data_5TRV # _entry.id 5TRV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5TRV pdb_00005trv 10.2210/pdb5trv/pdb WWPDB D_1000224604 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-01-25 2 'Structure model' 1 1 2017-02-01 3 'Structure model' 1 2 2017-09-20 4 'Structure model' 1 3 2019-12-04 5 'Structure model' 1 4 2024-03-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Author supporting evidence' 3 4 'Structure model' 'Author supporting evidence' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_audit_support 2 4 'Structure model' pdbx_audit_support 3 5 'Structure model' chem_comp_atom 4 5 'Structure model' chem_comp_bond 5 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_audit_support.funding_organization' 2 4 'Structure model' '_pdbx_audit_support.funding_organization' 3 5 'Structure model' '_database_2.pdbx_DOI' 4 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5TRV _pdbx_database_status.recvd_initial_deposition_date 2016-10-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 5TS4 _pdbx_database_related.db_name PDB _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Basanta, B.' 1 'Oberdorfer, G.' 2 'Marcos, E.' 3 'Chidyausiku, T.M.' 4 'Sankaran, B.' 5 'Baker, D.' 6 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Science _citation.journal_id_ASTM SCIEAS _citation.journal_id_CSD 0038 _citation.journal_id_ISSN 1095-9203 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 355 _citation.language ? _citation.page_first 201 _citation.page_last 206 _citation.title 'Principles for designing proteins with cavities formed by curved beta sheets.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1126/science.aah7389 _citation.pdbx_database_id_PubMed 28082595 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Marcos, E.' 1 ? primary 'Basanta, B.' 2 ? primary 'Chidyausiku, T.M.' 3 ? primary 'Tang, Y.' 4 ? primary 'Oberdorfer, G.' 5 ? primary 'Liu, G.' 6 ? primary 'Swapna, G.V.' 7 ? primary 'Guan, R.' 8 ? primary 'Silva, D.A.' 9 ? primary 'Dou, J.' 10 ? primary 'Pereira, J.H.' 11 ? primary 'Xiao, R.' 12 ? primary 'Sankaran, B.' 13 ? primary 'Zwart, P.H.' 14 ? primary 'Montelione, G.T.' 15 ? primary 'Baker, D.' 16 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'denovo NTF2' 14857.236 1 ? ? ? ? 2 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120 1 ? ? ? ? 3 water nat water 18.015 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMTQEEVRKIMEKLKKAFKQGNPEQIVSLLSPDVRVKVGNQEFSGSEEAEKMWRKLMKFVDRVEVRRVKVDENRVEIE VEFEVNGQRYSMEFHFEVENGKVRRVEIRISPTMKKLMKQILNYG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMTQEEVRKIMEKLKKAFKQGNPEQIVSLLSPDVRVKVGNQEFSGSEEAEKMWRKLMKFVDRVEVRRVKVDENRVEIE VEFEVNGQRYSMEFHFEVENGKVRRVEIRISPTMKKLMKQILNYG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'DI(HYDROXYETHYL)ETHER' PEG 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 THR n 1 6 GLN n 1 7 GLU n 1 8 GLU n 1 9 VAL n 1 10 ARG n 1 11 LYS n 1 12 ILE n 1 13 MET n 1 14 GLU n 1 15 LYS n 1 16 LEU n 1 17 LYS n 1 18 LYS n 1 19 ALA n 1 20 PHE n 1 21 LYS n 1 22 GLN n 1 23 GLY n 1 24 ASN n 1 25 PRO n 1 26 GLU n 1 27 GLN n 1 28 ILE n 1 29 VAL n 1 30 SER n 1 31 LEU n 1 32 LEU n 1 33 SER n 1 34 PRO n 1 35 ASP n 1 36 VAL n 1 37 ARG n 1 38 VAL n 1 39 LYS n 1 40 VAL n 1 41 GLY n 1 42 ASN n 1 43 GLN n 1 44 GLU n 1 45 PHE n 1 46 SER n 1 47 GLY n 1 48 SER n 1 49 GLU n 1 50 GLU n 1 51 ALA n 1 52 GLU n 1 53 LYS n 1 54 MET n 1 55 TRP n 1 56 ARG n 1 57 LYS n 1 58 LEU n 1 59 MET n 1 60 LYS n 1 61 PHE n 1 62 VAL n 1 63 ASP n 1 64 ARG n 1 65 VAL n 1 66 GLU n 1 67 VAL n 1 68 ARG n 1 69 ARG n 1 70 VAL n 1 71 LYS n 1 72 VAL n 1 73 ASP n 1 74 GLU n 1 75 ASN n 1 76 ARG n 1 77 VAL n 1 78 GLU n 1 79 ILE n 1 80 GLU n 1 81 VAL n 1 82 GLU n 1 83 PHE n 1 84 GLU n 1 85 VAL n 1 86 ASN n 1 87 GLY n 1 88 GLN n 1 89 ARG n 1 90 TYR n 1 91 SER n 1 92 MET n 1 93 GLU n 1 94 PHE n 1 95 HIS n 1 96 PHE n 1 97 GLU n 1 98 VAL n 1 99 GLU n 1 100 ASN n 1 101 GLY n 1 102 LYS n 1 103 VAL n 1 104 ARG n 1 105 ARG n 1 106 VAL n 1 107 GLU n 1 108 ILE n 1 109 ARG n 1 110 ILE n 1 111 SER n 1 112 PRO n 1 113 THR n 1 114 MET n 1 115 LYS n 1 116 LYS n 1 117 LEU n 1 118 MET n 1 119 LYS n 1 120 GLN n 1 121 ILE n 1 122 LEU n 1 123 ASN n 1 124 TYR n 1 125 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 125 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PEG non-polymer . 'DI(HYDROXYETHYL)ETHER' ? 'C4 H10 O3' 106.120 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -3 ? ? ? A . n A 1 2 SER 2 -2 ? ? ? A . n A 1 3 HIS 3 -1 ? ? ? A . n A 1 4 MET 4 0 0 MET MET A . n A 1 5 THR 5 1 1 THR THR A . n A 1 6 GLN 6 2 2 GLN GLN A . n A 1 7 GLU 7 3 3 GLU GLU A . n A 1 8 GLU 8 4 4 GLU GLU A . n A 1 9 VAL 9 5 5 VAL VAL A . n A 1 10 ARG 10 6 6 ARG ARG A . n A 1 11 LYS 11 7 7 LYS LYS A . n A 1 12 ILE 12 8 8 ILE ILE A . n A 1 13 MET 13 9 9 MET MET A . n A 1 14 GLU 14 10 10 GLU GLU A . n A 1 15 LYS 15 11 11 LYS LYS A . n A 1 16 LEU 16 12 12 LEU LEU A . n A 1 17 LYS 17 13 13 LYS LYS A . n A 1 18 LYS 18 14 14 LYS LYS A . n A 1 19 ALA 19 15 15 ALA ALA A . n A 1 20 PHE 20 16 16 PHE PHE A . n A 1 21 LYS 21 17 17 LYS LYS A . n A 1 22 GLN 22 18 18 GLN GLN A . n A 1 23 GLY 23 19 19 GLY GLY A . n A 1 24 ASN 24 20 20 ASN ASN A . n A 1 25 PRO 25 21 21 PRO PRO A . n A 1 26 GLU 26 22 22 GLU GLU A . n A 1 27 GLN 27 23 23 GLN GLN A . n A 1 28 ILE 28 24 24 ILE ILE A . n A 1 29 VAL 29 25 25 VAL VAL A . n A 1 30 SER 30 26 26 SER SER A . n A 1 31 LEU 31 27 27 LEU LEU A . n A 1 32 LEU 32 28 28 LEU LEU A . n A 1 33 SER 33 29 29 SER SER A . n A 1 34 PRO 34 30 30 PRO PRO A . n A 1 35 ASP 35 31 31 ASP ASP A . n A 1 36 VAL 36 32 32 VAL VAL A . n A 1 37 ARG 37 33 33 ARG ARG A . n A 1 38 VAL 38 34 34 VAL VAL A . n A 1 39 LYS 39 35 35 LYS LYS A . n A 1 40 VAL 40 36 36 VAL VAL A . n A 1 41 GLY 41 37 37 GLY GLY A . n A 1 42 ASN 42 38 38 ASN ASN A . n A 1 43 GLN 43 39 39 GLN GLN A . n A 1 44 GLU 44 40 40 GLU GLU A . n A 1 45 PHE 45 41 41 PHE PHE A . n A 1 46 SER 46 42 42 SER SER A . n A 1 47 GLY 47 43 43 GLY GLY A . n A 1 48 SER 48 44 44 SER SER A . n A 1 49 GLU 49 45 45 GLU GLU A . n A 1 50 GLU 50 46 46 GLU GLU A . n A 1 51 ALA 51 47 47 ALA ALA A . n A 1 52 GLU 52 48 48 GLU GLU A . n A 1 53 LYS 53 49 49 LYS LYS A . n A 1 54 MET 54 50 50 MET MET A . n A 1 55 TRP 55 51 51 TRP TRP A . n A 1 56 ARG 56 52 52 ARG ARG A . n A 1 57 LYS 57 53 53 LYS LYS A . n A 1 58 LEU 58 54 54 LEU LEU A . n A 1 59 MET 59 55 55 MET MET A . n A 1 60 LYS 60 56 56 LYS LYS A . n A 1 61 PHE 61 57 57 PHE PHE A . n A 1 62 VAL 62 58 58 VAL VAL A . n A 1 63 ASP 63 59 59 ASP ASP A . n A 1 64 ARG 64 60 60 ARG ARG A . n A 1 65 VAL 65 61 61 VAL VAL A . n A 1 66 GLU 66 62 62 GLU GLU A . n A 1 67 VAL 67 63 63 VAL VAL A . n A 1 68 ARG 68 64 64 ARG ARG A . n A 1 69 ARG 69 65 65 ARG ARG A . n A 1 70 VAL 70 66 66 VAL VAL A . n A 1 71 LYS 71 67 67 LYS LYS A . n A 1 72 VAL 72 68 68 VAL VAL A . n A 1 73 ASP 73 69 69 ASP ASP A . n A 1 74 GLU 74 70 70 GLU GLU A . n A 1 75 ASN 75 71 71 ASN ASN A . n A 1 76 ARG 76 72 72 ARG ARG A . n A 1 77 VAL 77 73 73 VAL VAL A . n A 1 78 GLU 78 74 74 GLU GLU A . n A 1 79 ILE 79 75 75 ILE ILE A . n A 1 80 GLU 80 76 76 GLU GLU A . n A 1 81 VAL 81 77 77 VAL VAL A . n A 1 82 GLU 82 78 78 GLU GLU A . n A 1 83 PHE 83 79 79 PHE PHE A . n A 1 84 GLU 84 80 80 GLU GLU A . n A 1 85 VAL 85 81 81 VAL VAL A . n A 1 86 ASN 86 82 82 ASN ASN A . n A 1 87 GLY 87 83 83 GLY GLY A . n A 1 88 GLN 88 84 84 GLN GLN A . n A 1 89 ARG 89 85 85 ARG ARG A . n A 1 90 TYR 90 86 86 TYR TYR A . n A 1 91 SER 91 87 87 SER SER A . n A 1 92 MET 92 88 88 MET MET A . n A 1 93 GLU 93 89 89 GLU GLU A . n A 1 94 PHE 94 90 90 PHE PHE A . n A 1 95 HIS 95 91 91 HIS HIS A . n A 1 96 PHE 96 92 92 PHE PHE A . n A 1 97 GLU 97 93 93 GLU GLU A . n A 1 98 VAL 98 94 94 VAL VAL A . n A 1 99 GLU 99 95 95 GLU GLU A . n A 1 100 ASN 100 96 96 ASN ASN A . n A 1 101 GLY 101 97 97 GLY GLY A . n A 1 102 LYS 102 98 98 LYS LYS A . n A 1 103 VAL 103 99 99 VAL VAL A . n A 1 104 ARG 104 100 100 ARG ARG A . n A 1 105 ARG 105 101 101 ARG ARG A . n A 1 106 VAL 106 102 102 VAL VAL A . n A 1 107 GLU 107 103 103 GLU GLU A . n A 1 108 ILE 108 104 104 ILE ILE A . n A 1 109 ARG 109 105 105 ARG ARG A . n A 1 110 ILE 110 106 106 ILE ILE A . n A 1 111 SER 111 107 107 SER SER A . n A 1 112 PRO 112 108 108 PRO PRO A . n A 1 113 THR 113 109 109 THR THR A . n A 1 114 MET 114 110 110 MET MET A . n A 1 115 LYS 115 111 111 LYS LYS A . n A 1 116 LYS 116 112 112 LYS LYS A . n A 1 117 LEU 117 113 113 LEU LEU A . n A 1 118 MET 118 114 114 MET MET A . n A 1 119 LYS 119 115 115 LYS LYS A . n A 1 120 GLN 120 116 116 GLN GLN A . n A 1 121 ILE 121 117 117 ILE ILE A . n A 1 122 LEU 122 118 ? ? ? A . n A 1 123 ASN 123 119 ? ? ? A . n A 1 124 TYR 124 120 ? ? ? A . n A 1 125 GLY 125 121 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PEG 1 201 1 PEG PEG A . C 3 HOH 1 301 8 HOH HOH A . C 3 HOH 2 302 4 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 3 ? CG ? A GLU 7 CG 2 1 Y 1 A GLU 3 ? CD ? A GLU 7 CD 3 1 Y 1 A GLU 3 ? OE1 ? A GLU 7 OE1 4 1 Y 1 A GLU 3 ? OE2 ? A GLU 7 OE2 5 1 Y 1 A ARG 6 ? CG ? A ARG 10 CG 6 1 Y 1 A ARG 6 ? CD ? A ARG 10 CD 7 1 Y 1 A ARG 6 ? NE ? A ARG 10 NE 8 1 Y 1 A ARG 6 ? CZ ? A ARG 10 CZ 9 1 Y 1 A ARG 6 ? NH1 ? A ARG 10 NH1 10 1 Y 1 A ARG 6 ? NH2 ? A ARG 10 NH2 11 1 Y 1 A LYS 7 ? CG ? A LYS 11 CG 12 1 Y 1 A LYS 7 ? CD ? A LYS 11 CD 13 1 Y 1 A LYS 7 ? CE ? A LYS 11 CE 14 1 Y 1 A LYS 7 ? NZ ? A LYS 11 NZ 15 1 Y 1 A LYS 14 ? CG ? A LYS 18 CG 16 1 Y 1 A LYS 14 ? CD ? A LYS 18 CD 17 1 Y 1 A LYS 14 ? CE ? A LYS 18 CE 18 1 Y 1 A LYS 14 ? NZ ? A LYS 18 NZ 19 1 Y 1 A LYS 17 ? CG ? A LYS 21 CG 20 1 Y 1 A LYS 17 ? CD ? A LYS 21 CD 21 1 Y 1 A LYS 17 ? CE ? A LYS 21 CE 22 1 Y 1 A LYS 17 ? NZ ? A LYS 21 NZ 23 1 Y 1 A ASN 20 ? CG ? A ASN 24 CG 24 1 Y 1 A ASN 20 ? OD1 ? A ASN 24 OD1 25 1 Y 1 A ASN 20 ? ND2 ? A ASN 24 ND2 26 1 Y 1 A GLU 22 ? CG ? A GLU 26 CG 27 1 Y 1 A GLU 22 ? CD ? A GLU 26 CD 28 1 Y 1 A GLU 22 ? OE1 ? A GLU 26 OE1 29 1 Y 1 A GLU 22 ? OE2 ? A GLU 26 OE2 30 1 Y 1 A GLN 23 ? CG ? A GLN 27 CG 31 1 Y 1 A GLN 23 ? CD ? A GLN 27 CD 32 1 Y 1 A GLN 23 ? OE1 ? A GLN 27 OE1 33 1 Y 1 A GLN 23 ? NE2 ? A GLN 27 NE2 34 1 Y 1 A GLU 45 ? CG ? A GLU 49 CG 35 1 Y 1 A GLU 45 ? CD ? A GLU 49 CD 36 1 Y 1 A GLU 45 ? OE1 ? A GLU 49 OE1 37 1 Y 1 A GLU 45 ? OE2 ? A GLU 49 OE2 38 1 Y 1 A LYS 49 ? CG ? A LYS 53 CG 39 1 Y 1 A LYS 49 ? CD ? A LYS 53 CD 40 1 Y 1 A LYS 49 ? CE ? A LYS 53 CE 41 1 Y 1 A LYS 49 ? NZ ? A LYS 53 NZ 42 1 Y 1 A LYS 56 ? CG ? A LYS 60 CG 43 1 Y 1 A LYS 56 ? CD ? A LYS 60 CD 44 1 Y 1 A LYS 56 ? CE ? A LYS 60 CE 45 1 Y 1 A LYS 56 ? NZ ? A LYS 60 NZ 46 1 Y 1 A ASP 59 ? CG ? A ASP 63 CG 47 1 Y 1 A ASP 59 ? OD1 ? A ASP 63 OD1 48 1 Y 1 A ASP 59 ? OD2 ? A ASP 63 OD2 49 1 Y 1 A ARG 60 ? CG ? A ARG 64 CG 50 1 Y 1 A ARG 60 ? CD ? A ARG 64 CD 51 1 Y 1 A ARG 60 ? NE ? A ARG 64 NE 52 1 Y 1 A ARG 60 ? CZ ? A ARG 64 CZ 53 1 Y 1 A ARG 60 ? NH1 ? A ARG 64 NH1 54 1 Y 1 A ARG 60 ? NH2 ? A ARG 64 NH2 55 1 Y 1 A ASN 82 ? CG ? A ASN 86 CG 56 1 Y 1 A ASN 82 ? OD1 ? A ASN 86 OD1 57 1 Y 1 A ASN 82 ? ND2 ? A ASN 86 ND2 58 1 Y 1 A ARG 85 ? NE ? A ARG 89 NE 59 1 Y 1 A ARG 85 ? CZ ? A ARG 89 CZ 60 1 Y 1 A ARG 85 ? NH1 ? A ARG 89 NH1 61 1 Y 1 A ARG 85 ? NH2 ? A ARG 89 NH2 62 1 Y 1 A LYS 98 ? CG ? A LYS 102 CG 63 1 Y 1 A LYS 98 ? CD ? A LYS 102 CD 64 1 Y 1 A LYS 98 ? CE ? A LYS 102 CE 65 1 Y 1 A LYS 98 ? NZ ? A LYS 102 NZ 66 1 Y 1 A LYS 111 ? CG ? A LYS 115 CG 67 1 Y 1 A LYS 111 ? CD ? A LYS 115 CD 68 1 Y 1 A LYS 111 ? CE ? A LYS 115 CE 69 1 Y 1 A LYS 111 ? NZ ? A LYS 115 NZ 70 1 Y 1 A LYS 112 ? CG ? A LYS 116 CG 71 1 Y 1 A LYS 112 ? CD ? A LYS 116 CD 72 1 Y 1 A LYS 112 ? CE ? A LYS 116 CE 73 1 Y 1 A LYS 112 ? NZ ? A LYS 116 NZ 74 1 Y 1 A LYS 115 ? CG ? A LYS 119 CG 75 1 Y 1 A LYS 115 ? CD ? A LYS 119 CD 76 1 Y 1 A LYS 115 ? CE ? A LYS 119 CE 77 1 Y 1 A LYS 115 ? NZ ? A LYS 119 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? dev_1616 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? 7.1.0 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.2.8 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.5.6 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5TRV _cell.details ? _cell.formula_units_Z ? _cell.length_a 75.530 _cell.length_a_esd ? _cell.length_b 75.530 _cell.length_b_esd ? _cell.length_c 50.070 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5TRV _symmetry.cell_setting ? _symmetry.Int_Tables_number 94 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 42 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5TRV _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.45 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.79 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.1 M bicine/Trizma base, pH 8.5, 10% PEG 20 000, 20% PEG MME 550 and 0.03 M of each ethylene glycol (diethyleneglycol, triethyleneglycol, tetraethyleneglycol and pentaethyleneglycol). ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-06-01 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 8.2.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 8.2.1 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5TRV _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.91 _reflns.d_resolution_low 41.73 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 3349 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.5 _reflns.pdbx_Rmerge_I_obs 0.034 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 72.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5TRV _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.910 _refine.ls_d_res_low 41.73 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 3316 _refine.ls_number_reflns_R_free 300 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 95.95 _refine.ls_percent_reflns_R_free 9.05 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2535 _refine.ls_R_factor_R_free 0.2971 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2494 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 33.52 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.38 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 910 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 7 _refine_hist.number_atoms_solvent 2 _refine_hist.number_atoms_total 919 _refine_hist.d_res_high 2.910 _refine_hist.d_res_low 41.73 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? 928 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.521 ? 1247 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 13.829 ? 348 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.021 ? 142 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.002 ? 163 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.9101 3.6661 . . 141 1501 98.00 . . . 0.2979 . 0.2862 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.6661 41.7371 . . 159 1515 94.00 . . . 0.2968 . 0.2354 . . . . . . . . . . # _struct.entry_id 5TRV _struct.title 'Crystal structure of a de novo designed protein with curved beta-sheet' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5TRV _struct_keywords.text 'de novo NTF2, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 5TRV _struct_ref.pdbx_db_accession 5TRV _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5TRV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 125 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 5TRV _struct_ref_seq.db_align_beg -3 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 121 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -3 _struct_ref_seq.pdbx_auth_seq_align_end 121 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 5 ? GLY A 23 ? THR A 1 GLY A 19 1 ? 19 HELX_P HELX_P2 AA2 ASN A 24 ? LEU A 31 ? ASN A 20 LEU A 27 1 ? 8 HELX_P HELX_P3 AA3 GLY A 47 ? VAL A 62 ? GLY A 43 VAL A 58 1 ? 16 HELX_P HELX_P4 AA4 PRO A 112 ? LYS A 115 ? PRO A 108 LYS A 111 5 ? 4 HELX_P HELX_P5 AA5 LYS A 116 ? ILE A 121 ? LYS A 112 ILE A 117 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 43 ? SER A 46 ? GLN A 39 SER A 42 AA1 2 LEU A 32 ? VAL A 40 ? LEU A 28 VAL A 36 AA1 3 LYS A 102 ? ILE A 110 ? LYS A 98 ILE A 106 AA1 4 ARG A 89 ? GLU A 99 ? ARG A 85 GLU A 95 AA1 5 ARG A 76 ? GLU A 84 ? ARG A 72 GLU A 80 AA1 6 VAL A 65 ? ASP A 73 ? VAL A 61 ASP A 69 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O PHE A 45 ? O PHE A 41 N VAL A 38 ? N VAL A 34 AA1 2 3 N LYS A 39 ? N LYS A 35 O VAL A 106 ? O VAL A 102 AA1 3 4 O GLU A 107 ? O GLU A 103 N HIS A 95 ? N HIS A 91 AA1 4 5 O PHE A 96 ? O PHE A 92 N VAL A 77 ? N VAL A 73 AA1 5 6 O GLU A 82 ? O GLU A 78 N GLU A 66 ? N GLU A 62 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id PEG _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'binding site for residue PEG A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 GLN A 43 ? GLN A 39 . ? 1_555 ? 2 AC1 5 PHE A 45 ? PHE A 41 . ? 1_555 ? 3 AC1 5 MET A 54 ? MET A 50 . ? 1_555 ? 4 AC1 5 MET A 118 ? MET A 114 . ? 1_555 ? 5 AC1 5 ILE A 121 ? ILE A 117 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 70 ? ? 55.30 -119.94 2 1 GLN A 116 ? ? -85.57 34.30 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -3 ? A GLY 1 2 1 Y 1 A SER -2 ? A SER 2 3 1 Y 1 A HIS -1 ? A HIS 3 4 1 Y 1 A LEU 118 ? A LEU 122 5 1 Y 1 A ASN 119 ? A ASN 123 6 1 Y 1 A TYR 120 ? A TYR 124 7 1 Y 1 A GLY 121 ? A GLY 125 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PEG C1 C N N 236 PEG O1 O N N 237 PEG C2 C N N 238 PEG O2 O N N 239 PEG C3 C N N 240 PEG C4 C N N 241 PEG O4 O N N 242 PEG H11 H N N 243 PEG H12 H N N 244 PEG HO1 H N N 245 PEG H21 H N N 246 PEG H22 H N N 247 PEG H31 H N N 248 PEG H32 H N N 249 PEG H41 H N N 250 PEG H42 H N N 251 PEG HO4 H N N 252 PHE N N N N 253 PHE CA C N S 254 PHE C C N N 255 PHE O O N N 256 PHE CB C N N 257 PHE CG C Y N 258 PHE CD1 C Y N 259 PHE CD2 C Y N 260 PHE CE1 C Y N 261 PHE CE2 C Y N 262 PHE CZ C Y N 263 PHE OXT O N N 264 PHE H H N N 265 PHE H2 H N N 266 PHE HA H N N 267 PHE HB2 H N N 268 PHE HB3 H N N 269 PHE HD1 H N N 270 PHE HD2 H N N 271 PHE HE1 H N N 272 PHE HE2 H N N 273 PHE HZ H N N 274 PHE HXT H N N 275 PRO N N N N 276 PRO CA C N S 277 PRO C C N N 278 PRO O O N N 279 PRO CB C N N 280 PRO CG C N N 281 PRO CD C N N 282 PRO OXT O N N 283 PRO H H N N 284 PRO HA H N N 285 PRO HB2 H N N 286 PRO HB3 H N N 287 PRO HG2 H N N 288 PRO HG3 H N N 289 PRO HD2 H N N 290 PRO HD3 H N N 291 PRO HXT H N N 292 SER N N N N 293 SER CA C N S 294 SER C C N N 295 SER O O N N 296 SER CB C N N 297 SER OG O N N 298 SER OXT O N N 299 SER H H N N 300 SER H2 H N N 301 SER HA H N N 302 SER HB2 H N N 303 SER HB3 H N N 304 SER HG H N N 305 SER HXT H N N 306 THR N N N N 307 THR CA C N S 308 THR C C N N 309 THR O O N N 310 THR CB C N R 311 THR OG1 O N N 312 THR CG2 C N N 313 THR OXT O N N 314 THR H H N N 315 THR H2 H N N 316 THR HA H N N 317 THR HB H N N 318 THR HG1 H N N 319 THR HG21 H N N 320 THR HG22 H N N 321 THR HG23 H N N 322 THR HXT H N N 323 TRP N N N N 324 TRP CA C N S 325 TRP C C N N 326 TRP O O N N 327 TRP CB C N N 328 TRP CG C Y N 329 TRP CD1 C Y N 330 TRP CD2 C Y N 331 TRP NE1 N Y N 332 TRP CE2 C Y N 333 TRP CE3 C Y N 334 TRP CZ2 C Y N 335 TRP CZ3 C Y N 336 TRP CH2 C Y N 337 TRP OXT O N N 338 TRP H H N N 339 TRP H2 H N N 340 TRP HA H N N 341 TRP HB2 H N N 342 TRP HB3 H N N 343 TRP HD1 H N N 344 TRP HE1 H N N 345 TRP HE3 H N N 346 TRP HZ2 H N N 347 TRP HZ3 H N N 348 TRP HH2 H N N 349 TRP HXT H N N 350 TYR N N N N 351 TYR CA C N S 352 TYR C C N N 353 TYR O O N N 354 TYR CB C N N 355 TYR CG C Y N 356 TYR CD1 C Y N 357 TYR CD2 C Y N 358 TYR CE1 C Y N 359 TYR CE2 C Y N 360 TYR CZ C Y N 361 TYR OH O N N 362 TYR OXT O N N 363 TYR H H N N 364 TYR H2 H N N 365 TYR HA H N N 366 TYR HB2 H N N 367 TYR HB3 H N N 368 TYR HD1 H N N 369 TYR HD2 H N N 370 TYR HE1 H N N 371 TYR HE2 H N N 372 TYR HH H N N 373 TYR HXT H N N 374 VAL N N N N 375 VAL CA C N S 376 VAL C C N N 377 VAL O O N N 378 VAL CB C N N 379 VAL CG1 C N N 380 VAL CG2 C N N 381 VAL OXT O N N 382 VAL H H N N 383 VAL H2 H N N 384 VAL HA H N N 385 VAL HB H N N 386 VAL HG11 H N N 387 VAL HG12 H N N 388 VAL HG13 H N N 389 VAL HG21 H N N 390 VAL HG22 H N N 391 VAL HG23 H N N 392 VAL HXT H N N 393 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PEG C1 O1 sing N N 224 PEG C1 C2 sing N N 225 PEG C1 H11 sing N N 226 PEG C1 H12 sing N N 227 PEG O1 HO1 sing N N 228 PEG C2 O2 sing N N 229 PEG C2 H21 sing N N 230 PEG C2 H22 sing N N 231 PEG O2 C3 sing N N 232 PEG C3 C4 sing N N 233 PEG C3 H31 sing N N 234 PEG C3 H32 sing N N 235 PEG C4 O4 sing N N 236 PEG C4 H41 sing N N 237 PEG C4 H42 sing N N 238 PEG O4 HO4 sing N N 239 PHE N CA sing N N 240 PHE N H sing N N 241 PHE N H2 sing N N 242 PHE CA C sing N N 243 PHE CA CB sing N N 244 PHE CA HA sing N N 245 PHE C O doub N N 246 PHE C OXT sing N N 247 PHE CB CG sing N N 248 PHE CB HB2 sing N N 249 PHE CB HB3 sing N N 250 PHE CG CD1 doub Y N 251 PHE CG CD2 sing Y N 252 PHE CD1 CE1 sing Y N 253 PHE CD1 HD1 sing N N 254 PHE CD2 CE2 doub Y N 255 PHE CD2 HD2 sing N N 256 PHE CE1 CZ doub Y N 257 PHE CE1 HE1 sing N N 258 PHE CE2 CZ sing Y N 259 PHE CE2 HE2 sing N N 260 PHE CZ HZ sing N N 261 PHE OXT HXT sing N N 262 PRO N CA sing N N 263 PRO N CD sing N N 264 PRO N H sing N N 265 PRO CA C sing N N 266 PRO CA CB sing N N 267 PRO CA HA sing N N 268 PRO C O doub N N 269 PRO C OXT sing N N 270 PRO CB CG sing N N 271 PRO CB HB2 sing N N 272 PRO CB HB3 sing N N 273 PRO CG CD sing N N 274 PRO CG HG2 sing N N 275 PRO CG HG3 sing N N 276 PRO CD HD2 sing N N 277 PRO CD HD3 sing N N 278 PRO OXT HXT sing N N 279 SER N CA sing N N 280 SER N H sing N N 281 SER N H2 sing N N 282 SER CA C sing N N 283 SER CA CB sing N N 284 SER CA HA sing N N 285 SER C O doub N N 286 SER C OXT sing N N 287 SER CB OG sing N N 288 SER CB HB2 sing N N 289 SER CB HB3 sing N N 290 SER OG HG sing N N 291 SER OXT HXT sing N N 292 THR N CA sing N N 293 THR N H sing N N 294 THR N H2 sing N N 295 THR CA C sing N N 296 THR CA CB sing N N 297 THR CA HA sing N N 298 THR C O doub N N 299 THR C OXT sing N N 300 THR CB OG1 sing N N 301 THR CB CG2 sing N N 302 THR CB HB sing N N 303 THR OG1 HG1 sing N N 304 THR CG2 HG21 sing N N 305 THR CG2 HG22 sing N N 306 THR CG2 HG23 sing N N 307 THR OXT HXT sing N N 308 TRP N CA sing N N 309 TRP N H sing N N 310 TRP N H2 sing N N 311 TRP CA C sing N N 312 TRP CA CB sing N N 313 TRP CA HA sing N N 314 TRP C O doub N N 315 TRP C OXT sing N N 316 TRP CB CG sing N N 317 TRP CB HB2 sing N N 318 TRP CB HB3 sing N N 319 TRP CG CD1 doub Y N 320 TRP CG CD2 sing Y N 321 TRP CD1 NE1 sing Y N 322 TRP CD1 HD1 sing N N 323 TRP CD2 CE2 doub Y N 324 TRP CD2 CE3 sing Y N 325 TRP NE1 CE2 sing Y N 326 TRP NE1 HE1 sing N N 327 TRP CE2 CZ2 sing Y N 328 TRP CE3 CZ3 doub Y N 329 TRP CE3 HE3 sing N N 330 TRP CZ2 CH2 doub Y N 331 TRP CZ2 HZ2 sing N N 332 TRP CZ3 CH2 sing Y N 333 TRP CZ3 HZ3 sing N N 334 TRP CH2 HH2 sing N N 335 TRP OXT HXT sing N N 336 TYR N CA sing N N 337 TYR N H sing N N 338 TYR N H2 sing N N 339 TYR CA C sing N N 340 TYR CA CB sing N N 341 TYR CA HA sing N N 342 TYR C O doub N N 343 TYR C OXT sing N N 344 TYR CB CG sing N N 345 TYR CB HB2 sing N N 346 TYR CB HB3 sing N N 347 TYR CG CD1 doub Y N 348 TYR CG CD2 sing Y N 349 TYR CD1 CE1 sing Y N 350 TYR CD1 HD1 sing N N 351 TYR CD2 CE2 doub Y N 352 TYR CD2 HD2 sing N N 353 TYR CE1 CZ doub Y N 354 TYR CE1 HE1 sing N N 355 TYR CE2 CZ sing Y N 356 TYR CE2 HE2 sing N N 357 TYR CZ OH sing N N 358 TYR OH HH sing N N 359 TYR OXT HXT sing N N 360 VAL N CA sing N N 361 VAL N H sing N N 362 VAL N H2 sing N N 363 VAL CA C sing N N 364 VAL CA CB sing N N 365 VAL CA HA sing N N 366 VAL C O doub N N 367 VAL C OXT sing N N 368 VAL CB CG1 sing N N 369 VAL CB CG2 sing N N 370 VAL CB HB sing N N 371 VAL CG1 HG11 sing N N 372 VAL CG1 HG12 sing N N 373 VAL CG1 HG13 sing N N 374 VAL CG2 HG21 sing N N 375 VAL CG2 HG22 sing N N 376 VAL CG2 HG23 sing N N 377 VAL OXT HXT sing N N 378 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Defense Threat Reduction Agency (DTRA)' 'United States' 'HDTRA 1-11-1-0041' 1 'European Commission' Spain 'FP7-PEOPLE-2011-IOF 298976' 2 'European Commission' Austria '332094 ASR-CompEnzDes FP7-PEOPLE-2012-IOF' 3 'Department of Energy (DOE, United States)' 'United States' DE-AC02-05CH11231 4 # _atom_sites.entry_id 5TRV _atom_sites.fract_transf_matrix[1][1] 0.013240 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013240 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019972 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_