data_5TPK # _entry.id 5TPK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5TPK pdb_00005tpk 10.2210/pdb5tpk/pdb WWPDB D_1000224594 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5TPK _pdbx_database_status.recvd_initial_deposition_date 2016-10-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chen, C.' 1 'Sotomayor, M.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structural determinants of protocadherin-15 mechanics and function in hearing and balance perception.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1920444117 _citation.pdbx_database_id_PubMed 32963095 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Choudhary, D.' 1 0000-0002-2912-1610 primary 'Narui, Y.' 2 0000-0002-1136-282X primary 'Neel, B.L.' 3 0000-0001-5983-9335 primary 'Wimalasena, L.N.' 4 0000-0002-8611-0192 primary 'Klanseck, C.F.' 5 0000-0001-5277-1315 primary 'De-la-Torre, P.' 6 0000-0002-2434-3345 primary 'Chen, C.' 7 0000-0001-5305-1707 primary 'Araya-Secchi, R.' 8 0000-0002-4872-3553 primary 'Tamilselvan, E.' 9 0000-0003-2347-6805 primary 'Sotomayor, M.' 10 0000-0002-3333-1805 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 97.27 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5TPK _cell.details ? _cell.formula_units_Z ? _cell.length_a 135.796 _cell.length_a_esd ? _cell.length_b 22.990 _cell.length_b_esd ? _cell.length_c 70.741 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5TPK _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Protocadherin-15 24239.008 1 ? V875A 'Extracellular domain residues 715-924' ? 2 non-polymer syn 'CALCIUM ION' 40.078 4 ? ? ? ? 3 water nat water 18.015 121 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVNDNAPVFDPYLPRNLSVVEEEANAFVGQVRATDPDAGINGQVHYSLGNFNNLFRITSNGSIYTAVKLNREARDHYELV VVATDGAVHPRHSTLTLYIKVLDIDDNSPVFTNSTYTVVVEENLPAGTSFLQIEAKDVDLGANVSYRIRSPEVKHLFALH PFTGELSLLRSLDYEAFPDQEASITFLAEAFDIYGTMPPGIATVTVIVKDLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MVNDNAPVFDPYLPRNLSVVEEEANAFVGQVRATDPDAGINGQVHYSLGNFNNLFRITSNGSIYTAVKLNREARDHYELV VVATDGAVHPRHSTLTLYIKVLDIDDNSPVFTNSTYTVVVEENLPAGTSFLQIEAKDVDLGANVSYRIRSPEVKHLFALH PFTGELSLLRSLDYEAFPDQEASITFLAEAFDIYGTMPPGIATVTVIVKDLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 ASN n 1 4 ASP n 1 5 ASN n 1 6 ALA n 1 7 PRO n 1 8 VAL n 1 9 PHE n 1 10 ASP n 1 11 PRO n 1 12 TYR n 1 13 LEU n 1 14 PRO n 1 15 ARG n 1 16 ASN n 1 17 LEU n 1 18 SER n 1 19 VAL n 1 20 VAL n 1 21 GLU n 1 22 GLU n 1 23 GLU n 1 24 ALA n 1 25 ASN n 1 26 ALA n 1 27 PHE n 1 28 VAL n 1 29 GLY n 1 30 GLN n 1 31 VAL n 1 32 ARG n 1 33 ALA n 1 34 THR n 1 35 ASP n 1 36 PRO n 1 37 ASP n 1 38 ALA n 1 39 GLY n 1 40 ILE n 1 41 ASN n 1 42 GLY n 1 43 GLN n 1 44 VAL n 1 45 HIS n 1 46 TYR n 1 47 SER n 1 48 LEU n 1 49 GLY n 1 50 ASN n 1 51 PHE n 1 52 ASN n 1 53 ASN n 1 54 LEU n 1 55 PHE n 1 56 ARG n 1 57 ILE n 1 58 THR n 1 59 SER n 1 60 ASN n 1 61 GLY n 1 62 SER n 1 63 ILE n 1 64 TYR n 1 65 THR n 1 66 ALA n 1 67 VAL n 1 68 LYS n 1 69 LEU n 1 70 ASN n 1 71 ARG n 1 72 GLU n 1 73 ALA n 1 74 ARG n 1 75 ASP n 1 76 HIS n 1 77 TYR n 1 78 GLU n 1 79 LEU n 1 80 VAL n 1 81 VAL n 1 82 VAL n 1 83 ALA n 1 84 THR n 1 85 ASP n 1 86 GLY n 1 87 ALA n 1 88 VAL n 1 89 HIS n 1 90 PRO n 1 91 ARG n 1 92 HIS n 1 93 SER n 1 94 THR n 1 95 LEU n 1 96 THR n 1 97 LEU n 1 98 TYR n 1 99 ILE n 1 100 LYS n 1 101 VAL n 1 102 LEU n 1 103 ASP n 1 104 ILE n 1 105 ASP n 1 106 ASP n 1 107 ASN n 1 108 SER n 1 109 PRO n 1 110 VAL n 1 111 PHE n 1 112 THR n 1 113 ASN n 1 114 SER n 1 115 THR n 1 116 TYR n 1 117 THR n 1 118 VAL n 1 119 VAL n 1 120 VAL n 1 121 GLU n 1 122 GLU n 1 123 ASN n 1 124 LEU n 1 125 PRO n 1 126 ALA n 1 127 GLY n 1 128 THR n 1 129 SER n 1 130 PHE n 1 131 LEU n 1 132 GLN n 1 133 ILE n 1 134 GLU n 1 135 ALA n 1 136 LYS n 1 137 ASP n 1 138 VAL n 1 139 ASP n 1 140 LEU n 1 141 GLY n 1 142 ALA n 1 143 ASN n 1 144 VAL n 1 145 SER n 1 146 TYR n 1 147 ARG n 1 148 ILE n 1 149 ARG n 1 150 SER n 1 151 PRO n 1 152 GLU n 1 153 VAL n 1 154 LYS n 1 155 HIS n 1 156 LEU n 1 157 PHE n 1 158 ALA n 1 159 LEU n 1 160 HIS n 1 161 PRO n 1 162 PHE n 1 163 THR n 1 164 GLY n 1 165 GLU n 1 166 LEU n 1 167 SER n 1 168 LEU n 1 169 LEU n 1 170 ARG n 1 171 SER n 1 172 LEU n 1 173 ASP n 1 174 TYR n 1 175 GLU n 1 176 ALA n 1 177 PHE n 1 178 PRO n 1 179 ASP n 1 180 GLN n 1 181 GLU n 1 182 ALA n 1 183 SER n 1 184 ILE n 1 185 THR n 1 186 PHE n 1 187 LEU n 1 188 ALA n 1 189 GLU n 1 190 ALA n 1 191 PHE n 1 192 ASP n 1 193 ILE n 1 194 TYR n 1 195 GLY n 1 196 THR n 1 197 MET n 1 198 PRO n 1 199 PRO n 1 200 GLY n 1 201 ILE n 1 202 ALA n 1 203 THR n 1 204 VAL n 1 205 THR n 1 206 VAL n 1 207 ILE n 1 208 VAL n 1 209 LYS n 1 210 ASP n 1 211 LEU n 1 212 GLU n 1 213 HIS n 1 214 HIS n 1 215 HIS n 1 216 HIS n 1 217 HIS n 1 218 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 218 _entity_src_gen.gene_src_common_name Mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Pcdh15 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-21a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PCD15_MOUSE _struct_ref.pdbx_db_accession Q99PJ1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VNDNAPVFDPYLPRNLSVVEEEANAFVGQVRATDPDAGINGQVHYSLGNFNNLFRITSNGSIYTAVKLNREARDHYELVV VATDGAVHPRHSTLTLYIKVLDIDDNSPVFTNSTYTVVVEENLPAGTSFLQIEAKDVDLGANVSYRIRSPEVKHLFALHP FTGELSLLRSLDYEAFPDQEASITFLVEAFDIYGTMPPGIATVTVIVKD ; _struct_ref.pdbx_align_begin 715 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5TPK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 210 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q99PJ1 _struct_ref_seq.db_align_beg 715 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 923 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 689 _struct_ref_seq.pdbx_auth_seq_align_end 897 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5TPK MET A 1 ? UNP Q99PJ1 ? ? 'initiating methionine' 688 1 1 5TPK ALA A 188 ? UNP Q99PJ1 VAL 901 'engineered mutation' 875 2 1 5TPK LEU A 211 ? UNP Q99PJ1 ? ? 'expression tag' 898 3 1 5TPK GLU A 212 ? UNP Q99PJ1 ? ? 'expression tag' 899 4 1 5TPK HIS A 213 ? UNP Q99PJ1 ? ? 'expression tag' 900 5 1 5TPK HIS A 214 ? UNP Q99PJ1 ? ? 'expression tag' 901 6 1 5TPK HIS A 215 ? UNP Q99PJ1 ? ? 'expression tag' 902 7 1 5TPK HIS A 216 ? UNP Q99PJ1 ? ? 'expression tag' 903 8 1 5TPK HIS A 217 ? UNP Q99PJ1 ? ? 'expression tag' 904 9 1 5TPK HIS A 218 ? UNP Q99PJ1 ? ? 'expression tag' 905 10 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5TPK _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.26 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.56 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2M AMMONIUM CHLORIDE, 10% PEG3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details 'Oxford Cryo-Jet crystal cryocoolers' _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-03-22 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97920 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97920 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-C _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 33 _reflns.entry_id 5TPK _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.00 _reflns.d_resolution_low 70.17 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15280 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.1 _reflns.pdbx_Rmerge_I_obs 0.045 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23.12 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.00 _reflns_shell.d_res_low 2.03 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 5.4 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 82.1 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.141 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.4 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -1.95 _refine.aniso_B[1][2] -0.00 _refine.aniso_B[1][3] -1.37 _refine.aniso_B[2][2] 0.09 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] 2.13 _refine.B_iso_max ? _refine.B_iso_mean 40.260 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.957 _refine.correlation_coeff_Fo_to_Fc_free 0.938 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5TPK _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.00 _refine.ls_d_res_low 70.17 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14026 _refine.ls_number_reflns_R_free 711 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.36 _refine.ls_percent_reflns_R_free 4.8 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.19177 _refine.ls_R_factor_R_free 0.22897 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.18995 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4XHZ _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.191 _refine.pdbx_overall_ESU_R_Free 0.165 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 7.663 _refine.overall_SU_ML 0.112 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 1572 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 4 _refine_hist.number_atoms_solvent 121 _refine_hist.number_atoms_total 1697 _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 70.17 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 0.019 1624 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 1518 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.315 1.949 2223 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.880 3.000 3483 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.359 5.000 204 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 33.743 24.304 79 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 12.302 15.000 245 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 20.062 15.000 9 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.078 0.200 260 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 0.021 1866 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 379 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 0.916 2.529 810 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 0.917 2.527 809 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 1.603 3.777 1010 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 1.602 3.778 1011 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 0.848 2.669 814 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 0.848 2.667 812 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 1.433 3.963 1211 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 5.006 30.406 1705 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 4.903 29.966 1682 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.000 _refine_ls_shell.d_res_low 2.052 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 48 _refine_ls_shell.number_reflns_R_work 877 _refine_ls_shell.percent_reflns_obs 81.93 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.275 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.211 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5TPK _struct.title 'Crystal Structure of Mouse Protocadherin-15 EC7-8 V875A' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5TPK _struct_keywords.text 'hearing, mechanotransduction, adhesion, calcium-binding protein, CELL ADHESION' _struct_keywords.pdbx_keywords 'CELL ADHESION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 3 ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 150 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 154 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 837 _struct_conf.end_auth_comp_id LYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 841 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASN 3 OD1 ? ? ? 1_555 E CA . CA ? ? A ASN 690 A CA 1004 1_555 ? ? ? ? ? ? ? 2.360 ? ? metalc2 metalc ? ? A ASN 5 O ? ? ? 1_555 E CA . CA ? ? A ASN 692 A CA 1004 1_555 ? ? ? ? ? ? ? 2.344 ? ? metalc3 metalc ? ? A GLU 21 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 708 A CA 1001 1_555 ? ? ? ? ? ? ? 2.365 ? ? metalc4 metalc ? ? A GLU 21 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 708 A CA 1002 1_555 ? ? ? ? ? ? ? 2.323 ? ? metalc5 metalc ? ? A GLU 22 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 709 A CA 1001 1_555 ? ? ? ? ? ? ? 2.475 ? ? metalc6 metalc ? ? A ASP 35 OD1 ? ? ? 1_555 E CA . CA ? ? A ASP 722 A CA 1004 1_555 ? ? ? ? ? ? ? 2.575 ? ? metalc7 metalc ? ? A ASP 35 OD2 ? ? ? 1_555 E CA . CA ? ? A ASP 722 A CA 1004 1_555 ? ? ? ? ? ? ? 2.869 ? ? metalc8 metalc ? ? A ASP 37 OD2 ? ? ? 1_555 E CA . CA ? ? A ASP 724 A CA 1004 1_555 ? ? ? ? ? ? ? 2.576 ? ? metalc9 metalc ? ? A ASN 41 O ? ? ? 1_555 E CA . CA ? ? A ASN 728 A CA 1004 1_555 ? ? ? ? ? ? ? 2.501 ? ? metalc10 metalc ? ? A ASN 70 OD1 ? ? ? 1_555 B CA . CA ? ? A ASN 757 A CA 1001 1_555 ? ? ? ? ? ? ? 2.315 ? ? metalc11 metalc ? ? A GLU 72 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 759 A CA 1001 1_555 ? ? ? ? ? ? ? 2.328 ? ? metalc12 metalc ? ? A GLU 72 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 759 A CA 1002 1_555 ? ? ? ? ? ? ? 2.793 ? ? metalc13 metalc ? ? A GLU 72 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 759 A CA 1002 1_555 ? ? ? ? ? ? ? 2.449 ? ? metalc14 metalc ? ? A ASP 85 OD2 ? ? ? 1_555 E CA . CA ? ? A ASP 772 A CA 1004 1_555 ? ? ? ? ? ? ? 2.801 ? ? metalc15 metalc ? ? A ASP 103 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 790 A CA 1002 1_555 ? ? ? ? ? ? ? 2.462 ? ? metalc16 metalc ? ? A ILE 104 O ? ? ? 1_555 C CA . CA ? ? A ILE 791 A CA 1002 1_555 ? ? ? ? ? ? ? 2.349 ? ? metalc17 metalc ? ? A ASP 105 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 792 A CA 1003 1_555 ? ? ? ? ? ? ? 2.328 ? ? metalc18 metalc ? ? A ASP 106 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 793 A CA 1001 1_555 ? ? ? ? ? ? ? 2.405 ? ? metalc19 metalc ? ? A ASP 106 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 793 A CA 1002 1_555 ? ? ? ? ? ? ? 2.405 ? ? metalc20 metalc ? ? A ASN 107 O ? ? ? 1_555 D CA . CA ? ? A ASN 794 A CA 1003 1_555 ? ? ? ? ? ? ? 2.232 ? ? metalc21 metalc ? ? A ASP 137 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 824 A CA 1003 1_555 ? ? ? ? ? ? ? 2.546 ? ? metalc22 metalc ? ? A ASP 137 OD2 ? ? ? 1_555 D CA . CA ? ? A ASP 824 A CA 1003 1_555 ? ? ? ? ? ? ? 2.464 ? ? metalc23 metalc ? ? A ASP 139 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 826 A CA 1002 1_555 ? ? ? ? ? ? ? 2.289 ? ? metalc24 metalc ? ? A ASP 139 OD2 ? ? ? 1_555 D CA . CA ? ? A ASP 826 A CA 1003 1_555 ? ? ? ? ? ? ? 2.357 ? ? metalc25 metalc ? ? B CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 1001 A HOH 1194 1_555 ? ? ? ? ? ? ? 2.353 ? ? metalc26 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 1003 A HOH 1101 1_555 ? ? ? ? ? ? ? 2.079 ? ? metalc27 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 1003 A HOH 1163 1_555 ? ? ? ? ? ? ? 2.434 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 4 ? AA3 ? 3 ? AA4 ? 2 ? AA5 ? 4 ? AA6 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA4 1 2 ? anti-parallel AA5 1 2 ? parallel AA5 2 3 ? anti-parallel AA5 3 4 ? anti-parallel AA6 1 2 ? anti-parallel AA6 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 8 ? PHE A 9 ? VAL A 695 PHE A 696 AA1 2 ALA A 33 ? THR A 34 ? ALA A 720 THR A 721 AA2 1 ASN A 16 ? VAL A 20 ? ASN A 703 VAL A 707 AA2 2 HIS A 92 ? LEU A 102 ? HIS A 779 LEU A 789 AA2 3 HIS A 76 ? ASP A 85 ? HIS A 763 ASP A 772 AA2 4 VAL A 44 ? LEU A 48 ? VAL A 731 LEU A 735 AA3 1 PHE A 27 ? GLN A 30 ? PHE A 714 GLN A 717 AA3 2 SER A 62 ? THR A 65 ? SER A 749 THR A 752 AA3 3 PHE A 55 ? ILE A 57 ? PHE A 742 ILE A 744 AA4 1 VAL A 110 ? PHE A 111 ? VAL A 797 PHE A 798 AA4 2 ALA A 135 ? LYS A 136 ? ALA A 822 LYS A 823 AA5 1 THR A 115 ? GLU A 121 ? THR A 802 GLU A 808 AA5 2 GLY A 200 ? LYS A 209 ? GLY A 887 LYS A 896 AA5 3 SER A 183 ? ASP A 192 ? SER A 870 ASP A 879 AA5 4 VAL A 144 ? ILE A 148 ? VAL A 831 ILE A 835 AA6 1 SER A 129 ? GLN A 132 ? SER A 816 GLN A 819 AA6 2 GLU A 165 ? LEU A 168 ? GLU A 852 LEU A 855 AA6 3 PHE A 157 ? LEU A 159 ? PHE A 844 LEU A 846 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 8 ? N VAL A 695 O THR A 34 ? O THR A 721 AA2 1 2 N VAL A 19 ? N VAL A 706 O LEU A 102 ? O LEU A 789 AA2 2 3 O ILE A 99 ? O ILE A 786 N TYR A 77 ? N TYR A 764 AA2 3 4 O THR A 84 ? O THR A 771 N HIS A 45 ? N HIS A 732 AA3 1 2 N GLY A 29 ? N GLY A 716 O ILE A 63 ? O ILE A 750 AA3 2 3 O TYR A 64 ? O TYR A 751 N ARG A 56 ? N ARG A 743 AA4 1 2 N VAL A 110 ? N VAL A 797 O LYS A 136 ? O LYS A 823 AA5 1 2 N VAL A 120 ? N VAL A 807 O LYS A 209 ? O LYS A 896 AA5 2 3 O VAL A 204 ? O VAL A 891 N PHE A 186 ? N PHE A 873 AA5 3 4 O GLU A 189 ? O GLU A 876 N ARG A 147 ? N ARG A 834 AA6 1 2 N LEU A 131 ? N LEU A 818 O LEU A 166 ? O LEU A 853 AA6 2 3 O SER A 167 ? O SER A 854 N ALA A 158 ? N ALA A 845 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 1001 ? 6 'binding site for residue CA A 1001' AC2 Software A CA 1002 ? 6 'binding site for residue CA A 1002' AC3 Software A CA 1003 ? 6 'binding site for residue CA A 1003' AC4 Software A CA 1004 ? 6 'binding site for residue CA A 1004' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 GLU A 21 ? GLU A 708 . ? 1_555 ? 2 AC1 6 GLU A 22 ? GLU A 709 . ? 1_555 ? 3 AC1 6 ASN A 70 ? ASN A 757 . ? 1_555 ? 4 AC1 6 GLU A 72 ? GLU A 759 . ? 1_555 ? 5 AC1 6 ASP A 106 ? ASP A 793 . ? 1_555 ? 6 AC1 6 HOH F . ? HOH A 1194 . ? 1_555 ? 7 AC2 6 GLU A 21 ? GLU A 708 . ? 1_555 ? 8 AC2 6 GLU A 72 ? GLU A 759 . ? 1_555 ? 9 AC2 6 ASP A 103 ? ASP A 790 . ? 1_555 ? 10 AC2 6 ILE A 104 ? ILE A 791 . ? 1_555 ? 11 AC2 6 ASP A 106 ? ASP A 793 . ? 1_555 ? 12 AC2 6 ASP A 139 ? ASP A 826 . ? 1_555 ? 13 AC3 6 ASP A 105 ? ASP A 792 . ? 1_555 ? 14 AC3 6 ASN A 107 ? ASN A 794 . ? 1_555 ? 15 AC3 6 ASP A 137 ? ASP A 824 . ? 1_555 ? 16 AC3 6 ASP A 139 ? ASP A 826 . ? 1_555 ? 17 AC3 6 HOH F . ? HOH A 1101 . ? 1_555 ? 18 AC3 6 HOH F . ? HOH A 1163 . ? 1_555 ? 19 AC4 6 ASN A 3 ? ASN A 690 . ? 1_555 ? 20 AC4 6 ASN A 5 ? ASN A 692 . ? 1_555 ? 21 AC4 6 ASP A 35 ? ASP A 722 . ? 1_555 ? 22 AC4 6 ASP A 37 ? ASP A 724 . ? 1_555 ? 23 AC4 6 ASN A 41 ? ASN A 728 . ? 1_555 ? 24 AC4 6 ASP A 85 ? ASP A 772 . ? 1_555 ? # _atom_sites.entry_id 5TPK _atom_sites.fract_transf_matrix[1][1] 0.007364 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000939 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.043497 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014251 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O S # loop_ # loop_ # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 688 ? ? ? A . n A 1 2 VAL 2 689 ? ? ? A . n A 1 3 ASN 3 690 690 ASN ASN A . n A 1 4 ASP 4 691 691 ASP ASP A . n A 1 5 ASN 5 692 692 ASN ASN A . n A 1 6 ALA 6 693 693 ALA ALA A . n A 1 7 PRO 7 694 694 PRO PRO A . n A 1 8 VAL 8 695 695 VAL VAL A . n A 1 9 PHE 9 696 696 PHE PHE A . n A 1 10 ASP 10 697 697 ASP ASP A . n A 1 11 PRO 11 698 698 PRO PRO A . n A 1 12 TYR 12 699 699 TYR TYR A . n A 1 13 LEU 13 700 700 LEU LEU A . n A 1 14 PRO 14 701 701 PRO PRO A . n A 1 15 ARG 15 702 702 ARG ARG A . n A 1 16 ASN 16 703 703 ASN ASN A . n A 1 17 LEU 17 704 704 LEU LEU A . n A 1 18 SER 18 705 705 SER SER A . n A 1 19 VAL 19 706 706 VAL VAL A . n A 1 20 VAL 20 707 707 VAL VAL A . n A 1 21 GLU 21 708 708 GLU GLU A . n A 1 22 GLU 22 709 709 GLU GLU A . n A 1 23 GLU 23 710 710 GLU GLU A . n A 1 24 ALA 24 711 711 ALA ALA A . n A 1 25 ASN 25 712 712 ASN ASN A . n A 1 26 ALA 26 713 713 ALA ALA A . n A 1 27 PHE 27 714 714 PHE PHE A . n A 1 28 VAL 28 715 715 VAL VAL A . n A 1 29 GLY 29 716 716 GLY GLY A . n A 1 30 GLN 30 717 717 GLN GLN A . n A 1 31 VAL 31 718 718 VAL VAL A . n A 1 32 ARG 32 719 719 ARG ARG A . n A 1 33 ALA 33 720 720 ALA ALA A . n A 1 34 THR 34 721 721 THR THR A . n A 1 35 ASP 35 722 722 ASP ASP A . n A 1 36 PRO 36 723 723 PRO PRO A . n A 1 37 ASP 37 724 724 ASP ASP A . n A 1 38 ALA 38 725 725 ALA ALA A . n A 1 39 GLY 39 726 726 GLY GLY A . n A 1 40 ILE 40 727 727 ILE ILE A . n A 1 41 ASN 41 728 728 ASN ASN A . n A 1 42 GLY 42 729 729 GLY GLY A . n A 1 43 GLN 43 730 730 GLN GLN A . n A 1 44 VAL 44 731 731 VAL VAL A . n A 1 45 HIS 45 732 732 HIS HIS A . n A 1 46 TYR 46 733 733 TYR TYR A . n A 1 47 SER 47 734 734 SER SER A . n A 1 48 LEU 48 735 735 LEU LEU A . n A 1 49 GLY 49 736 736 GLY GLY A . n A 1 50 ASN 50 737 737 ASN ASN A . n A 1 51 PHE 51 738 738 PHE PHE A . n A 1 52 ASN 52 739 739 ASN ASN A . n A 1 53 ASN 53 740 740 ASN ASN A . n A 1 54 LEU 54 741 741 LEU LEU A . n A 1 55 PHE 55 742 742 PHE PHE A . n A 1 56 ARG 56 743 743 ARG ARG A . n A 1 57 ILE 57 744 744 ILE ILE A . n A 1 58 THR 58 745 745 THR THR A . n A 1 59 SER 59 746 746 SER SER A . n A 1 60 ASN 60 747 747 ASN ASN A . n A 1 61 GLY 61 748 748 GLY GLY A . n A 1 62 SER 62 749 749 SER SER A . n A 1 63 ILE 63 750 750 ILE ILE A . n A 1 64 TYR 64 751 751 TYR TYR A . n A 1 65 THR 65 752 752 THR THR A . n A 1 66 ALA 66 753 753 ALA ALA A . n A 1 67 VAL 67 754 754 VAL VAL A . n A 1 68 LYS 68 755 755 LYS LYS A . n A 1 69 LEU 69 756 756 LEU LEU A . n A 1 70 ASN 70 757 757 ASN ASN A . n A 1 71 ARG 71 758 758 ARG ARG A . n A 1 72 GLU 72 759 759 GLU GLU A . n A 1 73 ALA 73 760 760 ALA ALA A . n A 1 74 ARG 74 761 761 ARG ARG A . n A 1 75 ASP 75 762 762 ASP ASP A . n A 1 76 HIS 76 763 763 HIS HIS A . n A 1 77 TYR 77 764 764 TYR TYR A . n A 1 78 GLU 78 765 765 GLU GLU A . n A 1 79 LEU 79 766 766 LEU LEU A . n A 1 80 VAL 80 767 767 VAL VAL A . n A 1 81 VAL 81 768 768 VAL VAL A . n A 1 82 VAL 82 769 769 VAL VAL A . n A 1 83 ALA 83 770 770 ALA ALA A . n A 1 84 THR 84 771 771 THR THR A . n A 1 85 ASP 85 772 772 ASP ASP A . n A 1 86 GLY 86 773 773 GLY GLY A . n A 1 87 ALA 87 774 774 ALA ALA A . n A 1 88 VAL 88 775 775 VAL VAL A . n A 1 89 HIS 89 776 776 HIS HIS A . n A 1 90 PRO 90 777 777 PRO PRO A . n A 1 91 ARG 91 778 778 ARG ARG A . n A 1 92 HIS 92 779 779 HIS HIS A . n A 1 93 SER 93 780 780 SER SER A . n A 1 94 THR 94 781 781 THR THR A . n A 1 95 LEU 95 782 782 LEU LEU A . n A 1 96 THR 96 783 783 THR THR A . n A 1 97 LEU 97 784 784 LEU LEU A . n A 1 98 TYR 98 785 785 TYR TYR A . n A 1 99 ILE 99 786 786 ILE ILE A . n A 1 100 LYS 100 787 787 LYS LYS A . n A 1 101 VAL 101 788 788 VAL VAL A . n A 1 102 LEU 102 789 789 LEU LEU A . n A 1 103 ASP 103 790 790 ASP ASP A . n A 1 104 ILE 104 791 791 ILE ILE A . n A 1 105 ASP 105 792 792 ASP ASP A . n A 1 106 ASP 106 793 793 ASP ASP A . n A 1 107 ASN 107 794 794 ASN ASN A . n A 1 108 SER 108 795 795 SER SER A . n A 1 109 PRO 109 796 796 PRO PRO A . n A 1 110 VAL 110 797 797 VAL VAL A . n A 1 111 PHE 111 798 798 PHE PHE A . n A 1 112 THR 112 799 799 THR THR A . n A 1 113 ASN 113 800 800 ASN ASN A . n A 1 114 SER 114 801 801 SER SER A . n A 1 115 THR 115 802 802 THR THR A . n A 1 116 TYR 116 803 803 TYR TYR A . n A 1 117 THR 117 804 804 THR THR A . n A 1 118 VAL 118 805 805 VAL VAL A . n A 1 119 VAL 119 806 806 VAL VAL A . n A 1 120 VAL 120 807 807 VAL VAL A . n A 1 121 GLU 121 808 808 GLU GLU A . n A 1 122 GLU 122 809 809 GLU GLU A . n A 1 123 ASN 123 810 810 ASN ASN A . n A 1 124 LEU 124 811 811 LEU LEU A . n A 1 125 PRO 125 812 812 PRO PRO A . n A 1 126 ALA 126 813 813 ALA ALA A . n A 1 127 GLY 127 814 814 GLY GLY A . n A 1 128 THR 128 815 815 THR THR A . n A 1 129 SER 129 816 816 SER SER A . n A 1 130 PHE 130 817 817 PHE PHE A . n A 1 131 LEU 131 818 818 LEU LEU A . n A 1 132 GLN 132 819 819 GLN GLN A . n A 1 133 ILE 133 820 820 ILE ILE A . n A 1 134 GLU 134 821 821 GLU GLU A . n A 1 135 ALA 135 822 822 ALA ALA A . n A 1 136 LYS 136 823 823 LYS LYS A . n A 1 137 ASP 137 824 824 ASP ASP A . n A 1 138 VAL 138 825 825 VAL VAL A . n A 1 139 ASP 139 826 826 ASP ASP A . n A 1 140 LEU 140 827 827 LEU LEU A . n A 1 141 GLY 141 828 828 GLY GLY A . n A 1 142 ALA 142 829 829 ALA ALA A . n A 1 143 ASN 143 830 830 ASN ASN A . n A 1 144 VAL 144 831 831 VAL VAL A . n A 1 145 SER 145 832 832 SER SER A . n A 1 146 TYR 146 833 833 TYR TYR A . n A 1 147 ARG 147 834 834 ARG ARG A . n A 1 148 ILE 148 835 835 ILE ILE A . n A 1 149 ARG 149 836 836 ARG ARG A . n A 1 150 SER 150 837 837 SER SER A . n A 1 151 PRO 151 838 838 PRO PRO A . n A 1 152 GLU 152 839 839 GLU GLU A . n A 1 153 VAL 153 840 840 VAL VAL A . n A 1 154 LYS 154 841 841 LYS LYS A . n A 1 155 HIS 155 842 842 HIS HIS A . n A 1 156 LEU 156 843 843 LEU LEU A . n A 1 157 PHE 157 844 844 PHE PHE A . n A 1 158 ALA 158 845 845 ALA ALA A . n A 1 159 LEU 159 846 846 LEU LEU A . n A 1 160 HIS 160 847 847 HIS HIS A . n A 1 161 PRO 161 848 848 PRO PRO A . n A 1 162 PHE 162 849 849 PHE PHE A . n A 1 163 THR 163 850 850 THR THR A . n A 1 164 GLY 164 851 851 GLY GLY A . n A 1 165 GLU 165 852 852 GLU GLU A . n A 1 166 LEU 166 853 853 LEU LEU A . n A 1 167 SER 167 854 854 SER SER A . n A 1 168 LEU 168 855 855 LEU LEU A . n A 1 169 LEU 169 856 856 LEU LEU A . n A 1 170 ARG 170 857 857 ARG ARG A . n A 1 171 SER 171 858 858 SER SER A . n A 1 172 LEU 172 859 859 LEU LEU A . n A 1 173 ASP 173 860 860 ASP ASP A . n A 1 174 TYR 174 861 861 TYR TYR A . n A 1 175 GLU 175 862 862 GLU GLU A . n A 1 176 ALA 176 863 ? ? ? A . n A 1 177 PHE 177 864 ? ? ? A . n A 1 178 PRO 178 865 ? ? ? A . n A 1 179 ASP 179 866 ? ? ? A . n A 1 180 GLN 180 867 ? ? ? A . n A 1 181 GLU 181 868 ? ? ? A . n A 1 182 ALA 182 869 869 ALA ALA A . n A 1 183 SER 183 870 870 SER SER A . n A 1 184 ILE 184 871 871 ILE ILE A . n A 1 185 THR 185 872 872 THR THR A . n A 1 186 PHE 186 873 873 PHE PHE A . n A 1 187 LEU 187 874 874 LEU LEU A . n A 1 188 ALA 188 875 875 ALA ALA A . n A 1 189 GLU 189 876 876 GLU GLU A . n A 1 190 ALA 190 877 877 ALA ALA A . n A 1 191 PHE 191 878 878 PHE PHE A . n A 1 192 ASP 192 879 879 ASP ASP A . n A 1 193 ILE 193 880 880 ILE ILE A . n A 1 194 TYR 194 881 881 TYR TYR A . n A 1 195 GLY 195 882 882 GLY GLY A . n A 1 196 THR 196 883 883 THR THR A . n A 1 197 MET 197 884 884 MET MET A . n A 1 198 PRO 198 885 885 PRO PRO A . n A 1 199 PRO 199 886 886 PRO PRO A . n A 1 200 GLY 200 887 887 GLY GLY A . n A 1 201 ILE 201 888 888 ILE ILE A . n A 1 202 ALA 202 889 889 ALA ALA A . n A 1 203 THR 203 890 890 THR THR A . n A 1 204 VAL 204 891 891 VAL VAL A . n A 1 205 THR 205 892 892 THR THR A . n A 1 206 VAL 206 893 893 VAL VAL A . n A 1 207 ILE 207 894 894 ILE ILE A . n A 1 208 VAL 208 895 895 VAL VAL A . n A 1 209 LYS 209 896 896 LYS LYS A . n A 1 210 ASP 210 897 897 ASP ASP A . n A 1 211 LEU 211 898 ? ? ? A . n A 1 212 GLU 212 899 ? ? ? A . n A 1 213 HIS 213 900 ? ? ? A . n A 1 214 HIS 214 901 ? ? ? A . n A 1 215 HIS 215 902 ? ? ? A . n A 1 216 HIS 216 903 ? ? ? A . n A 1 217 HIS 217 904 ? ? ? A . n A 1 218 HIS 218 905 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 1001 1 CA CA A . C 2 CA 1 1002 2 CA CA A . D 2 CA 1 1003 3 CA CA A . E 2 CA 1 1004 4 CA CA A . F 3 HOH 1 1101 73 HOH HOH A . F 3 HOH 2 1102 41 HOH HOH A . F 3 HOH 3 1103 83 HOH HOH A . F 3 HOH 4 1104 13 HOH HOH A . F 3 HOH 5 1105 18 HOH HOH A . F 3 HOH 6 1106 42 HOH HOH A . F 3 HOH 7 1107 111 HOH HOH A . F 3 HOH 8 1108 65 HOH HOH A . F 3 HOH 9 1109 90 HOH HOH A . F 3 HOH 10 1110 43 HOH HOH A . F 3 HOH 11 1111 137 HOH HOH A . F 3 HOH 12 1112 85 HOH HOH A . F 3 HOH 13 1113 1 HOH HOH A . F 3 HOH 14 1114 11 HOH HOH A . F 3 HOH 15 1115 3 HOH HOH A . F 3 HOH 16 1116 34 HOH HOH A . F 3 HOH 17 1117 58 HOH HOH A . F 3 HOH 18 1118 45 HOH HOH A . F 3 HOH 19 1119 30 HOH HOH A . F 3 HOH 20 1120 61 HOH HOH A . F 3 HOH 21 1121 8 HOH HOH A . F 3 HOH 22 1122 51 HOH HOH A . F 3 HOH 23 1123 14 HOH HOH A . F 3 HOH 24 1124 37 HOH HOH A . F 3 HOH 25 1125 23 HOH HOH A . F 3 HOH 26 1126 99 HOH HOH A . F 3 HOH 27 1127 86 HOH HOH A . F 3 HOH 28 1128 2 HOH HOH A . F 3 HOH 29 1129 28 HOH HOH A . F 3 HOH 30 1130 64 HOH HOH A . F 3 HOH 31 1131 63 HOH HOH A . F 3 HOH 32 1132 60 HOH HOH A . F 3 HOH 33 1133 76 HOH HOH A . F 3 HOH 34 1134 89 HOH HOH A . F 3 HOH 35 1135 97 HOH HOH A . F 3 HOH 36 1136 115 HOH HOH A . F 3 HOH 37 1137 92 HOH HOH A . F 3 HOH 38 1138 94 HOH HOH A . F 3 HOH 39 1139 7 HOH HOH A . F 3 HOH 40 1140 141 HOH HOH A . F 3 HOH 41 1141 16 HOH HOH A . F 3 HOH 42 1142 50 HOH HOH A . F 3 HOH 43 1143 101 HOH HOH A . F 3 HOH 44 1144 107 HOH HOH A . F 3 HOH 45 1145 145 HOH HOH A . F 3 HOH 46 1146 105 HOH HOH A . F 3 HOH 47 1147 36 HOH HOH A . F 3 HOH 48 1148 29 HOH HOH A . F 3 HOH 49 1149 47 HOH HOH A . F 3 HOH 50 1150 122 HOH HOH A . F 3 HOH 51 1151 134 HOH HOH A . F 3 HOH 52 1152 75 HOH HOH A . F 3 HOH 53 1153 54 HOH HOH A . F 3 HOH 54 1154 139 HOH HOH A . F 3 HOH 55 1155 109 HOH HOH A . F 3 HOH 56 1156 78 HOH HOH A . F 3 HOH 57 1157 93 HOH HOH A . F 3 HOH 58 1158 110 HOH HOH A . F 3 HOH 59 1159 72 HOH HOH A . F 3 HOH 60 1160 114 HOH HOH A . F 3 HOH 61 1161 33 HOH HOH A . F 3 HOH 62 1162 104 HOH HOH A . F 3 HOH 63 1163 21 HOH HOH A . F 3 HOH 64 1164 138 HOH HOH A . F 3 HOH 65 1165 25 HOH HOH A . F 3 HOH 66 1166 26 HOH HOH A . F 3 HOH 67 1167 57 HOH HOH A . F 3 HOH 68 1168 40 HOH HOH A . F 3 HOH 69 1169 56 HOH HOH A . F 3 HOH 70 1170 39 HOH HOH A . F 3 HOH 71 1171 49 HOH HOH A . F 3 HOH 72 1172 67 HOH HOH A . F 3 HOH 73 1173 32 HOH HOH A . F 3 HOH 74 1174 55 HOH HOH A . F 3 HOH 75 1175 20 HOH HOH A . F 3 HOH 76 1176 19 HOH HOH A . F 3 HOH 77 1177 17 HOH HOH A . F 3 HOH 78 1178 133 HOH HOH A . F 3 HOH 79 1179 27 HOH HOH A . F 3 HOH 80 1180 82 HOH HOH A . F 3 HOH 81 1181 103 HOH HOH A . F 3 HOH 82 1182 44 HOH HOH A . F 3 HOH 83 1183 88 HOH HOH A . F 3 HOH 84 1184 100 HOH HOH A . F 3 HOH 85 1185 87 HOH HOH A . F 3 HOH 86 1186 38 HOH HOH A . F 3 HOH 87 1187 15 HOH HOH A . F 3 HOH 88 1188 121 HOH HOH A . F 3 HOH 89 1189 6 HOH HOH A . F 3 HOH 90 1190 120 HOH HOH A . F 3 HOH 91 1191 118 HOH HOH A . F 3 HOH 92 1192 24 HOH HOH A . F 3 HOH 93 1193 116 HOH HOH A . F 3 HOH 94 1194 68 HOH HOH A . F 3 HOH 95 1195 108 HOH HOH A . F 3 HOH 96 1196 31 HOH HOH A . F 3 HOH 97 1197 35 HOH HOH A . F 3 HOH 98 1198 66 HOH HOH A . F 3 HOH 99 1199 53 HOH HOH A . F 3 HOH 100 1200 52 HOH HOH A . F 3 HOH 101 1201 142 HOH HOH A . F 3 HOH 102 1202 5 HOH HOH A . F 3 HOH 103 1203 130 HOH HOH A . F 3 HOH 104 1204 71 HOH HOH A . F 3 HOH 105 1205 74 HOH HOH A . F 3 HOH 106 1206 70 HOH HOH A . F 3 HOH 107 1207 77 HOH HOH A . F 3 HOH 108 1208 117 HOH HOH A . F 3 HOH 109 1209 22 HOH HOH A . F 3 HOH 110 1210 131 HOH HOH A . F 3 HOH 111 1211 144 HOH HOH A . F 3 HOH 112 1212 59 HOH HOH A . F 3 HOH 113 1213 80 HOH HOH A . F 3 HOH 114 1214 135 HOH HOH A . F 3 HOH 115 1215 46 HOH HOH A . F 3 HOH 116 1216 81 HOH HOH A . F 3 HOH 117 1217 91 HOH HOH A . F 3 HOH 118 1218 129 HOH HOH A . F 3 HOH 119 1219 140 HOH HOH A . F 3 HOH 120 1220 126 HOH HOH A . F 3 HOH 121 1221 123 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 180 ? 1 MORE -27 ? 1 'SSA (A^2)' 11330 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASN 3 ? A ASN 690 ? 1_555 CA ? E CA . ? A CA 1004 ? 1_555 O ? A ASN 5 ? A ASN 692 ? 1_555 98.9 ? 2 OD1 ? A ASN 3 ? A ASN 690 ? 1_555 CA ? E CA . ? A CA 1004 ? 1_555 OD1 ? A ASP 35 ? A ASP 722 ? 1_555 162.3 ? 3 O ? A ASN 5 ? A ASN 692 ? 1_555 CA ? E CA . ? A CA 1004 ? 1_555 OD1 ? A ASP 35 ? A ASP 722 ? 1_555 92.0 ? 4 OD1 ? A ASN 3 ? A ASN 690 ? 1_555 CA ? E CA . ? A CA 1004 ? 1_555 OD2 ? A ASP 35 ? A ASP 722 ? 1_555 148.3 ? 5 O ? A ASN 5 ? A ASN 692 ? 1_555 CA ? E CA . ? A CA 1004 ? 1_555 OD2 ? A ASP 35 ? A ASP 722 ? 1_555 81.7 ? 6 OD1 ? A ASP 35 ? A ASP 722 ? 1_555 CA ? E CA . ? A CA 1004 ? 1_555 OD2 ? A ASP 35 ? A ASP 722 ? 1_555 47.0 ? 7 OD1 ? A ASN 3 ? A ASN 690 ? 1_555 CA ? E CA . ? A CA 1004 ? 1_555 OD2 ? A ASP 37 ? A ASP 724 ? 1_555 90.5 ? 8 O ? A ASN 5 ? A ASN 692 ? 1_555 CA ? E CA . ? A CA 1004 ? 1_555 OD2 ? A ASP 37 ? A ASP 724 ? 1_555 89.6 ? 9 OD1 ? A ASP 35 ? A ASP 722 ? 1_555 CA ? E CA . ? A CA 1004 ? 1_555 OD2 ? A ASP 37 ? A ASP 724 ? 1_555 75.6 ? 10 OD2 ? A ASP 35 ? A ASP 722 ? 1_555 CA ? E CA . ? A CA 1004 ? 1_555 OD2 ? A ASP 37 ? A ASP 724 ? 1_555 121.1 ? 11 OD1 ? A ASN 3 ? A ASN 690 ? 1_555 CA ? E CA . ? A CA 1004 ? 1_555 O ? A ASN 41 ? A ASN 728 ? 1_555 100.1 ? 12 O ? A ASN 5 ? A ASN 692 ? 1_555 CA ? E CA . ? A CA 1004 ? 1_555 O ? A ASN 41 ? A ASN 728 ? 1_555 160.4 ? 13 OD1 ? A ASP 35 ? A ASP 722 ? 1_555 CA ? E CA . ? A CA 1004 ? 1_555 O ? A ASN 41 ? A ASN 728 ? 1_555 70.8 ? 14 OD2 ? A ASP 35 ? A ASP 722 ? 1_555 CA ? E CA . ? A CA 1004 ? 1_555 O ? A ASN 41 ? A ASN 728 ? 1_555 79.7 ? 15 OD2 ? A ASP 37 ? A ASP 724 ? 1_555 CA ? E CA . ? A CA 1004 ? 1_555 O ? A ASN 41 ? A ASN 728 ? 1_555 94.9 ? 16 OD1 ? A ASN 3 ? A ASN 690 ? 1_555 CA ? E CA . ? A CA 1004 ? 1_555 OD2 ? A ASP 85 ? A ASP 772 ? 1_555 68.5 ? 17 O ? A ASN 5 ? A ASN 692 ? 1_555 CA ? E CA . ? A CA 1004 ? 1_555 OD2 ? A ASP 85 ? A ASP 772 ? 1_555 90.7 ? 18 OD1 ? A ASP 35 ? A ASP 722 ? 1_555 CA ? E CA . ? A CA 1004 ? 1_555 OD2 ? A ASP 85 ? A ASP 772 ? 1_555 125.6 ? 19 OD2 ? A ASP 35 ? A ASP 722 ? 1_555 CA ? E CA . ? A CA 1004 ? 1_555 OD2 ? A ASP 85 ? A ASP 772 ? 1_555 79.9 ? 20 OD2 ? A ASP 37 ? A ASP 724 ? 1_555 CA ? E CA . ? A CA 1004 ? 1_555 OD2 ? A ASP 85 ? A ASP 772 ? 1_555 158.8 ? 21 O ? A ASN 41 ? A ASN 728 ? 1_555 CA ? E CA . ? A CA 1004 ? 1_555 OD2 ? A ASP 85 ? A ASP 772 ? 1_555 91.9 ? 22 OE2 ? A GLU 21 ? A GLU 708 ? 1_555 CA ? B CA . ? A CA 1001 ? 1_555 OE2 ? A GLU 22 ? A GLU 709 ? 1_555 91.9 ? 23 OE2 ? A GLU 21 ? A GLU 708 ? 1_555 CA ? B CA . ? A CA 1001 ? 1_555 OD1 ? A ASN 70 ? A ASN 757 ? 1_555 94.8 ? 24 OE2 ? A GLU 22 ? A GLU 709 ? 1_555 CA ? B CA . ? A CA 1001 ? 1_555 OD1 ? A ASN 70 ? A ASN 757 ? 1_555 85.1 ? 25 OE2 ? A GLU 21 ? A GLU 708 ? 1_555 CA ? B CA . ? A CA 1001 ? 1_555 OE1 ? A GLU 72 ? A GLU 759 ? 1_555 86.2 ? 26 OE2 ? A GLU 22 ? A GLU 709 ? 1_555 CA ? B CA . ? A CA 1001 ? 1_555 OE1 ? A GLU 72 ? A GLU 759 ? 1_555 174.4 ? 27 OD1 ? A ASN 70 ? A ASN 757 ? 1_555 CA ? B CA . ? A CA 1001 ? 1_555 OE1 ? A GLU 72 ? A GLU 759 ? 1_555 89.8 ? 28 OE2 ? A GLU 21 ? A GLU 708 ? 1_555 CA ? B CA . ? A CA 1001 ? 1_555 OD2 ? A ASP 106 ? A ASP 793 ? 1_555 98.8 ? 29 OE2 ? A GLU 22 ? A GLU 709 ? 1_555 CA ? B CA . ? A CA 1001 ? 1_555 OD2 ? A ASP 106 ? A ASP 793 ? 1_555 79.2 ? 30 OD1 ? A ASN 70 ? A ASN 757 ? 1_555 CA ? B CA . ? A CA 1001 ? 1_555 OD2 ? A ASP 106 ? A ASP 793 ? 1_555 159.5 ? 31 OE1 ? A GLU 72 ? A GLU 759 ? 1_555 CA ? B CA . ? A CA 1001 ? 1_555 OD2 ? A ASP 106 ? A ASP 793 ? 1_555 106.3 ? 32 OE2 ? A GLU 21 ? A GLU 708 ? 1_555 CA ? B CA . ? A CA 1001 ? 1_555 O ? F HOH . ? A HOH 1194 ? 1_555 170.4 ? 33 OE2 ? A GLU 22 ? A GLU 709 ? 1_555 CA ? B CA . ? A CA 1001 ? 1_555 O ? F HOH . ? A HOH 1194 ? 1_555 97.3 ? 34 OD1 ? A ASN 70 ? A ASN 757 ? 1_555 CA ? B CA . ? A CA 1001 ? 1_555 O ? F HOH . ? A HOH 1194 ? 1_555 88.8 ? 35 OE1 ? A GLU 72 ? A GLU 759 ? 1_555 CA ? B CA . ? A CA 1001 ? 1_555 O ? F HOH . ? A HOH 1194 ? 1_555 84.9 ? 36 OD2 ? A ASP 106 ? A ASP 793 ? 1_555 CA ? B CA . ? A CA 1001 ? 1_555 O ? F HOH . ? A HOH 1194 ? 1_555 80.3 ? 37 OE1 ? A GLU 21 ? A GLU 708 ? 1_555 CA ? C CA . ? A CA 1002 ? 1_555 OE1 ? A GLU 72 ? A GLU 759 ? 1_555 89.1 ? 38 OE1 ? A GLU 21 ? A GLU 708 ? 1_555 CA ? C CA . ? A CA 1002 ? 1_555 OE2 ? A GLU 72 ? A GLU 759 ? 1_555 112.0 ? 39 OE1 ? A GLU 72 ? A GLU 759 ? 1_555 CA ? C CA . ? A CA 1002 ? 1_555 OE2 ? A GLU 72 ? A GLU 759 ? 1_555 48.4 ? 40 OE1 ? A GLU 21 ? A GLU 708 ? 1_555 CA ? C CA . ? A CA 1002 ? 1_555 OD1 ? A ASP 103 ? A ASP 790 ? 1_555 83.5 ? 41 OE1 ? A GLU 72 ? A GLU 759 ? 1_555 CA ? C CA . ? A CA 1002 ? 1_555 OD1 ? A ASP 103 ? A ASP 790 ? 1_555 112.2 ? 42 OE2 ? A GLU 72 ? A GLU 759 ? 1_555 CA ? C CA . ? A CA 1002 ? 1_555 OD1 ? A ASP 103 ? A ASP 790 ? 1_555 73.1 ? 43 OE1 ? A GLU 21 ? A GLU 708 ? 1_555 CA ? C CA . ? A CA 1002 ? 1_555 O ? A ILE 104 ? A ILE 791 ? 1_555 84.5 ? 44 OE1 ? A GLU 72 ? A GLU 759 ? 1_555 CA ? C CA . ? A CA 1002 ? 1_555 O ? A ILE 104 ? A ILE 791 ? 1_555 155.5 ? 45 OE2 ? A GLU 72 ? A GLU 759 ? 1_555 CA ? C CA . ? A CA 1002 ? 1_555 O ? A ILE 104 ? A ILE 791 ? 1_555 154.6 ? 46 OD1 ? A ASP 103 ? A ASP 790 ? 1_555 CA ? C CA . ? A CA 1002 ? 1_555 O ? A ILE 104 ? A ILE 791 ? 1_555 90.6 ? 47 OE1 ? A GLU 21 ? A GLU 708 ? 1_555 CA ? C CA . ? A CA 1002 ? 1_555 OD1 ? A ASP 106 ? A ASP 793 ? 1_555 90.2 ? 48 OE1 ? A GLU 72 ? A GLU 759 ? 1_555 CA ? C CA . ? A CA 1002 ? 1_555 OD1 ? A ASP 106 ? A ASP 793 ? 1_555 76.8 ? 49 OE2 ? A GLU 72 ? A GLU 759 ? 1_555 CA ? C CA . ? A CA 1002 ? 1_555 OD1 ? A ASP 106 ? A ASP 793 ? 1_555 118.0 ? 50 OD1 ? A ASP 103 ? A ASP 790 ? 1_555 CA ? C CA . ? A CA 1002 ? 1_555 OD1 ? A ASP 106 ? A ASP 793 ? 1_555 168.7 ? 51 O ? A ILE 104 ? A ILE 791 ? 1_555 CA ? C CA . ? A CA 1002 ? 1_555 OD1 ? A ASP 106 ? A ASP 793 ? 1_555 79.5 ? 52 OE1 ? A GLU 21 ? A GLU 708 ? 1_555 CA ? C CA . ? A CA 1002 ? 1_555 OD1 ? A ASP 139 ? A ASP 826 ? 1_555 164.9 ? 53 OE1 ? A GLU 72 ? A GLU 759 ? 1_555 CA ? C CA . ? A CA 1002 ? 1_555 OD1 ? A ASP 139 ? A ASP 826 ? 1_555 94.9 ? 54 OE2 ? A GLU 72 ? A GLU 759 ? 1_555 CA ? C CA . ? A CA 1002 ? 1_555 OD1 ? A ASP 139 ? A ASP 826 ? 1_555 81.1 ? 55 OD1 ? A ASP 103 ? A ASP 790 ? 1_555 CA ? C CA . ? A CA 1002 ? 1_555 OD1 ? A ASP 139 ? A ASP 826 ? 1_555 108.3 ? 56 O ? A ILE 104 ? A ILE 791 ? 1_555 CA ? C CA . ? A CA 1002 ? 1_555 OD1 ? A ASP 139 ? A ASP 826 ? 1_555 85.9 ? 57 OD1 ? A ASP 106 ? A ASP 793 ? 1_555 CA ? C CA . ? A CA 1002 ? 1_555 OD1 ? A ASP 139 ? A ASP 826 ? 1_555 76.6 ? 58 OD1 ? A ASP 105 ? A ASP 792 ? 1_555 CA ? D CA . ? A CA 1003 ? 1_555 O ? A ASN 107 ? A ASN 794 ? 1_555 87.9 ? 59 OD1 ? A ASP 105 ? A ASP 792 ? 1_555 CA ? D CA . ? A CA 1003 ? 1_555 OD1 ? A ASP 137 ? A ASP 824 ? 1_555 155.8 ? 60 O ? A ASN 107 ? A ASN 794 ? 1_555 CA ? D CA . ? A CA 1003 ? 1_555 OD1 ? A ASP 137 ? A ASP 824 ? 1_555 90.9 ? 61 OD1 ? A ASP 105 ? A ASP 792 ? 1_555 CA ? D CA . ? A CA 1003 ? 1_555 OD2 ? A ASP 137 ? A ASP 824 ? 1_555 152.2 ? 62 O ? A ASN 107 ? A ASN 794 ? 1_555 CA ? D CA . ? A CA 1003 ? 1_555 OD2 ? A ASP 137 ? A ASP 824 ? 1_555 93.2 ? 63 OD1 ? A ASP 137 ? A ASP 824 ? 1_555 CA ? D CA . ? A CA 1003 ? 1_555 OD2 ? A ASP 137 ? A ASP 824 ? 1_555 52.0 ? 64 OD1 ? A ASP 105 ? A ASP 792 ? 1_555 CA ? D CA . ? A CA 1003 ? 1_555 OD2 ? A ASP 139 ? A ASP 826 ? 1_555 75.4 ? 65 O ? A ASN 107 ? A ASN 794 ? 1_555 CA ? D CA . ? A CA 1003 ? 1_555 OD2 ? A ASP 139 ? A ASP 826 ? 1_555 78.9 ? 66 OD1 ? A ASP 137 ? A ASP 824 ? 1_555 CA ? D CA . ? A CA 1003 ? 1_555 OD2 ? A ASP 139 ? A ASP 826 ? 1_555 80.7 ? 67 OD2 ? A ASP 137 ? A ASP 824 ? 1_555 CA ? D CA . ? A CA 1003 ? 1_555 OD2 ? A ASP 139 ? A ASP 826 ? 1_555 132.1 ? 68 OD1 ? A ASP 105 ? A ASP 792 ? 1_555 CA ? D CA . ? A CA 1003 ? 1_555 O ? F HOH . ? A HOH 1101 ? 1_555 82.9 ? 69 O ? A ASN 107 ? A ASN 794 ? 1_555 CA ? D CA . ? A CA 1003 ? 1_555 O ? F HOH . ? A HOH 1101 ? 1_555 170.8 ? 70 OD1 ? A ASP 137 ? A ASP 824 ? 1_555 CA ? D CA . ? A CA 1003 ? 1_555 O ? F HOH . ? A HOH 1101 ? 1_555 97.5 ? 71 OD2 ? A ASP 137 ? A ASP 824 ? 1_555 CA ? D CA . ? A CA 1003 ? 1_555 O ? F HOH . ? A HOH 1101 ? 1_555 94.8 ? 72 OD2 ? A ASP 139 ? A ASP 826 ? 1_555 CA ? D CA . ? A CA 1003 ? 1_555 O ? F HOH . ? A HOH 1101 ? 1_555 98.9 ? 73 OD1 ? A ASP 105 ? A ASP 792 ? 1_555 CA ? D CA . ? A CA 1003 ? 1_555 O ? F HOH . ? A HOH 1163 ? 1_555 73.8 ? 74 O ? A ASN 107 ? A ASN 794 ? 1_555 CA ? D CA . ? A CA 1003 ? 1_555 O ? F HOH . ? A HOH 1163 ? 1_555 92.9 ? 75 OD1 ? A ASP 137 ? A ASP 824 ? 1_555 CA ? D CA . ? A CA 1003 ? 1_555 O ? F HOH . ? A HOH 1163 ? 1_555 130.4 ? 76 OD2 ? A ASP 137 ? A ASP 824 ? 1_555 CA ? D CA . ? A CA 1003 ? 1_555 O ? F HOH . ? A HOH 1163 ? 1_555 78.4 ? 77 OD2 ? A ASP 139 ? A ASP 826 ? 1_555 CA ? D CA . ? A CA 1003 ? 1_555 O ? F HOH . ? A HOH 1163 ? 1_555 148.4 ? 78 O ? F HOH . ? A HOH 1101 ? 1_555 CA ? D CA . ? A CA 1003 ? 1_555 O ? F HOH . ? A HOH 1163 ? 1_555 84.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-10-25 2 'Structure model' 1 1 2019-12-18 3 'Structure model' 1 2 2020-10-07 4 'Structure model' 1 3 2023-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 3 'Structure model' pdbx_struct_conn_angle 5 3 'Structure model' struct_conn 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 4 'Structure model' database_2 9 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 3 'Structure model' '_citation.country' 3 3 'Structure model' '_citation.journal_abbrev' 4 3 'Structure model' '_citation.journal_id_ASTM' 5 3 'Structure model' '_citation.journal_id_CSD' 6 3 'Structure model' '_citation.journal_id_ISSN' 7 3 'Structure model' '_citation.pdbx_database_id_DOI' 8 3 'Structure model' '_citation.pdbx_database_id_PubMed' 9 3 'Structure model' '_citation.title' 10 3 'Structure model' '_citation.year' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 15 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 16 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 17 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 18 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 19 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 20 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 21 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 22 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 23 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 24 3 'Structure model' '_pdbx_struct_conn_angle.value' 25 3 'Structure model' '_struct_conn.pdbx_dist_value' 26 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 27 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 28 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 29 4 'Structure model' '_database_2.pdbx_DOI' 30 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined -30.6925 -15.9745 -10.6030 0.0559 0.0943 0.0212 -0.0227 -0.0164 -0.0053 3.5490 2.4569 2.9710 0.1162 -0.0244 0.1100 0.0227 0.0865 -0.0260 -0.3542 0.0502 0.1247 0.0746 -0.3883 -0.0729 'X-RAY DIFFRACTION' 2 ? refined 7.2615 -9.5956 19.4973 0.1070 0.0240 0.0484 -0.0036 0.0338 -0.0132 6.2892 1.7605 4.2247 0.0183 2.2752 0.1397 -0.0684 -0.3413 0.1529 0.2009 -0.0438 0.0574 -0.0679 -0.2456 0.1122 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 A 691 ? ? A 791 ? ? ? ? 'X-RAY DIFFRACTION' 2 1 A 1001 ? ? A 1002 ? ? ? ? 'X-RAY DIFFRACTION' 3 2 A 792 ? ? A 897 ? ? ? ? 'X-RAY DIFFRACTION' 4 2 A 1003 ? ? A 1003 ? ? ? ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0155 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 723 ? ? -65.98 80.74 2 1 ASP A 860 ? ? -136.54 -98.39 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 688 ? A MET 1 2 1 Y 1 A VAL 689 ? A VAL 2 3 1 Y 1 A ALA 863 ? A ALA 176 4 1 Y 1 A PHE 864 ? A PHE 177 5 1 Y 1 A PRO 865 ? A PRO 178 6 1 Y 1 A ASP 866 ? A ASP 179 7 1 Y 1 A GLN 867 ? A GLN 180 8 1 Y 1 A GLU 868 ? A GLU 181 9 1 Y 1 A LEU 898 ? A LEU 211 10 1 Y 1 A GLU 899 ? A GLU 212 11 1 Y 1 A HIS 900 ? A HIS 213 12 1 Y 1 A HIS 901 ? A HIS 214 13 1 Y 1 A HIS 902 ? A HIS 215 14 1 Y 1 A HIS 903 ? A HIS 216 15 1 Y 1 A HIS 904 ? A HIS 217 16 1 Y 1 A HIS 905 ? A HIS 218 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 HIS N N N N 124 HIS CA C N S 125 HIS C C N N 126 HIS O O N N 127 HIS CB C N N 128 HIS CG C Y N 129 HIS ND1 N Y N 130 HIS CD2 C Y N 131 HIS CE1 C Y N 132 HIS NE2 N Y N 133 HIS OXT O N N 134 HIS H H N N 135 HIS H2 H N N 136 HIS HA H N N 137 HIS HB2 H N N 138 HIS HB3 H N N 139 HIS HD1 H N N 140 HIS HD2 H N N 141 HIS HE1 H N N 142 HIS HE2 H N N 143 HIS HXT H N N 144 HOH O O N N 145 HOH H1 H N N 146 HOH H2 H N N 147 ILE N N N N 148 ILE CA C N S 149 ILE C C N N 150 ILE O O N N 151 ILE CB C N S 152 ILE CG1 C N N 153 ILE CG2 C N N 154 ILE CD1 C N N 155 ILE OXT O N N 156 ILE H H N N 157 ILE H2 H N N 158 ILE HA H N N 159 ILE HB H N N 160 ILE HG12 H N N 161 ILE HG13 H N N 162 ILE HG21 H N N 163 ILE HG22 H N N 164 ILE HG23 H N N 165 ILE HD11 H N N 166 ILE HD12 H N N 167 ILE HD13 H N N 168 ILE HXT H N N 169 LEU N N N N 170 LEU CA C N S 171 LEU C C N N 172 LEU O O N N 173 LEU CB C N N 174 LEU CG C N N 175 LEU CD1 C N N 176 LEU CD2 C N N 177 LEU OXT O N N 178 LEU H H N N 179 LEU H2 H N N 180 LEU HA H N N 181 LEU HB2 H N N 182 LEU HB3 H N N 183 LEU HG H N N 184 LEU HD11 H N N 185 LEU HD12 H N N 186 LEU HD13 H N N 187 LEU HD21 H N N 188 LEU HD22 H N N 189 LEU HD23 H N N 190 LEU HXT H N N 191 LYS N N N N 192 LYS CA C N S 193 LYS C C N N 194 LYS O O N N 195 LYS CB C N N 196 LYS CG C N N 197 LYS CD C N N 198 LYS CE C N N 199 LYS NZ N N N 200 LYS OXT O N N 201 LYS H H N N 202 LYS H2 H N N 203 LYS HA H N N 204 LYS HB2 H N N 205 LYS HB3 H N N 206 LYS HG2 H N N 207 LYS HG3 H N N 208 LYS HD2 H N N 209 LYS HD3 H N N 210 LYS HE2 H N N 211 LYS HE3 H N N 212 LYS HZ1 H N N 213 LYS HZ2 H N N 214 LYS HZ3 H N N 215 LYS HXT H N N 216 MET N N N N 217 MET CA C N S 218 MET C C N N 219 MET O O N N 220 MET CB C N N 221 MET CG C N N 222 MET SD S N N 223 MET CE C N N 224 MET OXT O N N 225 MET H H N N 226 MET H2 H N N 227 MET HA H N N 228 MET HB2 H N N 229 MET HB3 H N N 230 MET HG2 H N N 231 MET HG3 H N N 232 MET HE1 H N N 233 MET HE2 H N N 234 MET HE3 H N N 235 MET HXT H N N 236 PHE N N N N 237 PHE CA C N S 238 PHE C C N N 239 PHE O O N N 240 PHE CB C N N 241 PHE CG C Y N 242 PHE CD1 C Y N 243 PHE CD2 C Y N 244 PHE CE1 C Y N 245 PHE CE2 C Y N 246 PHE CZ C Y N 247 PHE OXT O N N 248 PHE H H N N 249 PHE H2 H N N 250 PHE HA H N N 251 PHE HB2 H N N 252 PHE HB3 H N N 253 PHE HD1 H N N 254 PHE HD2 H N N 255 PHE HE1 H N N 256 PHE HE2 H N N 257 PHE HZ H N N 258 PHE HXT H N N 259 PRO N N N N 260 PRO CA C N S 261 PRO C C N N 262 PRO O O N N 263 PRO CB C N N 264 PRO CG C N N 265 PRO CD C N N 266 PRO OXT O N N 267 PRO H H N N 268 PRO HA H N N 269 PRO HB2 H N N 270 PRO HB3 H N N 271 PRO HG2 H N N 272 PRO HG3 H N N 273 PRO HD2 H N N 274 PRO HD3 H N N 275 PRO HXT H N N 276 SER N N N N 277 SER CA C N S 278 SER C C N N 279 SER O O N N 280 SER CB C N N 281 SER OG O N N 282 SER OXT O N N 283 SER H H N N 284 SER H2 H N N 285 SER HA H N N 286 SER HB2 H N N 287 SER HB3 H N N 288 SER HG H N N 289 SER HXT H N N 290 THR N N N N 291 THR CA C N S 292 THR C C N N 293 THR O O N N 294 THR CB C N R 295 THR OG1 O N N 296 THR CG2 C N N 297 THR OXT O N N 298 THR H H N N 299 THR H2 H N N 300 THR HA H N N 301 THR HB H N N 302 THR HG1 H N N 303 THR HG21 H N N 304 THR HG22 H N N 305 THR HG23 H N N 306 THR HXT H N N 307 TYR N N N N 308 TYR CA C N S 309 TYR C C N N 310 TYR O O N N 311 TYR CB C N N 312 TYR CG C Y N 313 TYR CD1 C Y N 314 TYR CD2 C Y N 315 TYR CE1 C Y N 316 TYR CE2 C Y N 317 TYR CZ C Y N 318 TYR OH O N N 319 TYR OXT O N N 320 TYR H H N N 321 TYR H2 H N N 322 TYR HA H N N 323 TYR HB2 H N N 324 TYR HB3 H N N 325 TYR HD1 H N N 326 TYR HD2 H N N 327 TYR HE1 H N N 328 TYR HE2 H N N 329 TYR HH H N N 330 TYR HXT H N N 331 VAL N N N N 332 VAL CA C N S 333 VAL C C N N 334 VAL O O N N 335 VAL CB C N N 336 VAL CG1 C N N 337 VAL CG2 C N N 338 VAL OXT O N N 339 VAL H H N N 340 VAL H2 H N N 341 VAL HA H N N 342 VAL HB H N N 343 VAL HG11 H N N 344 VAL HG12 H N N 345 VAL HG13 H N N 346 VAL HG21 H N N 347 VAL HG22 H N N 348 VAL HG23 H N N 349 VAL HXT H N N 350 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TYR N CA sing N N 293 TYR N H sing N N 294 TYR N H2 sing N N 295 TYR CA C sing N N 296 TYR CA CB sing N N 297 TYR CA HA sing N N 298 TYR C O doub N N 299 TYR C OXT sing N N 300 TYR CB CG sing N N 301 TYR CB HB2 sing N N 302 TYR CB HB3 sing N N 303 TYR CG CD1 doub Y N 304 TYR CG CD2 sing Y N 305 TYR CD1 CE1 sing Y N 306 TYR CD1 HD1 sing N N 307 TYR CD2 CE2 doub Y N 308 TYR CD2 HD2 sing N N 309 TYR CE1 CZ doub Y N 310 TYR CE1 HE1 sing N N 311 TYR CE2 CZ sing Y N 312 TYR CE2 HE2 sing N N 313 TYR CZ OH sing N N 314 TYR OH HH sing N N 315 TYR OXT HXT sing N N 316 VAL N CA sing N N 317 VAL N H sing N N 318 VAL N H2 sing N N 319 VAL CA C sing N N 320 VAL CA CB sing N N 321 VAL CA HA sing N N 322 VAL C O doub N N 323 VAL C OXT sing N N 324 VAL CB CG1 sing N N 325 VAL CB CG2 sing N N 326 VAL CB HB sing N N 327 VAL CG1 HG11 sing N N 328 VAL CG1 HG12 sing N N 329 VAL CG1 HG13 sing N N 330 VAL CG2 HG21 sing N N 331 VAL CG2 HG22 sing N N 332 VAL CG2 HG23 sing N N 333 VAL OXT HXT sing N N 334 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute on Deafness and Other Communication Disorders (NIH/NIDCD)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 'R00 DC012534' _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4XHZ _pdbx_initial_refinement_model.details ? #