sing N N 162 LEU CD1 HD12 sing N N 163 LEU CD1 HD13 sing N N 164 LEU CD2 HD21 sing N N 165 LEU CD2 HD22 sing N N 166 LEU CD2 HD23 sing N N 167 LEU OXT HXT sing N N 168 LYS N CA sing N N 169 LYS N H sing N N 170 LYS N H2 sing N N 171 LYS CA C sing N N 172 LYS CA CB sing N N 173 LYS CA HA sing N N 174 LYS C O doub N N 175 LYS C OXT sing N N 176 LYS CB CG sing N N 177 LYS CB HB2 sing N N 178 LYS CB HB3 sing N N 179 LYS CG CD sing N N 180 LYS CG HG2 sing N N 181 LYS CG HG3 sing N N 182 LYS CD CE sing N N 183 LYS CD HD2 sing N N 184 LYS CD HD3 sing N N 185 LYS CE NZ sing N N 186 LYS CE HE2 sing N N 187 LYS CE HE3 sing N N 188 LYS NZ HZ1 sing N N 189 LYS NZ HZ2 sing N N 190 LYS NZ HZ3 sing N N 191 LYS OXT HXT sing N N 192 MET N CA sing N N 193 MET N H sing N N 194 MET N H2 sing N N 195 MET CA C sing N N 196 MET CA CB sing N N 197 MET CA HA sing N N 198 MET C O doub N N 199 MET C OXT sing N N 200 MET CB CG sing N N 201 MET CB HB2 sing N N 202 MET CB HB3 sing N N 203 MET CG SD sing N N 204 MET CG HG2 sing N N 205 MET CG HG3 sing N N 206 MET SD CE sing N N 207 MET CE HE1 sing N N 208 MET CE HE2 sing N N 209 MET CE HE3 sing N N 210 MET OXT HXT sing N N 211 PHE N CA sing N N 212 PHE N H sing N N 213 PHE N H2 sing N N 214 PHE CA C sing N N 215 PHE CA CB sing N N 216 PHE CA HA sing N N 217 PHE C O doub N N 218 PHE C OXT sing N N 219 PHE CB CG sing N N 220 PHE CB HB2 sing N N 221 PHE CB HB3 sing N N 222 PHE CG CD1 doub Y N 223 PHE CG CD2 sing Y N 224 PHE CD1 CE1 sing Y N 225 PHE CD1 HD1 sing N N 226 PHE CD2 CE2 doub Y N 227 PHE CD2 HD2 sing N N 228 PHE CE1 CZ doub Y N 229 PHE CE1 HE1 sing N N 230 PHE CE2 CZ sing Y N 231 PHE CE2 HE2 sing N N 232 PHE CZ HZ sing N N 233 PHE OXT HXT sing N N 234 PRO N CA sing N N 235 PRO N CD sing N N 236 PRO N H sing N N 237 PRO CA C sing N N 238 PRO CA CB sing N N 239 PRO CA HA sing N N 240 PRO C O doub N N 241 PRO C OXT sing N N 242 PRO CB CG sing N N 243 PRO CB HB2 sing N N 244 PRO CB HB3 sing N N 245 PRO CG CD sing N N 246 PRO CG HG2 sing N N 247 PRO CG HG3 sing N N 248 PRO CD HD2 sing N N 249 PRO CD HD3 sing N N 250 PRO OXT HXT sing N N 251 SER N CA sing N N 252 SER N H sing N N 253 SER N H2 sing N N 254 SER CA C sing N N 255 SER CA CB sing N N 256 SER CA HA sing N N 257 SER C O doub N N 258 SER C OXT sing N N 259 SER CB OG sing N N 260 SER CB HB2 sing N N 261 SER CB HB3 sing N N 262 SER OG HG sing N N 263 SER OXT HXT sing N N 264 THR N CA sing N N 265 THR N H sing N N 266 THR N H2 sing N N 267 THR CA C sing N N 268 THR CA CB sing N N 269 THR CA HA sing N N 270 THR C O doub N N 271 THR C OXT sing N N 272 THR CB OG1 sing N N 273 THR CB CG2 sing N N 274 THR CB HB sing N N 275 THR OG1 HG1 sing N N 276 THR CG2 HG21 sing N N 277 THR CG2 HG22 sing N N 278 THR CG2 HG23 sing N N 279 THR OXT HXT sing N N 280 TRP N CA sing N N 281 TRP N H sing N N 282 TRP N H2 sing N N 283 TRP CA C sing N N 284 TRP CA CB sing N N 285 TRP CA HA sing N N 286 TRP C O doub N N 287 TRP C OXT sing N N 288 TRP CB CG sing N N 289 TRP CB HB2 sing N N 290 TRP CB HB3 sing N N 291 TRP CG CD1 doub Y N 292 TRP CG CD2 sing Y N 293 TRP CD1 NE1 sing Y N 294 TRP CD1 HD1 sing N N 295 TRP CD2 CE2 doub Y N 296 TRP CD2 CE3 sing Y N 297 TRP NE1 CE2 sing Y N 298 TRP NE1 HE1 sing N N 299 TRP CE2 CZ2 sing Y N 300 TRP CE3 CZ3 doub Y N 301 TRP CE3 HE3 sing N N 302 TRP CZ2 CH2 doub Y N 303 TRP CZ2 HZ2 sing N N 304 TRP CZ3 CH2 sing Y N 305 TRP CZ3 HZ3 sing N N 306 TRP CH2 HH2 sing N N 307 TRP OXT HXT sing N N 308 TYR N CA sing N N 309 TYR N H sing N N 310 TYR N H2 sing N N 311 TYR CA C sing N N 312 TYR CA CB sing N N 313 TYR CA HA sing N N 314 TYR C O doub N N 315 TYR C OXT sing N N 316 TYR CB CG sing N N 317 TYR CB HB2 sing N N 318 TYR CB HB3 sing N N 319 TYR CG CD1 doub Y N 320 TYR CG CD2 sing Y N 321 TYR CD1 CE1 sing Y N 322 TYR CD1 HD1 sing N N 323 TYR CD2 CE2 doub Y N 324 TYR CD2 HD2 sing N N 325 TYR CE1 CZ doub Y N 326 TYR CE1 HE1 sing N N 327 TYR CE2 CZ sing Y N 328 TYR CE2 HE2 sing N N 329 TYR CZ OH sing N N 330 TYR OH HH sing N N 331 TYR OXT HXT sing N N 332 VAL N CA sing N N 333 VAL N H sing N N 334 VAL N H2 sing N N 335 VAL CA C sing N N 336 VAL CA CB sing N N 337 VAL CA HA sing N N 338 VAL C O doub N N 339 VAL C OXT sing N N 340 VAL CB CG1 sing N N 341 VAL CB CG2 sing N N 342 VAL CB HB sing N N 343 VAL CG1 HG11 sing N N 344 VAL CG1 HG12 sing N N 345 VAL CG1 HG13 sing N N 346 VAL CG2 HG21 sing N N 347 VAL CG2 HG22 sing N N 348 VAL CG2 HG23 sing N N 349 VAL OXT HXT sing N N 350 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Defense Threat Reduction Agency (DTRA)' 'United States' 'HDTRA 1-11-1-0041' 1 'European Commission' Spain 'FP7-PEOPLE-2011-IOF 298976' 2 'European Commission' Austria '332094 ASR-CompEnzDes FP7-PEOPLE-2012-IOF' 3 'Department of Energy (DOE, United States)' 'United States' DE-AC02-05CH11231 4 # _atom_sites.entry_id 5TPJ _atom_sites.fract_transf_matrix[1][1] 0.020076 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020076 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008841 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_