data_5TS2 # _entry.id 5TS2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5TS2 pdb_00005ts2 10.2210/pdb5ts2/pdb WWPDB D_1000224714 ? ? # _pdbx_database_related.db_name TargetTrack _pdbx_database_related.db_id SSGCID-PsaeA.00960.a _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5TS2 _pdbx_database_status.recvd_initial_deposition_date 2016-10-27 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _audit_author.name 'Seattle Structural Genomics Center for Infectious Disease (SSGCID)' _audit_author.pdbx_ordinal 1 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Crystal structure of a phosphopantetheine adenylyltransferase (CoaD, PPAT) from Pseudomonas aeruginosa bound to dephospho coenzyme A ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Edwards, T.E.' 1 ? primary 'Davies, D.R.' 2 ? primary 'Fairman, J.W.' 3 ? primary 'Lorimer, D.' 4 ? primary 'Seattle Structural Genomics Center for Infectious Disease (SSGCID)' 5 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5TS2 _cell.details ? _cell.formula_units_Z ? _cell.length_a 98.380 _cell.length_a_esd ? _cell.length_b 101.350 _cell.length_b_esd ? _cell.length_c 105.710 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5TS2 _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Phosphopantetheine adenylyltransferase' 18826.633 6 2.7.7.3 ? ? ? 2 non-polymer syn 'DEPHOSPHO COENZYME A' 687.554 6 ? ? ? ? 3 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? 4 non-polymer syn 'CHLORIDE ION' 35.453 11 ? ? ? ? 5 water nat water 18.015 189 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Dephospho-CoA pyrophosphorylase,Pantetheine-phosphate adenylyltransferase,PPAT' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAHHHHHHMNRVLYPGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKNPLFSLEQRVALAQEVTKHLPNVEVVGFSTL LAHFVKEQKANVFLRGLRAVSDFEYEFQLANMNRQLAPDVESMFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADA LAERFKR ; _entity_poly.pdbx_seq_one_letter_code_can ;MAHHHHHHMNRVLYPGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKNPLFSLEQRVALAQEVTKHLPNVEVVGFSTL LAHFVKEQKANVFLRGLRAVSDFEYEFQLANMNRQLAPDVESMFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADA LAERFKR ; _entity_poly.pdbx_strand_id A,B,C,D,E,F _entity_poly.pdbx_target_identifier SSGCID-PsaeA.00960.a # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 MET n 1 10 ASN n 1 11 ARG n 1 12 VAL n 1 13 LEU n 1 14 TYR n 1 15 PRO n 1 16 GLY n 1 17 THR n 1 18 PHE n 1 19 ASP n 1 20 PRO n 1 21 ILE n 1 22 THR n 1 23 LYS n 1 24 GLY n 1 25 HIS n 1 26 GLY n 1 27 ASP n 1 28 LEU n 1 29 ILE n 1 30 GLU n 1 31 ARG n 1 32 ALA n 1 33 SER n 1 34 ARG n 1 35 LEU n 1 36 PHE n 1 37 ASP n 1 38 HIS n 1 39 VAL n 1 40 ILE n 1 41 ILE n 1 42 ALA n 1 43 VAL n 1 44 ALA n 1 45 ALA n 1 46 SER n 1 47 PRO n 1 48 LYS n 1 49 LYS n 1 50 ASN n 1 51 PRO n 1 52 LEU n 1 53 PHE n 1 54 SER n 1 55 LEU n 1 56 GLU n 1 57 GLN n 1 58 ARG n 1 59 VAL n 1 60 ALA n 1 61 LEU n 1 62 ALA n 1 63 GLN n 1 64 GLU n 1 65 VAL n 1 66 THR n 1 67 LYS n 1 68 HIS n 1 69 LEU n 1 70 PRO n 1 71 ASN n 1 72 VAL n 1 73 GLU n 1 74 VAL n 1 75 VAL n 1 76 GLY n 1 77 PHE n 1 78 SER n 1 79 THR n 1 80 LEU n 1 81 LEU n 1 82 ALA n 1 83 HIS n 1 84 PHE n 1 85 VAL n 1 86 LYS n 1 87 GLU n 1 88 GLN n 1 89 LYS n 1 90 ALA n 1 91 ASN n 1 92 VAL n 1 93 PHE n 1 94 LEU n 1 95 ARG n 1 96 GLY n 1 97 LEU n 1 98 ARG n 1 99 ALA n 1 100 VAL n 1 101 SER n 1 102 ASP n 1 103 PHE n 1 104 GLU n 1 105 TYR n 1 106 GLU n 1 107 PHE n 1 108 GLN n 1 109 LEU n 1 110 ALA n 1 111 ASN n 1 112 MET n 1 113 ASN n 1 114 ARG n 1 115 GLN n 1 116 LEU n 1 117 ALA n 1 118 PRO n 1 119 ASP n 1 120 VAL n 1 121 GLU n 1 122 SER n 1 123 MET n 1 124 PHE n 1 125 LEU n 1 126 THR n 1 127 PRO n 1 128 SER n 1 129 GLU n 1 130 LYS n 1 131 TYR n 1 132 SER n 1 133 PHE n 1 134 ILE n 1 135 SER n 1 136 SER n 1 137 THR n 1 138 LEU n 1 139 VAL n 1 140 ARG n 1 141 GLU n 1 142 ILE n 1 143 ALA n 1 144 ALA n 1 145 LEU n 1 146 GLY n 1 147 GLY n 1 148 ASP n 1 149 ILE n 1 150 SER n 1 151 LYS n 1 152 PHE n 1 153 VAL n 1 154 HIS n 1 155 PRO n 1 156 ALA n 1 157 VAL n 1 158 ALA n 1 159 ASP n 1 160 ALA n 1 161 LEU n 1 162 ALA n 1 163 GLU n 1 164 ARG n 1 165 PHE n 1 166 LYS n 1 167 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 167 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'coaD, PLES_03601' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain LESB58 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas aeruginosa (strain LESB58)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 557722 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code COAD_PSEA8 _struct_ref.pdbx_db_accession B7V2S6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNRVLYPGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKNPLFSLEQRVALAQEVTKHLPNVEVVGFSTLLAHFVKEQ KANVFLRGLRAVSDFEYEFQLANMNRQLAPDVESMFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALAERFKR ; _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5TS2 A 9 ? 167 ? B7V2S6 1 ? 159 ? 1 159 2 1 5TS2 B 9 ? 167 ? B7V2S6 1 ? 159 ? 1 159 3 1 5TS2 C 9 ? 167 ? B7V2S6 1 ? 159 ? 1 159 4 1 5TS2 D 9 ? 167 ? B7V2S6 1 ? 159 ? 1 159 5 1 5TS2 E 9 ? 167 ? B7V2S6 1 ? 159 ? 1 159 6 1 5TS2 F 9 ? 167 ? B7V2S6 1 ? 159 ? 1 159 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5TS2 MET A 1 ? UNP B7V2S6 ? ? 'initiating methionine' -7 1 1 5TS2 ALA A 2 ? UNP B7V2S6 ? ? 'expression tag' -6 2 1 5TS2 HIS A 3 ? UNP B7V2S6 ? ? 'expression tag' -5 3 1 5TS2 HIS A 4 ? UNP B7V2S6 ? ? 'expression tag' -4 4 1 5TS2 HIS A 5 ? UNP B7V2S6 ? ? 'expression tag' -3 5 1 5TS2 HIS A 6 ? UNP B7V2S6 ? ? 'expression tag' -2 6 1 5TS2 HIS A 7 ? UNP B7V2S6 ? ? 'expression tag' -1 7 1 5TS2 HIS A 8 ? UNP B7V2S6 ? ? 'expression tag' 0 8 2 5TS2 MET B 1 ? UNP B7V2S6 ? ? 'initiating methionine' -7 9 2 5TS2 ALA B 2 ? UNP B7V2S6 ? ? 'expression tag' -6 10 2 5TS2 HIS B 3 ? UNP B7V2S6 ? ? 'expression tag' -5 11 2 5TS2 HIS B 4 ? UNP B7V2S6 ? ? 'expression tag' -4 12 2 5TS2 HIS B 5 ? UNP B7V2S6 ? ? 'expression tag' -3 13 2 5TS2 HIS B 6 ? UNP B7V2S6 ? ? 'expression tag' -2 14 2 5TS2 HIS B 7 ? UNP B7V2S6 ? ? 'expression tag' -1 15 2 5TS2 HIS B 8 ? UNP B7V2S6 ? ? 'expression tag' 0 16 3 5TS2 MET C 1 ? UNP B7V2S6 ? ? 'initiating methionine' -7 17 3 5TS2 ALA C 2 ? UNP B7V2S6 ? ? 'expression tag' -6 18 3 5TS2 HIS C 3 ? UNP B7V2S6 ? ? 'expression tag' -5 19 3 5TS2 HIS C 4 ? UNP B7V2S6 ? ? 'expression tag' -4 20 3 5TS2 HIS C 5 ? UNP B7V2S6 ? ? 'expression tag' -3 21 3 5TS2 HIS C 6 ? UNP B7V2S6 ? ? 'expression tag' -2 22 3 5TS2 HIS C 7 ? UNP B7V2S6 ? ? 'expression tag' -1 23 3 5TS2 HIS C 8 ? UNP B7V2S6 ? ? 'expression tag' 0 24 4 5TS2 MET D 1 ? UNP B7V2S6 ? ? 'initiating methionine' -7 25 4 5TS2 ALA D 2 ? UNP B7V2S6 ? ? 'expression tag' -6 26 4 5TS2 HIS D 3 ? UNP B7V2S6 ? ? 'expression tag' -5 27 4 5TS2 HIS D 4 ? UNP B7V2S6 ? ? 'expression tag' -4 28 4 5TS2 HIS D 5 ? UNP B7V2S6 ? ? 'expression tag' -3 29 4 5TS2 HIS D 6 ? UNP B7V2S6 ? ? 'expression tag' -2 30 4 5TS2 HIS D 7 ? UNP B7V2S6 ? ? 'expression tag' -1 31 4 5TS2 HIS D 8 ? UNP B7V2S6 ? ? 'expression tag' 0 32 5 5TS2 MET E 1 ? UNP B7V2S6 ? ? 'initiating methionine' -7 33 5 5TS2 ALA E 2 ? UNP B7V2S6 ? ? 'expression tag' -6 34 5 5TS2 HIS E 3 ? UNP B7V2S6 ? ? 'expression tag' -5 35 5 5TS2 HIS E 4 ? UNP B7V2S6 ? ? 'expression tag' -4 36 5 5TS2 HIS E 5 ? UNP B7V2S6 ? ? 'expression tag' -3 37 5 5TS2 HIS E 6 ? UNP B7V2S6 ? ? 'expression tag' -2 38 5 5TS2 HIS E 7 ? UNP B7V2S6 ? ? 'expression tag' -1 39 5 5TS2 HIS E 8 ? UNP B7V2S6 ? ? 'expression tag' 0 40 6 5TS2 MET F 1 ? UNP B7V2S6 ? ? 'initiating methionine' -7 41 6 5TS2 ALA F 2 ? UNP B7V2S6 ? ? 'expression tag' -6 42 6 5TS2 HIS F 3 ? UNP B7V2S6 ? ? 'expression tag' -5 43 6 5TS2 HIS F 4 ? UNP B7V2S6 ? ? 'expression tag' -4 44 6 5TS2 HIS F 5 ? UNP B7V2S6 ? ? 'expression tag' -3 45 6 5TS2 HIS F 6 ? UNP B7V2S6 ? ? 'expression tag' -2 46 6 5TS2 HIS F 7 ? UNP B7V2S6 ? ? 'expression tag' -1 47 6 5TS2 HIS F 8 ? UNP B7V2S6 ? ? 'expression tag' 0 48 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 COD non-polymer . 'DEPHOSPHO COENZYME A' ? 'C21 H35 N7 O13 P2 S' 687.554 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5TS2 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.33 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.27 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;PsaeA.00960.a.B1 batch PS02167 at 18.6 against MCSG1 screen condition E9 0.2 M CaCl2, 20% PEG 3350 supplemented with 20% ethylene glycol, 2 mM MgCl, and 2 mM ATP in the cryo-protectant, crystal tracking ID 259488e9, unique puck ID sls7-3 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 300 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-03-12 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97872 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-F' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97872 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-F _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 43.250 _reflns.entry_id 5TS2 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.300 _reflns.d_resolution_low 46.8650 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 46486 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3.000 _reflns.percent_possible_obs 97.500 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.7 _reflns.pdbx_Rmerge_I_obs 0.057 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 16.630 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.300 2.360 ? 3.020 ? ? ? ? ? 99.000 ? ? ? ? 0.507 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 1 0.824 ? 2.360 2.420 ? 3.700 ? ? ? ? ? 98.800 ? ? ? ? 0.411 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 0.867 ? 2.420 2.490 ? 4.300 ? ? ? ? ? 98.700 ? ? ? ? 0.360 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 3 1 0.900 ? 2.490 2.570 ? 5.380 ? ? ? ? ? 98.400 ? ? ? ? 0.279 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 4 1 0.927 ? 2.570 2.660 ? 6.550 ? ? ? ? ? 98.000 ? ? ? ? 0.227 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 5 1 0.951 ? 2.660 2.750 ? 7.800 ? ? ? ? ? 98.500 ? ? ? ? 0.187 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 6 1 0.969 ? 2.750 2.850 ? 10.250 ? ? ? ? ? 98.300 ? ? ? ? 0.139 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 7 1 0.984 ? 2.850 2.970 ? 12.600 ? ? ? ? ? 97.600 ? ? ? ? 0.110 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 8 1 0.989 ? 2.970 3.100 ? 15.900 ? ? ? ? ? 98.000 ? ? ? ? 0.083 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 9 1 0.993 ? 3.100 3.250 ? 17.970 ? ? ? ? ? 97.600 ? ? ? ? 0.072 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 10 1 0.995 ? 3.250 3.430 ? 22.340 ? ? ? ? ? 97.500 ? ? ? ? 0.056 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 11 1 0.997 ? 3.430 3.640 ? 26.080 ? ? ? ? ? 96.800 ? ? ? ? 0.046 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 12 1 0.998 ? 3.640 3.890 ? 29.340 ? ? ? ? ? 97.200 ? ? ? ? 0.042 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 13 1 0.998 ? 3.890 4.200 ? 32.660 ? ? ? ? ? 96.800 ? ? ? ? 0.037 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 14 1 0.998 ? 4.200 4.600 ? 35.170 ? ? ? ? ? 96.400 ? ? ? ? 0.035 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 15 1 0.998 ? 4.600 5.140 ? 36.760 ? ? ? ? ? 95.600 ? ? ? ? 0.034 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 16 1 0.998 ? 5.140 5.940 ? 34.970 ? ? ? ? ? 95.600 ? ? ? ? 0.036 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 17 1 0.998 ? 5.940 7.270 ? 36.170 ? ? ? ? ? 94.900 ? ? ? ? 0.032 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 18 1 0.999 ? 7.270 10.290 ? 41.560 ? ? ? ? ? 93.700 ? ? ? ? 0.029 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 19 1 0.999 ? 10.290 ? ? 40.410 ? ? ? ? ? 88.400 ? ? ? ? 0.027 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 20 1 0.998 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 127.280 _refine.B_iso_mean 51.2273 _refine.B_iso_min 20.980 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5TS2 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.3000 _refine.ls_d_res_low 46.8650 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 46437 _refine.ls_number_reflns_R_free 2158 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.5300 _refine.ls_percent_reflns_R_free 4.6500 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1834 _refine.ls_R_factor_R_free 0.2444 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1804 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.360 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3k9w _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 25.4000 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3100 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.3000 _refine_hist.d_res_low 46.8650 _refine_hist.pdbx_number_atoms_ligand 277 _refine_hist.number_atoms_solvent 189 _refine_hist.number_atoms_total 7967 _refine_hist.pdbx_number_residues_total 971 _refine_hist.pdbx_B_iso_mean_ligand 69.12 _refine_hist.pdbx_B_iso_mean_solvent 47.07 _refine_hist.pdbx_number_atoms_protein 7501 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 7988 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.014 ? 10896 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.057 ? 1231 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 1388 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 14.390 ? 4652 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.pdbx_ens_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_weight 1 'X-RAY DIFFRACTION' 1 1 TORSIONAL A 4085 11.100 ? ? ? ? ? ? ? 2 'X-RAY DIFFRACTION' 1 2 TORSIONAL B 4085 11.100 ? ? ? ? ? ? ? 3 'X-RAY DIFFRACTION' 1 3 TORSIONAL C 4085 11.100 ? ? ? ? ? ? ? 4 'X-RAY DIFFRACTION' 1 4 TORSIONAL D 4085 11.100 ? ? ? ? ? ? ? 5 'X-RAY DIFFRACTION' 1 5 TORSIONAL E 4085 11.100 ? ? ? ? ? ? ? 6 'X-RAY DIFFRACTION' 1 6 TORSIONAL F 4085 11.100 ? ? ? ? ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.3002 2.3537 3104 . 183 2921 99.0000 . . . 0.3023 . 0.2285 . . . . . . 15 . . . 'X-RAY DIFFRACTION' 2.3537 2.4126 3078 . 147 2931 99.0000 . . . 0.3250 . 0.2358 . . . . . . 15 . . . 'X-RAY DIFFRACTION' 2.4126 2.4778 3091 . 138 2953 99.0000 . . . 0.3013 . 0.2250 . . . . . . 15 . . . 'X-RAY DIFFRACTION' 2.4778 2.5507 3059 . 134 2925 99.0000 . . . 0.3028 . 0.2231 . . . . . . 15 . . . 'X-RAY DIFFRACTION' 2.5507 2.6330 3105 . 134 2971 99.0000 . . . 0.2970 . 0.2299 . . . . . . 15 . . . 'X-RAY DIFFRACTION' 2.6330 2.7271 3094 . 144 2950 98.0000 . . . 0.3108 . 0.2372 . . . . . . 15 . . . 'X-RAY DIFFRACTION' 2.7271 2.8363 3082 . 117 2965 98.0000 . . . 0.3188 . 0.2235 . . . . . . 15 . . . 'X-RAY DIFFRACTION' 2.8363 2.9653 3077 . 124 2953 98.0000 . . . 0.2929 . 0.2200 . . . . . . 15 . . . 'X-RAY DIFFRACTION' 2.9653 3.1217 3091 . 136 2955 98.0000 . . . 0.3054 . 0.2125 . . . . . . 15 . . . 'X-RAY DIFFRACTION' 3.1217 3.3172 3094 . 106 2988 98.0000 . . . 0.2657 . 0.2169 . . . . . . 15 . . . 'X-RAY DIFFRACTION' 3.3172 3.5732 3078 . 149 2929 97.0000 . . . 0.2533 . 0.1930 . . . . . . 15 . . . 'X-RAY DIFFRACTION' 3.5732 3.9327 3105 . 192 2913 97.0000 . . . 0.2261 . 0.1648 . . . . . . 15 . . . 'X-RAY DIFFRACTION' 3.9327 4.5013 3102 . 162 2940 97.0000 . . . 0.1829 . 0.1422 . . . . . . 15 . . . 'X-RAY DIFFRACTION' 4.5013 5.6696 3106 . 170 2936 96.0000 . . . 0.1975 . 0.1357 . . . . . . 15 . . . 'X-RAY DIFFRACTION' 5.6696 46.8746 3171 . 122 3049 94.0000 . . . 0.2332 . 0.1499 . . . . . . 15 . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 ;(chain A and ((resid 1 and (name N or name CA or name C or name O or name CB )) or resid 2 through 29 or resid 31 through 32 or resid 34 through 41 or (resid 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 47 or (resid 48 through 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 77 or (resid 78 through 79 and (name N or name CA or name C or name O or name CB )) or resid 80 or (resid 81 through 82 and (name N or name CA or name C or name O or name CB )) or resid 83 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 102 or resid 104 through 119 or (resid 120 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 145 or resid 147 through 157)) ; 1 2 ;(chain B and ((resid 1 and (name N or name CA or name C or name O or name CB )) or resid 2 through 29 or resid 31 through 32 or resid 34 through 39 or (resid 40 through 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 47 or (resid 48 through 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 77 or (resid 78 through 79 and (name N or name CA or name C or name O or name CB )) or resid 80 or (resid 81 through 82 and (name N or name CA or name C or name O or name CB )) or resid 83 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 102 or resid 104 through 145 or resid 147 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157)) ; 1 3 ;(chain C and ((resid 1 and (name N or name CA or name C or name O or name CB )) or resid 2 through 29 or resid 31 through 32 or resid 34 through 39 or (resid 40 through 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 77 or (resid 78 through 79 and (name N or name CA or name C or name O or name CB )) or resid 80 through 102 or resid 104 through 119 or (resid 120 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 142 or (resid 143 and (name N or name CA or name C or name O or name CB )) or resid 144 through 145 or resid 147 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157)) ; 1 4 ;(chain D and ((resid 1 and (name N or name CA or name C or name O or name CB )) or resid 2 through 29 or resid 31 through 32 or resid 34 through 41 or (resid 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 77 or (resid 78 through 79 and (name N or name CA or name C or name O or name CB )) or resid 80 or (resid 81 through 82 and (name N or name CA or name C or name O or name CB )) or resid 83 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 102 or resid 104 through 119 or (resid 120 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 145 or resid 147 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157)) ; 1 5 ;(chain E and ((resid 1 and (name N or name CA or name C or name O or name CB )) or resid 2 through 29 or resid 31 through 32 or resid 34 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 78 or (resid 79 and (name N or name CA or name C or name O or name CB )) or resid 80 or (resid 81 through 82 and (name N or name CA or name C or name O or name CB )) or resid 83 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 102 or resid 104 through 119 or (resid 120 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 145 or resid 147 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157)) ; 1 6 ;(chain F and (resid 1 through 29 or resid 31 through 32 or resid 34 through 39 or (resid 40 through 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 77 or (resid 78 through 79 and (name N or name CA or name C or name O or name CB )) or resid 80 through 102 or resid 104 through 119 or (resid 120 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 142 or (resid 143 and (name N or name CA or name C or name O or name CB )) or resid 144 through 145 or resid 147 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A MET 9 . A MET 9 . A MET 1 A MET 1 ? ;(chain A and ((resid 1 and (name N or name CA or name C or name O or name CB )) or resid 2 through 29 or resid 31 through 32 or resid 34 through 41 or (resid 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 47 or (resid 48 through 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 77 or (resid 78 through 79 and (name N or name CA or name C or name O or name CB )) or resid 80 or (resid 81 through 82 and (name N or name CA or name C or name O or name CB )) or resid 83 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 102 or resid 104 through 119 or (resid 120 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 145 or resid 147 through 157)) ; 1 1 2 A ALA 2 . A LYS 166 . A ALA -6 A LYS 158 ? ;(chain A and ((resid 1 and (name N or name CA or name C or name O or name CB )) or resid 2 through 29 or resid 31 through 32 or resid 34 through 41 or (resid 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 47 or (resid 48 through 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 77 or (resid 78 through 79 and (name N or name CA or name C or name O or name CB )) or resid 80 or (resid 81 through 82 and (name N or name CA or name C or name O or name CB )) or resid 83 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 102 or resid 104 through 119 or (resid 120 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 145 or resid 147 through 157)) ; 1 1 3 A ALA 2 . A LYS 166 . A ALA -6 A LYS 158 ? ;(chain A and ((resid 1 and (name N or name CA or name C or name O or name CB )) or resid 2 through 29 or resid 31 through 32 or resid 34 through 41 or (resid 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 47 or (resid 48 through 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 77 or (resid 78 through 79 and (name N or name CA or name C or name O or name CB )) or resid 80 or (resid 81 through 82 and (name N or name CA or name C or name O or name CB )) or resid 83 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 102 or resid 104 through 119 or (resid 120 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 145 or resid 147 through 157)) ; 1 1 4 A ALA 2 . A LYS 166 . A ALA -6 A LYS 158 ? ;(chain A and ((resid 1 and (name N or name CA or name C or name O or name CB )) or resid 2 through 29 or resid 31 through 32 or resid 34 through 41 or (resid 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 47 or (resid 48 through 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 77 or (resid 78 through 79 and (name N or name CA or name C or name O or name CB )) or resid 80 or (resid 81 through 82 and (name N or name CA or name C or name O or name CB )) or resid 83 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 102 or resid 104 through 119 or (resid 120 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 145 or resid 147 through 157)) ; 1 1 5 A ALA 2 . A LYS 166 . A ALA -6 A LYS 158 ? ;(chain A and ((resid 1 and (name N or name CA or name C or name O or name CB )) or resid 2 through 29 or resid 31 through 32 or resid 34 through 41 or (resid 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 47 or (resid 48 through 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 77 or (resid 78 through 79 and (name N or name CA or name C or name O or name CB )) or resid 80 or (resid 81 through 82 and (name N or name CA or name C or name O or name CB )) or resid 83 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 102 or resid 104 through 119 or (resid 120 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 145 or resid 147 through 157)) ; 1 2 1 B MET 9 . B MET 9 . B MET 1 B MET 1 ? ;(chain B and ((resid 1 and (name N or name CA or name C or name O or name CB )) or resid 2 through 29 or resid 31 through 32 or resid 34 through 39 or (resid 40 through 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 47 or (resid 48 through 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 77 or (resid 78 through 79 and (name N or name CA or name C or name O or name CB )) or resid 80 or (resid 81 through 82 and (name N or name CA or name C or name O or name CB )) or resid 83 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 102 or resid 104 through 145 or resid 147 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157)) ; 1 2 2 B MET 9 . B LYS 166 . B MET 1 B LYS 158 ? ;(chain B and ((resid 1 and (name N or name CA or name C or name O or name CB )) or resid 2 through 29 or resid 31 through 32 or resid 34 through 39 or (resid 40 through 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 47 or (resid 48 through 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 77 or (resid 78 through 79 and (name N or name CA or name C or name O or name CB )) or resid 80 or (resid 81 through 82 and (name N or name CA or name C or name O or name CB )) or resid 83 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 102 or resid 104 through 145 or resid 147 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157)) ; 1 2 3 B MET 9 . B LYS 166 . B MET 1 B LYS 158 ? ;(chain B and ((resid 1 and (name N or name CA or name C or name O or name CB )) or resid 2 through 29 or resid 31 through 32 or resid 34 through 39 or (resid 40 through 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 47 or (resid 48 through 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 77 or (resid 78 through 79 and (name N or name CA or name C or name O or name CB )) or resid 80 or (resid 81 through 82 and (name N or name CA or name C or name O or name CB )) or resid 83 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 102 or resid 104 through 145 or resid 147 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157)) ; 1 2 4 B MET 9 . B LYS 166 . B MET 1 B LYS 158 ? ;(chain B and ((resid 1 and (name N or name CA or name C or name O or name CB )) or resid 2 through 29 or resid 31 through 32 or resid 34 through 39 or (resid 40 through 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 47 or (resid 48 through 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 77 or (resid 78 through 79 and (name N or name CA or name C or name O or name CB )) or resid 80 or (resid 81 through 82 and (name N or name CA or name C or name O or name CB )) or resid 83 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 102 or resid 104 through 145 or resid 147 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157)) ; 1 2 5 B MET 9 . B LYS 166 . B MET 1 B LYS 158 ? ;(chain B and ((resid 1 and (name N or name CA or name C or name O or name CB )) or resid 2 through 29 or resid 31 through 32 or resid 34 through 39 or (resid 40 through 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 47 or (resid 48 through 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 77 or (resid 78 through 79 and (name N or name CA or name C or name O or name CB )) or resid 80 or (resid 81 through 82 and (name N or name CA or name C or name O or name CB )) or resid 83 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 102 or resid 104 through 145 or resid 147 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157)) ; 1 3 1 C MET 9 . C MET 9 . C MET 1 C MET 1 ? ;(chain C and ((resid 1 and (name N or name CA or name C or name O or name CB )) or resid 2 through 29 or resid 31 through 32 or resid 34 through 39 or (resid 40 through 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 77 or (resid 78 through 79 and (name N or name CA or name C or name O or name CB )) or resid 80 through 102 or resid 104 through 119 or (resid 120 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 142 or (resid 143 and (name N or name CA or name C or name O or name CB )) or resid 144 through 145 or resid 147 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157)) ; 1 3 2 C ALA 2 . C LYS 166 . C ALA -6 C LYS 158 ? ;(chain C and ((resid 1 and (name N or name CA or name C or name O or name CB )) or resid 2 through 29 or resid 31 through 32 or resid 34 through 39 or (resid 40 through 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 77 or (resid 78 through 79 and (name N or name CA or name C or name O or name CB )) or resid 80 through 102 or resid 104 through 119 or (resid 120 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 142 or (resid 143 and (name N or name CA or name C or name O or name CB )) or resid 144 through 145 or resid 147 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157)) ; 1 3 3 C ALA 2 . C LYS 166 . C ALA -6 C LYS 158 ? ;(chain C and ((resid 1 and (name N or name CA or name C or name O or name CB )) or resid 2 through 29 or resid 31 through 32 or resid 34 through 39 or (resid 40 through 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 77 or (resid 78 through 79 and (name N or name CA or name C or name O or name CB )) or resid 80 through 102 or resid 104 through 119 or (resid 120 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 142 or (resid 143 and (name N or name CA or name C or name O or name CB )) or resid 144 through 145 or resid 147 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157)) ; 1 3 4 C ALA 2 . C LYS 166 . C ALA -6 C LYS 158 ? ;(chain C and ((resid 1 and (name N or name CA or name C or name O or name CB )) or resid 2 through 29 or resid 31 through 32 or resid 34 through 39 or (resid 40 through 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 77 or (resid 78 through 79 and (name N or name CA or name C or name O or name CB )) or resid 80 through 102 or resid 104 through 119 or (resid 120 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 142 or (resid 143 and (name N or name CA or name C or name O or name CB )) or resid 144 through 145 or resid 147 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157)) ; 1 3 5 C ALA 2 . C LYS 166 . C ALA -6 C LYS 158 ? ;(chain C and ((resid 1 and (name N or name CA or name C or name O or name CB )) or resid 2 through 29 or resid 31 through 32 or resid 34 through 39 or (resid 40 through 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 77 or (resid 78 through 79 and (name N or name CA or name C or name O or name CB )) or resid 80 through 102 or resid 104 through 119 or (resid 120 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 142 or (resid 143 and (name N or name CA or name C or name O or name CB )) or resid 144 through 145 or resid 147 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157)) ; 1 4 1 D MET 9 . D MET 9 . D MET 1 D MET 1 ? ;(chain D and ((resid 1 and (name N or name CA or name C or name O or name CB )) or resid 2 through 29 or resid 31 through 32 or resid 34 through 41 or (resid 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 77 or (resid 78 through 79 and (name N or name CA or name C or name O or name CB )) or resid 80 or (resid 81 through 82 and (name N or name CA or name C or name O or name CB )) or resid 83 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 102 or resid 104 through 119 or (resid 120 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 145 or resid 147 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157)) ; 1 4 2 D HIS 7 . D PHE 165 . D HIS -1 D PHE 157 ? ;(chain D and ((resid 1 and (name N or name CA or name C or name O or name CB )) or resid 2 through 29 or resid 31 through 32 or resid 34 through 41 or (resid 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 77 or (resid 78 through 79 and (name N or name CA or name C or name O or name CB )) or resid 80 or (resid 81 through 82 and (name N or name CA or name C or name O or name CB )) or resid 83 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 102 or resid 104 through 119 or (resid 120 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 145 or resid 147 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157)) ; 1 4 3 D HIS 7 . D PHE 165 . D HIS -1 D PHE 157 ? ;(chain D and ((resid 1 and (name N or name CA or name C or name O or name CB )) or resid 2 through 29 or resid 31 through 32 or resid 34 through 41 or (resid 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 77 or (resid 78 through 79 and (name N or name CA or name C or name O or name CB )) or resid 80 or (resid 81 through 82 and (name N or name CA or name C or name O or name CB )) or resid 83 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 102 or resid 104 through 119 or (resid 120 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 145 or resid 147 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157)) ; 1 4 4 D HIS 7 . D PHE 165 . D HIS -1 D PHE 157 ? ;(chain D and ((resid 1 and (name N or name CA or name C or name O or name CB )) or resid 2 through 29 or resid 31 through 32 or resid 34 through 41 or (resid 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 77 or (resid 78 through 79 and (name N or name CA or name C or name O or name CB )) or resid 80 or (resid 81 through 82 and (name N or name CA or name C or name O or name CB )) or resid 83 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 102 or resid 104 through 119 or (resid 120 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 145 or resid 147 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157)) ; 1 4 5 D HIS 7 . D PHE 165 . D HIS -1 D PHE 157 ? ;(chain D and ((resid 1 and (name N or name CA or name C or name O or name CB )) or resid 2 through 29 or resid 31 through 32 or resid 34 through 41 or (resid 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 77 or (resid 78 through 79 and (name N or name CA or name C or name O or name CB )) or resid 80 or (resid 81 through 82 and (name N or name CA or name C or name O or name CB )) or resid 83 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 102 or resid 104 through 119 or (resid 120 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 145 or resid 147 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157)) ; 1 5 1 E MET 9 . E MET 9 . E MET 1 E MET 1 ? ;(chain E and ((resid 1 and (name N or name CA or name C or name O or name CB )) or resid 2 through 29 or resid 31 through 32 or resid 34 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 78 or (resid 79 and (name N or name CA or name C or name O or name CB )) or resid 80 or (resid 81 through 82 and (name N or name CA or name C or name O or name CB )) or resid 83 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 102 or resid 104 through 119 or (resid 120 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 145 or resid 147 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157)) ; 1 5 2 E ALA 2 . T COD . . E ALA -6 E COD 201 ? ;(chain E and ((resid 1 and (name N or name CA or name C or name O or name CB )) or resid 2 through 29 or resid 31 through 32 or resid 34 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 78 or (resid 79 and (name N or name CA or name C or name O or name CB )) or resid 80 or (resid 81 through 82 and (name N or name CA or name C or name O or name CB )) or resid 83 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 102 or resid 104 through 119 or (resid 120 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 145 or resid 147 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157)) ; 1 5 3 E ALA 2 . T COD . . E ALA -6 E COD 201 ? ;(chain E and ((resid 1 and (name N or name CA or name C or name O or name CB )) or resid 2 through 29 or resid 31 through 32 or resid 34 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 78 or (resid 79 and (name N or name CA or name C or name O or name CB )) or resid 80 or (resid 81 through 82 and (name N or name CA or name C or name O or name CB )) or resid 83 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 102 or resid 104 through 119 or (resid 120 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 145 or resid 147 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157)) ; 1 5 4 E ALA 2 . T COD . . E ALA -6 E COD 201 ? ;(chain E and ((resid 1 and (name N or name CA or name C or name O or name CB )) or resid 2 through 29 or resid 31 through 32 or resid 34 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 78 or (resid 79 and (name N or name CA or name C or name O or name CB )) or resid 80 or (resid 81 through 82 and (name N or name CA or name C or name O or name CB )) or resid 83 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 102 or resid 104 through 119 or (resid 120 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 145 or resid 147 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157)) ; 1 5 5 E ALA 2 . T COD . . E ALA -6 E COD 201 ? ;(chain E and ((resid 1 and (name N or name CA or name C or name O or name CB )) or resid 2 through 29 or resid 31 through 32 or resid 34 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 78 or (resid 79 and (name N or name CA or name C or name O or name CB )) or resid 80 or (resid 81 through 82 and (name N or name CA or name C or name O or name CB )) or resid 83 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 102 or resid 104 through 119 or (resid 120 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 145 or resid 147 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157)) ; 1 6 1 F MET 9 . F ASP 37 . F MET 1 F ASP 29 ? ;(chain F and (resid 1 through 29 or resid 31 through 32 or resid 34 through 39 or (resid 40 through 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 77 or (resid 78 through 79 and (name N or name CA or name C or name O or name CB )) or resid 80 through 102 or resid 104 through 119 or (resid 120 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 142 or (resid 143 and (name N or name CA or name C or name O or name CB )) or resid 144 through 145 or resid 147 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157)) ; 1 6 2 F VAL 39 . F ILE 40 . F VAL 31 F ILE 32 ? ;(chain F and (resid 1 through 29 or resid 31 through 32 or resid 34 through 39 or (resid 40 through 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 77 or (resid 78 through 79 and (name N or name CA or name C or name O or name CB )) or resid 80 through 102 or resid 104 through 119 or (resid 120 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 142 or (resid 143 and (name N or name CA or name C or name O or name CB )) or resid 144 through 145 or resid 147 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157)) ; 1 6 3 F ALA 42 . F PRO 47 . F ALA 34 F PRO 39 ? ;(chain F and (resid 1 through 29 or resid 31 through 32 or resid 34 through 39 or (resid 40 through 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 77 or (resid 78 through 79 and (name N or name CA or name C or name O or name CB )) or resid 80 through 102 or resid 104 through 119 or (resid 120 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 142 or (resid 143 and (name N or name CA or name C or name O or name CB )) or resid 144 through 145 or resid 147 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157)) ; 1 6 4 F LYS 48 . F ASN 50 . F LYS 40 F ASN 42 ? ;(chain F and (resid 1 through 29 or resid 31 through 32 or resid 34 through 39 or (resid 40 through 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 77 or (resid 78 through 79 and (name N or name CA or name C or name O or name CB )) or resid 80 through 102 or resid 104 through 119 or (resid 120 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 142 or (resid 143 and (name N or name CA or name C or name O or name CB )) or resid 144 through 145 or resid 147 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157)) ; 1 6 5 F HIS 8 . F LYS 166 . F HIS 0 F LYS 158 ? ;(chain F and (resid 1 through 29 or resid 31 through 32 or resid 34 through 39 or (resid 40 through 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 77 or (resid 78 through 79 and (name N or name CA or name C or name O or name CB )) or resid 80 through 102 or resid 104 through 119 or (resid 120 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 142 or (resid 143 and (name N or name CA or name C or name O or name CB )) or resid 144 through 145 or resid 147 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157)) ; 1 6 6 F HIS 8 . F LYS 166 . F HIS 0 F LYS 158 ? ;(chain F and (resid 1 through 29 or resid 31 through 32 or resid 34 through 39 or (resid 40 through 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 77 or (resid 78 through 79 and (name N or name CA or name C or name O or name CB )) or resid 80 through 102 or resid 104 through 119 or (resid 120 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 142 or (resid 143 and (name N or name CA or name C or name O or name CB )) or resid 144 through 145 or resid 147 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157)) ; 1 6 7 F HIS 8 . F LYS 166 . F HIS 0 F LYS 158 ? ;(chain F and (resid 1 through 29 or resid 31 through 32 or resid 34 through 39 or (resid 40 through 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 77 or (resid 78 through 79 and (name N or name CA or name C or name O or name CB )) or resid 80 through 102 or resid 104 through 119 or (resid 120 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 142 or (resid 143 and (name N or name CA or name C or name O or name CB )) or resid 144 through 145 or resid 147 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157)) ; 1 6 8 F HIS 8 . F LYS 166 . F HIS 0 F LYS 158 ? ;(chain F and (resid 1 through 29 or resid 31 through 32 or resid 34 through 39 or (resid 40 through 42 and (name N or name CA or name C or name O or name CB )) or resid 43 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 77 or (resid 78 through 79 and (name N or name CA or name C or name O or name CB )) or resid 80 through 102 or resid 104 through 119 or (resid 120 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 142 or (resid 143 and (name N or name CA or name C or name O or name CB )) or resid 144 through 145 or resid 147 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157)) ; # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 5TS2 _struct.title ;Crystal structure of a phosphopantetheine adenylyltransferase (CoaD, PPAT) from Pseudomonas aeruginosa bound to dephospho coenzyme A ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5TS2 _struct_keywords.text ;structural genomics, coenzyme A biosynthesis, PPAT, CoaD, Seattle Structural Genomics Center for Infectious Disease, SSGCID, TRANSFERASE ; _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 1 ? F N N 1 ? G N N 2 ? H N N 3 ? I N N 4 ? J N N 2 ? K N N 4 ? L N N 4 ? M N N 2 ? N N N 4 ? O N N 4 ? P N N 4 ? Q N N 2 ? R N N 4 ? S N N 4 ? T N N 2 ? U N N 3 ? V N N 4 ? W N N 2 ? X N N 4 ? Y N N 4 ? Z N N 5 ? AA N N 5 ? BA N N 5 ? CA N N 5 ? DA N N 5 ? EA N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 22 ? PHE A 36 ? THR A 14 PHE A 28 1 ? 15 HELX_P HELX_P2 AA2 SER A 46 ? ASN A 50 ? SER A 38 ASN A 42 5 ? 5 HELX_P HELX_P3 AA3 SER A 54 ? LYS A 67 ? SER A 46 LYS A 59 1 ? 14 HELX_P HELX_P4 AA4 LEU A 80 ? GLN A 88 ? LEU A 72 GLN A 80 1 ? 9 HELX_P HELX_P5 AA5 ASP A 102 ? ALA A 117 ? ASP A 94 ALA A 109 1 ? 16 HELX_P HELX_P6 AA6 SER A 128 ? SER A 132 ? SER A 120 SER A 124 5 ? 5 HELX_P HELX_P7 AA7 SER A 135 ? LEU A 145 ? SER A 127 LEU A 137 1 ? 11 HELX_P HELX_P8 AA8 HIS A 154 ? LYS A 166 ? HIS A 146 LYS A 158 1 ? 13 HELX_P HELX_P9 AA9 THR B 22 ? PHE B 36 ? THR B 14 PHE B 28 1 ? 15 HELX_P HELX_P10 AB1 SER B 46 ? ASN B 50 ? SER B 38 ASN B 42 5 ? 5 HELX_P HELX_P11 AB2 SER B 54 ? LYS B 67 ? SER B 46 LYS B 59 1 ? 14 HELX_P HELX_P12 AB3 LEU B 80 ? GLN B 88 ? LEU B 72 GLN B 80 1 ? 9 HELX_P HELX_P13 AB4 ASP B 102 ? ALA B 117 ? ASP B 94 ALA B 109 1 ? 16 HELX_P HELX_P14 AB5 SER B 128 ? SER B 132 ? SER B 120 SER B 124 5 ? 5 HELX_P HELX_P15 AB6 SER B 135 ? LEU B 145 ? SER B 127 LEU B 137 1 ? 11 HELX_P HELX_P16 AB7 HIS B 154 ? PHE B 165 ? HIS B 146 PHE B 157 1 ? 12 HELX_P HELX_P17 AB8 THR C 22 ? PHE C 36 ? THR C 14 PHE C 28 1 ? 15 HELX_P HELX_P18 AB9 SER C 46 ? ASN C 50 ? SER C 38 ASN C 42 5 ? 5 HELX_P HELX_P19 AC1 SER C 54 ? LYS C 67 ? SER C 46 LYS C 59 1 ? 14 HELX_P HELX_P20 AC2 LEU C 80 ? GLN C 88 ? LEU C 72 GLN C 80 1 ? 9 HELX_P HELX_P21 AC3 ASP C 102 ? ALA C 117 ? ASP C 94 ALA C 109 1 ? 16 HELX_P HELX_P22 AC4 SER C 128 ? SER C 132 ? SER C 120 SER C 124 5 ? 5 HELX_P HELX_P23 AC5 SER C 135 ? LEU C 145 ? SER C 127 LEU C 137 1 ? 11 HELX_P HELX_P24 AC6 HIS C 154 ? PHE C 165 ? HIS C 146 PHE C 157 1 ? 12 HELX_P HELX_P25 AC7 THR D 22 ? PHE D 36 ? THR D 14 PHE D 28 1 ? 15 HELX_P HELX_P26 AC8 SER D 46 ? ASN D 50 ? SER D 38 ASN D 42 5 ? 5 HELX_P HELX_P27 AC9 SER D 54 ? LYS D 67 ? SER D 46 LYS D 59 1 ? 14 HELX_P HELX_P28 AD1 LEU D 80 ? GLN D 88 ? LEU D 72 GLN D 80 1 ? 9 HELX_P HELX_P29 AD2 ASP D 102 ? ALA D 117 ? ASP D 94 ALA D 109 1 ? 16 HELX_P HELX_P30 AD3 SER D 128 ? SER D 132 ? SER D 120 SER D 124 5 ? 5 HELX_P HELX_P31 AD4 SER D 135 ? LEU D 145 ? SER D 127 LEU D 137 1 ? 11 HELX_P HELX_P32 AD5 HIS D 154 ? PHE D 165 ? HIS D 146 PHE D 157 1 ? 12 HELX_P HELX_P33 AD6 THR E 22 ? PHE E 36 ? THR E 14 PHE E 28 1 ? 15 HELX_P HELX_P34 AD7 SER E 46 ? ASN E 50 ? SER E 38 ASN E 42 5 ? 5 HELX_P HELX_P35 AD8 SER E 54 ? LYS E 67 ? SER E 46 LYS E 59 1 ? 14 HELX_P HELX_P36 AD9 LEU E 80 ? GLN E 88 ? LEU E 72 GLN E 80 1 ? 9 HELX_P HELX_P37 AE1 ASP E 102 ? ALA E 117 ? ASP E 94 ALA E 109 1 ? 16 HELX_P HELX_P38 AE2 SER E 128 ? SER E 132 ? SER E 120 SER E 124 5 ? 5 HELX_P HELX_P39 AE3 SER E 135 ? LEU E 145 ? SER E 127 LEU E 137 1 ? 11 HELX_P HELX_P40 AE4 HIS E 154 ? PHE E 165 ? HIS E 146 PHE E 157 1 ? 12 HELX_P HELX_P41 AE5 THR F 22 ? PHE F 36 ? THR F 14 PHE F 28 1 ? 15 HELX_P HELX_P42 AE6 SER F 46 ? ASN F 50 ? SER F 38 ASN F 42 5 ? 5 HELX_P HELX_P43 AE7 SER F 54 ? LYS F 67 ? SER F 46 LYS F 59 1 ? 14 HELX_P HELX_P44 AE8 LEU F 80 ? GLN F 88 ? LEU F 72 GLN F 80 1 ? 9 HELX_P HELX_P45 AE9 ASP F 102 ? ALA F 117 ? ASP F 94 ALA F 109 1 ? 16 HELX_P HELX_P46 AF1 SER F 135 ? LEU F 145 ? SER F 127 LEU F 137 1 ? 11 HELX_P HELX_P47 AF2 HIS F 154 ? LYS F 166 ? HIS F 146 LYS F 158 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? BA HOH . O ? ? ? 4_465 U CA . CA ? ? C HOH 322 E CA 202 1_555 ? ? ? ? ? ? ? 2.393 ? ? metalc2 metalc ? ? E VAL 72 O ? ? ? 1_555 U CA . CA ? ? E VAL 64 E CA 202 1_555 ? ? ? ? ? ? ? 2.598 ? ? metalc3 metalc ? ? U CA . CA ? ? ? 1_555 DA HOH . O ? ? E CA 202 E HOH 311 1_555 ? ? ? ? ? ? ? 2.503 ? ? metalc4 metalc ? ? U CA . CA ? ? ? 1_555 DA HOH . O ? ? E CA 202 E HOH 319 1_555 ? ? ? ? ? ? ? 3.055 ? ? metalc5 metalc ? ? U CA . CA ? ? ? 1_555 DA HOH . O ? ? E CA 202 E HOH 330 1_555 ? ? ? ? ? ? ? 2.374 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ASP 19 A . ? ASP 11 A PRO 20 A ? PRO 12 A 1 -2.60 2 ASP 19 B . ? ASP 11 B PRO 20 B ? PRO 12 B 1 -3.37 3 ASP 19 C . ? ASP 11 C PRO 20 C ? PRO 12 C 1 -1.24 4 ASP 19 D . ? ASP 11 D PRO 20 D ? PRO 12 D 1 -4.07 5 ASP 19 E . ? ASP 11 E PRO 20 E ? PRO 12 E 1 -2.82 6 ASP 19 F . ? ASP 11 F PRO 20 F ? PRO 12 F 1 -3.79 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 10 ? AA2 ? 10 ? AA3 ? 10 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? anti-parallel AA1 6 7 ? parallel AA1 7 8 ? parallel AA1 8 9 ? parallel AA1 9 10 ? parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? parallel AA2 4 5 ? parallel AA2 5 6 ? anti-parallel AA2 6 7 ? parallel AA2 7 8 ? parallel AA2 8 9 ? parallel AA2 9 10 ? parallel AA3 1 2 ? parallel AA3 2 3 ? parallel AA3 3 4 ? parallel AA3 4 5 ? parallel AA3 5 6 ? anti-parallel AA3 6 7 ? parallel AA3 7 8 ? parallel AA3 8 9 ? parallel AA3 9 10 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 72 ? PHE A 77 ? VAL A 64 PHE A 69 AA1 2 HIS A 38 ? ALA A 44 ? HIS A 30 ALA A 36 AA1 3 ARG A 11 ? GLY A 16 ? ARG A 3 GLY A 8 AA1 4 VAL A 92 ? GLY A 96 ? VAL A 84 GLY A 88 AA1 5 GLU A 121 ? LEU A 125 ? GLU A 113 LEU A 117 AA1 6 GLU D 121 ? LEU D 125 ? GLU D 113 LEU D 117 AA1 7 VAL D 92 ? GLY D 96 ? VAL D 84 GLY D 88 AA1 8 ARG D 11 ? GLY D 16 ? ARG D 3 GLY D 8 AA1 9 HIS D 38 ? ALA D 44 ? HIS D 30 ALA D 36 AA1 10 VAL D 72 ? PHE D 77 ? VAL D 64 PHE D 69 AA2 1 VAL B 72 ? PHE B 77 ? VAL B 64 PHE B 69 AA2 2 HIS B 38 ? ALA B 44 ? HIS B 30 ALA B 36 AA2 3 ARG B 11 ? GLY B 16 ? ARG B 3 GLY B 8 AA2 4 VAL B 92 ? GLY B 96 ? VAL B 84 GLY B 88 AA2 5 GLU B 121 ? LEU B 125 ? GLU B 113 LEU B 117 AA2 6 GLU E 121 ? LEU E 125 ? GLU E 113 LEU E 117 AA2 7 VAL E 92 ? GLY E 96 ? VAL E 84 GLY E 88 AA2 8 ARG E 11 ? GLY E 16 ? ARG E 3 GLY E 8 AA2 9 HIS E 38 ? ALA E 44 ? HIS E 30 ALA E 36 AA2 10 VAL E 72 ? PHE E 77 ? VAL E 64 PHE E 69 AA3 1 VAL C 72 ? PHE C 77 ? VAL C 64 PHE C 69 AA3 2 HIS C 38 ? ALA C 44 ? HIS C 30 ALA C 36 AA3 3 ARG C 11 ? GLY C 16 ? ARG C 3 GLY C 8 AA3 4 VAL C 92 ? GLY C 96 ? VAL C 84 GLY C 88 AA3 5 GLU C 121 ? LEU C 125 ? GLU C 113 LEU C 117 AA3 6 GLU F 121 ? LEU F 125 ? GLU F 113 LEU F 117 AA3 7 VAL F 92 ? GLY F 96 ? VAL F 84 GLY F 88 AA3 8 ARG F 11 ? GLY F 16 ? ARG F 3 GLY F 8 AA3 9 HIS F 38 ? ALA F 44 ? HIS F 30 ALA F 36 AA3 10 VAL F 72 ? PHE F 77 ? VAL F 64 PHE F 69 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 73 ? O GLU A 65 N ILE A 41 ? N ILE A 33 AA1 2 3 O ILE A 40 ? O ILE A 32 N VAL A 12 ? N VAL A 4 AA1 3 4 N LEU A 13 ? N LEU A 5 O LEU A 94 ? O LEU A 86 AA1 4 5 N PHE A 93 ? N PHE A 85 O GLU A 121 ? O GLU A 113 AA1 5 6 N PHE A 124 ? N PHE A 116 O PHE D 124 ? O PHE D 116 AA1 6 7 O GLU D 121 ? O GLU D 113 N PHE D 93 ? N PHE D 85 AA1 7 8 O LEU D 94 ? O LEU D 86 N LEU D 13 ? N LEU D 5 AA1 8 9 N TYR D 14 ? N TYR D 6 O ILE D 40 ? O ILE D 32 AA1 9 10 N ILE D 41 ? N ILE D 33 O GLU D 73 ? O GLU D 65 AA2 1 2 O GLU B 73 ? O GLU B 65 N ILE B 41 ? N ILE B 33 AA2 2 3 O ILE B 40 ? O ILE B 32 N TYR B 14 ? N TYR B 6 AA2 3 4 N LEU B 13 ? N LEU B 5 O LEU B 94 ? O LEU B 86 AA2 4 5 N PHE B 93 ? N PHE B 85 O GLU B 121 ? O GLU B 113 AA2 5 6 N PHE B 124 ? N PHE B 116 O PHE E 124 ? O PHE E 116 AA2 6 7 O GLU E 121 ? O GLU E 113 N PHE E 93 ? N PHE E 85 AA2 7 8 O VAL E 92 ? O VAL E 84 N LEU E 13 ? N LEU E 5 AA2 8 9 N TYR E 14 ? N TYR E 6 O ILE E 40 ? O ILE E 32 AA2 9 10 N ILE E 41 ? N ILE E 33 O GLU E 73 ? O GLU E 65 AA3 1 2 O GLU C 73 ? O GLU C 65 N ILE C 41 ? N ILE C 33 AA3 2 3 O ILE C 40 ? O ILE C 32 N TYR C 14 ? N TYR C 6 AA3 3 4 N LEU C 13 ? N LEU C 5 O VAL C 92 ? O VAL C 84 AA3 4 5 N PHE C 93 ? N PHE C 85 O GLU C 121 ? O GLU C 113 AA3 5 6 N PHE C 124 ? N PHE C 116 O PHE F 124 ? O PHE F 116 AA3 6 7 O GLU F 121 ? O GLU F 113 N PHE F 93 ? N PHE F 85 AA3 7 8 O LEU F 94 ? O LEU F 86 N LEU F 13 ? N LEU F 5 AA3 8 9 N TYR F 14 ? N TYR F 6 O ILE F 40 ? O ILE F 32 AA3 9 10 N ILE F 41 ? N ILE F 33 O GLU F 73 ? O GLU F 65 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A COD 201 ? 20 'binding site for residue COD A 201' AC2 Software A CA 202 ? 6 'binding site for residue CA A 202' AC3 Software A CL 203 ? 2 'binding site for residue CL A 203' AC4 Software B COD 201 ? 22 'binding site for residue COD B 201' AC5 Software B CL 202 ? 2 'binding site for residue CL B 202' AC6 Software B CL 203 ? 3 'binding site for residue CL B 203' AC7 Software C COD 201 ? 19 'binding site for residue COD C 201' AC8 Software C CL 202 ? 2 'binding site for residue CL C 202' AC9 Software C CL 203 ? 3 'binding site for residue CL C 203' AD1 Software C CL 204 ? 3 'binding site for residue CL C 204' AD2 Software D COD 201 ? 22 'binding site for residue COD D 201' AD3 Software D CL 202 ? 2 'binding site for residue CL D 202' AD4 Software D CL 203 ? 3 'binding site for residue CL D 203' AD5 Software E COD 201 ? 21 'binding site for residue COD E 201' AD6 Software E CA 202 ? 5 'binding site for residue CA E 202' AD7 Software E CL 203 ? 3 'binding site for residue CL E 203' AD8 Software F COD 201 ? 25 'binding site for residue COD F 201' AD9 Software F CL 202 ? 2 'binding site for residue CL F 202' AE1 Software F CL 203 ? 3 'binding site for residue CL F 203' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 20 TYR A 14 ? TYR A 6 . ? 1_555 ? 2 AC1 20 PRO A 15 ? PRO A 7 . ? 1_555 ? 3 AC1 20 GLY A 16 ? GLY A 8 . ? 1_555 ? 4 AC1 20 THR A 17 ? THR A 9 . ? 1_555 ? 5 AC1 20 PHE A 18 ? PHE A 10 . ? 1_555 ? 6 AC1 20 GLY A 24 ? GLY A 16 . ? 1_555 ? 7 AC1 20 HIS A 25 ? HIS A 17 . ? 1_555 ? 8 AC1 20 THR A 79 ? THR A 71 . ? 1_555 ? 9 AC1 20 LEU A 80 ? LEU A 72 . ? 1_555 ? 10 AC1 20 LEU A 81 ? LEU A 73 . ? 1_555 ? 11 AC1 20 ARG A 95 ? ARG A 87 . ? 1_555 ? 12 AC1 20 GLY A 96 ? GLY A 88 . ? 1_555 ? 13 AC1 20 ARG A 98 ? ARG A 90 . ? 1_555 ? 14 AC1 20 LEU A 109 ? LEU A 101 . ? 1_555 ? 15 AC1 20 ASN A 113 ? ASN A 105 . ? 1_555 ? 16 AC1 20 PRO A 127 ? PRO A 119 . ? 1_555 ? 17 AC1 20 TYR A 131 ? TYR A 123 . ? 1_555 ? 18 AC1 20 ILE A 134 ? ILE A 126 . ? 1_555 ? 19 AC1 20 HOH Z . ? HOH A 315 . ? 1_555 ? 20 AC1 20 LEU E 145 ? LEU E 137 . ? 1_555 ? 21 AC2 6 HIS A 5 ? HIS A -3 . ? 1_555 ? 22 AC2 6 HIS A 3 ? HIS A -5 . ? 1_555 ? 23 AC2 6 HIS C 5 ? HIS C -3 . ? 4_455 ? 24 AC2 6 HIS C 3 ? HIS C -5 . ? 4_455 ? 25 AC2 6 HIS E 5 ? HIS E -3 . ? 2_464 ? 26 AC2 6 HIS E 3 ? HIS E -5 . ? 2_464 ? 27 AC3 2 SER A 135 ? SER A 127 . ? 1_555 ? 28 AC3 2 THR A 137 ? THR A 129 . ? 1_555 ? 29 AC4 22 TYR B 14 ? TYR B 6 . ? 1_555 ? 30 AC4 22 PRO B 15 ? PRO B 7 . ? 1_555 ? 31 AC4 22 GLY B 16 ? GLY B 8 . ? 1_555 ? 32 AC4 22 THR B 17 ? THR B 9 . ? 1_555 ? 33 AC4 22 PHE B 18 ? PHE B 10 . ? 1_555 ? 34 AC4 22 GLY B 24 ? GLY B 16 . ? 1_555 ? 35 AC4 22 HIS B 25 ? HIS B 17 . ? 1_555 ? 36 AC4 22 PHE B 77 ? PHE B 69 . ? 1_555 ? 37 AC4 22 LEU B 80 ? LEU B 72 . ? 1_555 ? 38 AC4 22 LEU B 81 ? LEU B 73 . ? 1_555 ? 39 AC4 22 ARG B 95 ? ARG B 87 . ? 1_555 ? 40 AC4 22 GLY B 96 ? GLY B 88 . ? 1_555 ? 41 AC4 22 ARG B 98 ? ARG B 90 . ? 1_555 ? 42 AC4 22 TYR B 105 ? TYR B 97 . ? 1_555 ? 43 AC4 22 GLU B 106 ? GLU B 98 . ? 1_555 ? 44 AC4 22 ASN B 113 ? ASN B 105 . ? 1_555 ? 45 AC4 22 PRO B 127 ? PRO B 119 . ? 1_555 ? 46 AC4 22 TYR B 131 ? TYR B 123 . ? 1_555 ? 47 AC4 22 ILE B 134 ? ILE B 126 . ? 1_555 ? 48 AC4 22 HOH AA . ? HOH B 301 . ? 1_555 ? 49 AC4 22 HOH AA . ? HOH B 303 . ? 1_555 ? 50 AC4 22 HOH AA . ? HOH B 306 . ? 1_555 ? 51 AC5 2 SER B 135 ? SER B 127 . ? 1_555 ? 52 AC5 2 THR B 137 ? THR B 129 . ? 1_555 ? 53 AC6 3 ALA B 117 ? ALA B 109 . ? 1_555 ? 54 AC6 3 PRO B 118 ? PRO B 110 . ? 1_555 ? 55 AC6 3 ASP B 119 ? ASP B 111 . ? 1_555 ? 56 AC7 19 LEU A 145 ? LEU A 137 . ? 1_555 ? 57 AC7 19 TYR C 14 ? TYR C 6 . ? 1_555 ? 58 AC7 19 PRO C 15 ? PRO C 7 . ? 1_555 ? 59 AC7 19 GLY C 16 ? GLY C 8 . ? 1_555 ? 60 AC7 19 THR C 17 ? THR C 9 . ? 1_555 ? 61 AC7 19 PHE C 18 ? PHE C 10 . ? 1_555 ? 62 AC7 19 GLY C 24 ? GLY C 16 . ? 1_555 ? 63 AC7 19 HIS C 25 ? HIS C 17 . ? 1_555 ? 64 AC7 19 LYS C 49 ? LYS C 41 . ? 1_555 ? 65 AC7 19 LEU C 80 ? LEU C 72 . ? 1_555 ? 66 AC7 19 LEU C 81 ? LEU C 73 . ? 1_555 ? 67 AC7 19 ARG C 95 ? ARG C 87 . ? 1_555 ? 68 AC7 19 GLY C 96 ? GLY C 88 . ? 1_555 ? 69 AC7 19 ARG C 98 ? ARG C 90 . ? 1_555 ? 70 AC7 19 TYR C 105 ? TYR C 97 . ? 1_555 ? 71 AC7 19 PRO C 127 ? PRO C 119 . ? 1_555 ? 72 AC7 19 TYR C 131 ? TYR C 123 . ? 1_555 ? 73 AC7 19 ILE C 134 ? ILE C 126 . ? 1_555 ? 74 AC7 19 HOH BA . ? HOH C 325 . ? 1_555 ? 75 AC8 2 SER C 135 ? SER C 127 . ? 1_555 ? 76 AC8 2 THR C 137 ? THR C 129 . ? 1_555 ? 77 AC9 3 ALA C 117 ? ALA C 109 . ? 1_555 ? 78 AC9 3 PRO C 118 ? PRO C 110 . ? 1_555 ? 79 AC9 3 ASP C 119 ? ASP C 111 . ? 1_555 ? 80 AD1 3 HIS C 3 ? HIS C -5 . ? 1_555 ? 81 AD1 3 HIS C 4 ? HIS C -4 . ? 1_555 ? 82 AD1 3 HIS C 8 ? HIS C 0 . ? 1_555 ? 83 AD2 22 TYR D 14 ? TYR D 6 . ? 1_555 ? 84 AD2 22 PRO D 15 ? PRO D 7 . ? 1_555 ? 85 AD2 22 GLY D 16 ? GLY D 8 . ? 1_555 ? 86 AD2 22 THR D 17 ? THR D 9 . ? 1_555 ? 87 AD2 22 PHE D 18 ? PHE D 10 . ? 1_555 ? 88 AD2 22 GLY D 24 ? GLY D 16 . ? 1_555 ? 89 AD2 22 HIS D 25 ? HIS D 17 . ? 1_555 ? 90 AD2 22 THR D 79 ? THR D 71 . ? 1_555 ? 91 AD2 22 LEU D 80 ? LEU D 72 . ? 1_555 ? 92 AD2 22 LEU D 81 ? LEU D 73 . ? 1_555 ? 93 AD2 22 ARG D 95 ? ARG D 87 . ? 1_555 ? 94 AD2 22 GLY D 96 ? GLY D 88 . ? 1_555 ? 95 AD2 22 ARG D 98 ? ARG D 90 . ? 1_555 ? 96 AD2 22 LEU D 109 ? LEU D 101 . ? 1_555 ? 97 AD2 22 ASN D 113 ? ASN D 105 . ? 1_555 ? 98 AD2 22 PRO D 127 ? PRO D 119 . ? 1_555 ? 99 AD2 22 TYR D 131 ? TYR D 123 . ? 1_555 ? 100 AD2 22 ILE D 134 ? ILE D 126 . ? 1_555 ? 101 AD2 22 HOH CA . ? HOH D 326 . ? 1_555 ? 102 AD2 22 HOH CA . ? HOH D 330 . ? 1_555 ? 103 AD2 22 LEU F 138 ? LEU F 130 . ? 1_555 ? 104 AD2 22 GLU F 141 ? GLU F 133 . ? 1_555 ? 105 AD3 2 SER D 135 ? SER D 127 . ? 1_555 ? 106 AD3 2 THR D 137 ? THR D 129 . ? 1_555 ? 107 AD4 3 ALA D 117 ? ALA D 109 . ? 1_555 ? 108 AD4 3 PRO D 118 ? PRO D 110 . ? 1_555 ? 109 AD4 3 ASP D 119 ? ASP D 111 . ? 1_555 ? 110 AD5 21 LEU C 138 ? LEU C 130 . ? 1_555 ? 111 AD5 21 LEU C 145 ? LEU C 137 . ? 1_555 ? 112 AD5 21 TYR E 14 ? TYR E 6 . ? 1_555 ? 113 AD5 21 PRO E 15 ? PRO E 7 . ? 1_555 ? 114 AD5 21 GLY E 16 ? GLY E 8 . ? 1_555 ? 115 AD5 21 THR E 17 ? THR E 9 . ? 1_555 ? 116 AD5 21 PHE E 18 ? PHE E 10 . ? 1_555 ? 117 AD5 21 GLY E 24 ? GLY E 16 . ? 1_555 ? 118 AD5 21 HIS E 25 ? HIS E 17 . ? 1_555 ? 119 AD5 21 PHE E 77 ? PHE E 69 . ? 1_555 ? 120 AD5 21 LEU E 80 ? LEU E 72 . ? 1_555 ? 121 AD5 21 LEU E 81 ? LEU E 73 . ? 1_555 ? 122 AD5 21 ARG E 95 ? ARG E 87 . ? 1_555 ? 123 AD5 21 GLY E 96 ? GLY E 88 . ? 1_555 ? 124 AD5 21 ARG E 98 ? ARG E 90 . ? 1_555 ? 125 AD5 21 GLU E 106 ? GLU E 98 . ? 1_555 ? 126 AD5 21 LEU E 109 ? LEU E 101 . ? 1_555 ? 127 AD5 21 PRO E 127 ? PRO E 119 . ? 1_555 ? 128 AD5 21 TYR E 131 ? TYR E 123 . ? 1_555 ? 129 AD5 21 ILE E 134 ? ILE E 126 . ? 1_555 ? 130 AD5 21 HOH DA . ? HOH E 323 . ? 1_555 ? 131 AD6 5 HOH BA . ? HOH C 322 . ? 4_465 ? 132 AD6 5 VAL E 72 ? VAL E 64 . ? 1_555 ? 133 AD6 5 HOH DA . ? HOH E 311 . ? 1_555 ? 134 AD6 5 HOH DA . ? HOH E 319 . ? 1_555 ? 135 AD6 5 HOH DA . ? HOH E 330 . ? 1_555 ? 136 AD7 3 ALA E 117 ? ALA E 109 . ? 1_555 ? 137 AD7 3 PRO E 118 ? PRO E 110 . ? 1_555 ? 138 AD7 3 ASP E 119 ? ASP E 111 . ? 1_555 ? 139 AD8 25 GLU B 141 ? GLU B 133 . ? 1_555 ? 140 AD8 25 LEU B 145 ? LEU B 137 . ? 1_555 ? 141 AD8 25 TYR F 14 ? TYR F 6 . ? 1_555 ? 142 AD8 25 PRO F 15 ? PRO F 7 . ? 1_555 ? 143 AD8 25 GLY F 16 ? GLY F 8 . ? 1_555 ? 144 AD8 25 THR F 17 ? THR F 9 . ? 1_555 ? 145 AD8 25 PHE F 18 ? PHE F 10 . ? 1_555 ? 146 AD8 25 GLY F 24 ? GLY F 16 . ? 1_555 ? 147 AD8 25 HIS F 25 ? HIS F 17 . ? 1_555 ? 148 AD8 25 LYS F 49 ? LYS F 41 . ? 1_555 ? 149 AD8 25 LEU F 80 ? LEU F 72 . ? 1_555 ? 150 AD8 25 LEU F 81 ? LEU F 73 . ? 1_555 ? 151 AD8 25 ARG F 95 ? ARG F 87 . ? 1_555 ? 152 AD8 25 GLY F 96 ? GLY F 88 . ? 1_555 ? 153 AD8 25 ARG F 98 ? ARG F 90 . ? 1_555 ? 154 AD8 25 GLU F 106 ? GLU F 98 . ? 1_555 ? 155 AD8 25 LEU F 109 ? LEU F 101 . ? 1_555 ? 156 AD8 25 ASN F 113 ? ASN F 105 . ? 1_555 ? 157 AD8 25 PRO F 127 ? PRO F 119 . ? 1_555 ? 158 AD8 25 TYR F 131 ? TYR F 123 . ? 1_555 ? 159 AD8 25 ILE F 134 ? ILE F 126 . ? 1_555 ? 160 AD8 25 HOH EA . ? HOH F 304 . ? 1_555 ? 161 AD8 25 HOH EA . ? HOH F 310 . ? 1_555 ? 162 AD8 25 HOH EA . ? HOH F 311 . ? 1_555 ? 163 AD8 25 HOH EA . ? HOH F 316 . ? 1_555 ? 164 AD9 2 SER F 135 ? SER F 127 . ? 1_555 ? 165 AD9 2 THR F 137 ? THR F 129 . ? 1_555 ? 166 AE1 3 ALA F 117 ? ALA F 109 . ? 1_555 ? 167 AE1 3 PRO F 118 ? PRO F 110 . ? 1_555 ? 168 AE1 3 ASP F 119 ? ASP F 111 . ? 1_555 ? # _atom_sites.entry_id 5TS2 _atom_sites.fract_transf_matrix[1][1] 0.010165 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009867 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009460 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CA CL N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -7 ? ? ? A . n A 1 2 ALA 2 -6 -6 ALA ALA A . n A 1 3 HIS 3 -5 -5 HIS HIS A . n A 1 4 HIS 4 -4 -4 HIS HIS A . n A 1 5 HIS 5 -3 -3 HIS HIS A . n A 1 6 HIS 6 -2 -2 HIS HIS A . n A 1 7 HIS 7 -1 -1 HIS HIS A . n A 1 8 HIS 8 0 0 HIS HIS A . n A 1 9 MET 9 1 1 MET MET A . n A 1 10 ASN 10 2 2 ASN ASN A . n A 1 11 ARG 11 3 3 ARG ARG A . n A 1 12 VAL 12 4 4 VAL VAL A . n A 1 13 LEU 13 5 5 LEU LEU A . n A 1 14 TYR 14 6 6 TYR TYR A . n A 1 15 PRO 15 7 7 PRO PRO A . n A 1 16 GLY 16 8 8 GLY GLY A . n A 1 17 THR 17 9 9 THR THR A . n A 1 18 PHE 18 10 10 PHE PHE A . n A 1 19 ASP 19 11 11 ASP ASP A . n A 1 20 PRO 20 12 12 PRO PRO A . n A 1 21 ILE 21 13 13 ILE ILE A . n A 1 22 THR 22 14 14 THR THR A . n A 1 23 LYS 23 15 15 LYS LYS A . n A 1 24 GLY 24 16 16 GLY GLY A . n A 1 25 HIS 25 17 17 HIS HIS A . n A 1 26 GLY 26 18 18 GLY GLY A . n A 1 27 ASP 27 19 19 ASP ASP A . n A 1 28 LEU 28 20 20 LEU LEU A . n A 1 29 ILE 29 21 21 ILE ILE A . n A 1 30 GLU 30 22 22 GLU GLU A . n A 1 31 ARG 31 23 23 ARG ARG A . n A 1 32 ALA 32 24 24 ALA ALA A . n A 1 33 SER 33 25 25 SER SER A . n A 1 34 ARG 34 26 26 ARG ARG A . n A 1 35 LEU 35 27 27 LEU LEU A . n A 1 36 PHE 36 28 28 PHE PHE A . n A 1 37 ASP 37 29 29 ASP ASP A . n A 1 38 HIS 38 30 30 HIS HIS A . n A 1 39 VAL 39 31 31 VAL VAL A . n A 1 40 ILE 40 32 32 ILE ILE A . n A 1 41 ILE 41 33 33 ILE ILE A . n A 1 42 ALA 42 34 34 ALA ALA A . n A 1 43 VAL 43 35 35 VAL VAL A . n A 1 44 ALA 44 36 36 ALA ALA A . n A 1 45 ALA 45 37 37 ALA ALA A . n A 1 46 SER 46 38 38 SER SER A . n A 1 47 PRO 47 39 39 PRO PRO A . n A 1 48 LYS 48 40 40 LYS LYS A . n A 1 49 LYS 49 41 41 LYS LYS A . n A 1 50 ASN 50 42 42 ASN ASN A . n A 1 51 PRO 51 43 43 PRO PRO A . n A 1 52 LEU 52 44 44 LEU LEU A . n A 1 53 PHE 53 45 45 PHE PHE A . n A 1 54 SER 54 46 46 SER SER A . n A 1 55 LEU 55 47 47 LEU LEU A . n A 1 56 GLU 56 48 48 GLU GLU A . n A 1 57 GLN 57 49 49 GLN GLN A . n A 1 58 ARG 58 50 50 ARG ARG A . n A 1 59 VAL 59 51 51 VAL VAL A . n A 1 60 ALA 60 52 52 ALA ALA A . n A 1 61 LEU 61 53 53 LEU LEU A . n A 1 62 ALA 62 54 54 ALA ALA A . n A 1 63 GLN 63 55 55 GLN GLN A . n A 1 64 GLU 64 56 56 GLU GLU A . n A 1 65 VAL 65 57 57 VAL VAL A . n A 1 66 THR 66 58 58 THR THR A . n A 1 67 LYS 67 59 59 LYS LYS A . n A 1 68 HIS 68 60 60 HIS HIS A . n A 1 69 LEU 69 61 61 LEU LEU A . n A 1 70 PRO 70 62 62 PRO PRO A . n A 1 71 ASN 71 63 63 ASN ASN A . n A 1 72 VAL 72 64 64 VAL VAL A . n A 1 73 GLU 73 65 65 GLU GLU A . n A 1 74 VAL 74 66 66 VAL VAL A . n A 1 75 VAL 75 67 67 VAL VAL A . n A 1 76 GLY 76 68 68 GLY GLY A . n A 1 77 PHE 77 69 69 PHE PHE A . n A 1 78 SER 78 70 70 SER SER A . n A 1 79 THR 79 71 71 THR THR A . n A 1 80 LEU 80 72 72 LEU LEU A . n A 1 81 LEU 81 73 73 LEU LEU A . n A 1 82 ALA 82 74 74 ALA ALA A . n A 1 83 HIS 83 75 75 HIS HIS A . n A 1 84 PHE 84 76 76 PHE PHE A . n A 1 85 VAL 85 77 77 VAL VAL A . n A 1 86 LYS 86 78 78 LYS LYS A . n A 1 87 GLU 87 79 79 GLU GLU A . n A 1 88 GLN 88 80 80 GLN GLN A . n A 1 89 LYS 89 81 81 LYS LYS A . n A 1 90 ALA 90 82 82 ALA ALA A . n A 1 91 ASN 91 83 83 ASN ASN A . n A 1 92 VAL 92 84 84 VAL VAL A . n A 1 93 PHE 93 85 85 PHE PHE A . n A 1 94 LEU 94 86 86 LEU LEU A . n A 1 95 ARG 95 87 87 ARG ARG A . n A 1 96 GLY 96 88 88 GLY GLY A . n A 1 97 LEU 97 89 89 LEU LEU A . n A 1 98 ARG 98 90 90 ARG ARG A . n A 1 99 ALA 99 91 91 ALA ALA A . n A 1 100 VAL 100 92 92 VAL VAL A . n A 1 101 SER 101 93 93 SER SER A . n A 1 102 ASP 102 94 94 ASP ASP A . n A 1 103 PHE 103 95 95 PHE PHE A . n A 1 104 GLU 104 96 96 GLU GLU A . n A 1 105 TYR 105 97 97 TYR TYR A . n A 1 106 GLU 106 98 98 GLU GLU A . n A 1 107 PHE 107 99 99 PHE PHE A . n A 1 108 GLN 108 100 100 GLN GLN A . n A 1 109 LEU 109 101 101 LEU LEU A . n A 1 110 ALA 110 102 102 ALA ALA A . n A 1 111 ASN 111 103 103 ASN ASN A . n A 1 112 MET 112 104 104 MET MET A . n A 1 113 ASN 113 105 105 ASN ASN A . n A 1 114 ARG 114 106 106 ARG ARG A . n A 1 115 GLN 115 107 107 GLN GLN A . n A 1 116 LEU 116 108 108 LEU LEU A . n A 1 117 ALA 117 109 109 ALA ALA A . n A 1 118 PRO 118 110 110 PRO PRO A . n A 1 119 ASP 119 111 111 ASP ASP A . n A 1 120 VAL 120 112 112 VAL VAL A . n A 1 121 GLU 121 113 113 GLU GLU A . n A 1 122 SER 122 114 114 SER SER A . n A 1 123 MET 123 115 115 MET MET A . n A 1 124 PHE 124 116 116 PHE PHE A . n A 1 125 LEU 125 117 117 LEU LEU A . n A 1 126 THR 126 118 118 THR THR A . n A 1 127 PRO 127 119 119 PRO PRO A . n A 1 128 SER 128 120 120 SER SER A . n A 1 129 GLU 129 121 121 GLU GLU A . n A 1 130 LYS 130 122 122 LYS LYS A . n A 1 131 TYR 131 123 123 TYR TYR A . n A 1 132 SER 132 124 124 SER SER A . n A 1 133 PHE 133 125 125 PHE PHE A . n A 1 134 ILE 134 126 126 ILE ILE A . n A 1 135 SER 135 127 127 SER SER A . n A 1 136 SER 136 128 128 SER SER A . n A 1 137 THR 137 129 129 THR THR A . n A 1 138 LEU 138 130 130 LEU LEU A . n A 1 139 VAL 139 131 131 VAL VAL A . n A 1 140 ARG 140 132 132 ARG ARG A . n A 1 141 GLU 141 133 133 GLU GLU A . n A 1 142 ILE 142 134 134 ILE ILE A . n A 1 143 ALA 143 135 135 ALA ALA A . n A 1 144 ALA 144 136 136 ALA ALA A . n A 1 145 LEU 145 137 137 LEU LEU A . n A 1 146 GLY 146 138 138 GLY GLY A . n A 1 147 GLY 147 139 139 GLY GLY A . n A 1 148 ASP 148 140 140 ASP ASP A . n A 1 149 ILE 149 141 141 ILE ILE A . n A 1 150 SER 150 142 142 SER SER A . n A 1 151 LYS 151 143 143 LYS LYS A . n A 1 152 PHE 152 144 144 PHE PHE A . n A 1 153 VAL 153 145 145 VAL VAL A . n A 1 154 HIS 154 146 146 HIS HIS A . n A 1 155 PRO 155 147 147 PRO PRO A . n A 1 156 ALA 156 148 148 ALA ALA A . n A 1 157 VAL 157 149 149 VAL VAL A . n A 1 158 ALA 158 150 150 ALA ALA A . n A 1 159 ASP 159 151 151 ASP ASP A . n A 1 160 ALA 160 152 152 ALA ALA A . n A 1 161 LEU 161 153 153 LEU LEU A . n A 1 162 ALA 162 154 154 ALA ALA A . n A 1 163 GLU 163 155 155 GLU GLU A . n A 1 164 ARG 164 156 156 ARG ARG A . n A 1 165 PHE 165 157 157 PHE PHE A . n A 1 166 LYS 166 158 158 LYS LYS A . n A 1 167 ARG 167 159 ? ? ? A . n B 1 1 MET 1 -7 ? ? ? B . n B 1 2 ALA 2 -6 ? ? ? B . n B 1 3 HIS 3 -5 ? ? ? B . n B 1 4 HIS 4 -4 ? ? ? B . n B 1 5 HIS 5 -3 ? ? ? B . n B 1 6 HIS 6 -2 ? ? ? B . n B 1 7 HIS 7 -1 ? ? ? B . n B 1 8 HIS 8 0 ? ? ? B . n B 1 9 MET 9 1 1 MET MET B . n B 1 10 ASN 10 2 2 ASN ASN B . n B 1 11 ARG 11 3 3 ARG ARG B . n B 1 12 VAL 12 4 4 VAL VAL B . n B 1 13 LEU 13 5 5 LEU LEU B . n B 1 14 TYR 14 6 6 TYR TYR B . n B 1 15 PRO 15 7 7 PRO PRO B . n B 1 16 GLY 16 8 8 GLY GLY B . n B 1 17 THR 17 9 9 THR THR B . n B 1 18 PHE 18 10 10 PHE PHE B . n B 1 19 ASP 19 11 11 ASP ASP B . n B 1 20 PRO 20 12 12 PRO PRO B . n B 1 21 ILE 21 13 13 ILE ILE B . n B 1 22 THR 22 14 14 THR THR B . n B 1 23 LYS 23 15 15 LYS LYS B . n B 1 24 GLY 24 16 16 GLY GLY B . n B 1 25 HIS 25 17 17 HIS HIS B . n B 1 26 GLY 26 18 18 GLY GLY B . n B 1 27 ASP 27 19 19 ASP ASP B . n B 1 28 LEU 28 20 20 LEU LEU B . n B 1 29 ILE 29 21 21 ILE ILE B . n B 1 30 GLU 30 22 22 GLU GLU B . n B 1 31 ARG 31 23 23 ARG ARG B . n B 1 32 ALA 32 24 24 ALA ALA B . n B 1 33 SER 33 25 25 SER SER B . n B 1 34 ARG 34 26 26 ARG ARG B . n B 1 35 LEU 35 27 27 LEU LEU B . n B 1 36 PHE 36 28 28 PHE PHE B . n B 1 37 ASP 37 29 29 ASP ASP B . n B 1 38 HIS 38 30 30 HIS HIS B . n B 1 39 VAL 39 31 31 VAL VAL B . n B 1 40 ILE 40 32 32 ILE ILE B . n B 1 41 ILE 41 33 33 ILE ILE B . n B 1 42 ALA 42 34 34 ALA ALA B . n B 1 43 VAL 43 35 35 VAL VAL B . n B 1 44 ALA 44 36 36 ALA ALA B . n B 1 45 ALA 45 37 37 ALA ALA B . n B 1 46 SER 46 38 38 SER SER B . n B 1 47 PRO 47 39 39 PRO PRO B . n B 1 48 LYS 48 40 40 LYS LYS B . n B 1 49 LYS 49 41 41 LYS LYS B . n B 1 50 ASN 50 42 42 ASN ASN B . n B 1 51 PRO 51 43 43 PRO PRO B . n B 1 52 LEU 52 44 44 LEU LEU B . n B 1 53 PHE 53 45 45 PHE PHE B . n B 1 54 SER 54 46 46 SER SER B . n B 1 55 LEU 55 47 47 LEU LEU B . n B 1 56 GLU 56 48 48 GLU GLU B . n B 1 57 GLN 57 49 49 GLN GLN B . n B 1 58 ARG 58 50 50 ARG ARG B . n B 1 59 VAL 59 51 51 VAL VAL B . n B 1 60 ALA 60 52 52 ALA ALA B . n B 1 61 LEU 61 53 53 LEU LEU B . n B 1 62 ALA 62 54 54 ALA ALA B . n B 1 63 GLN 63 55 55 GLN GLN B . n B 1 64 GLU 64 56 56 GLU GLU B . n B 1 65 VAL 65 57 57 VAL VAL B . n B 1 66 THR 66 58 58 THR THR B . n B 1 67 LYS 67 59 59 LYS LYS B . n B 1 68 HIS 68 60 60 HIS HIS B . n B 1 69 LEU 69 61 61 LEU LEU B . n B 1 70 PRO 70 62 62 PRO PRO B . n B 1 71 ASN 71 63 63 ASN ASN B . n B 1 72 VAL 72 64 64 VAL VAL B . n B 1 73 GLU 73 65 65 GLU GLU B . n B 1 74 VAL 74 66 66 VAL VAL B . n B 1 75 VAL 75 67 67 VAL VAL B . n B 1 76 GLY 76 68 68 GLY GLY B . n B 1 77 PHE 77 69 69 PHE PHE B . n B 1 78 SER 78 70 70 SER SER B . n B 1 79 THR 79 71 71 THR THR B . n B 1 80 LEU 80 72 72 LEU LEU B . n B 1 81 LEU 81 73 73 LEU LEU B . n B 1 82 ALA 82 74 74 ALA ALA B . n B 1 83 HIS 83 75 75 HIS HIS B . n B 1 84 PHE 84 76 76 PHE PHE B . n B 1 85 VAL 85 77 77 VAL VAL B . n B 1 86 LYS 86 78 78 LYS LYS B . n B 1 87 GLU 87 79 79 GLU GLU B . n B 1 88 GLN 88 80 80 GLN GLN B . n B 1 89 LYS 89 81 81 LYS LYS B . n B 1 90 ALA 90 82 82 ALA ALA B . n B 1 91 ASN 91 83 83 ASN ASN B . n B 1 92 VAL 92 84 84 VAL VAL B . n B 1 93 PHE 93 85 85 PHE PHE B . n B 1 94 LEU 94 86 86 LEU LEU B . n B 1 95 ARG 95 87 87 ARG ARG B . n B 1 96 GLY 96 88 88 GLY GLY B . n B 1 97 LEU 97 89 89 LEU LEU B . n B 1 98 ARG 98 90 90 ARG ARG B . n B 1 99 ALA 99 91 91 ALA ALA B . n B 1 100 VAL 100 92 92 VAL VAL B . n B 1 101 SER 101 93 93 SER SER B . n B 1 102 ASP 102 94 94 ASP ASP B . n B 1 103 PHE 103 95 95 PHE PHE B . n B 1 104 GLU 104 96 96 GLU GLU B . n B 1 105 TYR 105 97 97 TYR TYR B . n B 1 106 GLU 106 98 98 GLU GLU B . n B 1 107 PHE 107 99 99 PHE PHE B . n B 1 108 GLN 108 100 100 GLN GLN B . n B 1 109 LEU 109 101 101 LEU LEU B . n B 1 110 ALA 110 102 102 ALA ALA B . n B 1 111 ASN 111 103 103 ASN ASN B . n B 1 112 MET 112 104 104 MET MET B . n B 1 113 ASN 113 105 105 ASN ASN B . n B 1 114 ARG 114 106 106 ARG ARG B . n B 1 115 GLN 115 107 107 GLN GLN B . n B 1 116 LEU 116 108 108 LEU LEU B . n B 1 117 ALA 117 109 109 ALA ALA B . n B 1 118 PRO 118 110 110 PRO PRO B . n B 1 119 ASP 119 111 111 ASP ASP B . n B 1 120 VAL 120 112 112 VAL VAL B . n B 1 121 GLU 121 113 113 GLU GLU B . n B 1 122 SER 122 114 114 SER SER B . n B 1 123 MET 123 115 115 MET MET B . n B 1 124 PHE 124 116 116 PHE PHE B . n B 1 125 LEU 125 117 117 LEU LEU B . n B 1 126 THR 126 118 118 THR THR B . n B 1 127 PRO 127 119 119 PRO PRO B . n B 1 128 SER 128 120 120 SER SER B . n B 1 129 GLU 129 121 121 GLU GLU B . n B 1 130 LYS 130 122 122 LYS LYS B . n B 1 131 TYR 131 123 123 TYR TYR B . n B 1 132 SER 132 124 124 SER SER B . n B 1 133 PHE 133 125 125 PHE PHE B . n B 1 134 ILE 134 126 126 ILE ILE B . n B 1 135 SER 135 127 127 SER SER B . n B 1 136 SER 136 128 128 SER SER B . n B 1 137 THR 137 129 129 THR THR B . n B 1 138 LEU 138 130 130 LEU LEU B . n B 1 139 VAL 139 131 131 VAL VAL B . n B 1 140 ARG 140 132 132 ARG ARG B . n B 1 141 GLU 141 133 133 GLU GLU B . n B 1 142 ILE 142 134 134 ILE ILE B . n B 1 143 ALA 143 135 135 ALA ALA B . n B 1 144 ALA 144 136 136 ALA ALA B . n B 1 145 LEU 145 137 137 LEU LEU B . n B 1 146 GLY 146 138 138 GLY GLY B . n B 1 147 GLY 147 139 139 GLY GLY B . n B 1 148 ASP 148 140 140 ASP ASP B . n B 1 149 ILE 149 141 141 ILE ILE B . n B 1 150 SER 150 142 142 SER SER B . n B 1 151 LYS 151 143 143 LYS LYS B . n B 1 152 PHE 152 144 144 PHE PHE B . n B 1 153 VAL 153 145 145 VAL VAL B . n B 1 154 HIS 154 146 146 HIS HIS B . n B 1 155 PRO 155 147 147 PRO PRO B . n B 1 156 ALA 156 148 148 ALA ALA B . n B 1 157 VAL 157 149 149 VAL VAL B . n B 1 158 ALA 158 150 150 ALA ALA B . n B 1 159 ASP 159 151 151 ASP ASP B . n B 1 160 ALA 160 152 152 ALA ALA B . n B 1 161 LEU 161 153 153 LEU LEU B . n B 1 162 ALA 162 154 154 ALA ALA B . n B 1 163 GLU 163 155 155 GLU GLU B . n B 1 164 ARG 164 156 156 ARG ARG B . n B 1 165 PHE 165 157 157 PHE PHE B . n B 1 166 LYS 166 158 158 LYS LYS B . n B 1 167 ARG 167 159 ? ? ? B . n C 1 1 MET 1 -7 ? ? ? C . n C 1 2 ALA 2 -6 -6 ALA ALA C . n C 1 3 HIS 3 -5 -5 HIS HIS C . n C 1 4 HIS 4 -4 -4 HIS HIS C . n C 1 5 HIS 5 -3 -3 HIS HIS C . n C 1 6 HIS 6 -2 -2 HIS HIS C . n C 1 7 HIS 7 -1 -1 HIS HIS C . n C 1 8 HIS 8 0 0 HIS HIS C . n C 1 9 MET 9 1 1 MET MET C . n C 1 10 ASN 10 2 2 ASN ASN C . n C 1 11 ARG 11 3 3 ARG ARG C . n C 1 12 VAL 12 4 4 VAL VAL C . n C 1 13 LEU 13 5 5 LEU LEU C . n C 1 14 TYR 14 6 6 TYR TYR C . n C 1 15 PRO 15 7 7 PRO PRO C . n C 1 16 GLY 16 8 8 GLY GLY C . n C 1 17 THR 17 9 9 THR THR C . n C 1 18 PHE 18 10 10 PHE PHE C . n C 1 19 ASP 19 11 11 ASP ASP C . n C 1 20 PRO 20 12 12 PRO PRO C . n C 1 21 ILE 21 13 13 ILE ILE C . n C 1 22 THR 22 14 14 THR THR C . n C 1 23 LYS 23 15 15 LYS LYS C . n C 1 24 GLY 24 16 16 GLY GLY C . n C 1 25 HIS 25 17 17 HIS HIS C . n C 1 26 GLY 26 18 18 GLY GLY C . n C 1 27 ASP 27 19 19 ASP ASP C . n C 1 28 LEU 28 20 20 LEU LEU C . n C 1 29 ILE 29 21 21 ILE ILE C . n C 1 30 GLU 30 22 22 GLU GLU C . n C 1 31 ARG 31 23 23 ARG ARG C . n C 1 32 ALA 32 24 24 ALA ALA C . n C 1 33 SER 33 25 25 SER SER C . n C 1 34 ARG 34 26 26 ARG ARG C . n C 1 35 LEU 35 27 27 LEU LEU C . n C 1 36 PHE 36 28 28 PHE PHE C . n C 1 37 ASP 37 29 29 ASP ASP C . n C 1 38 HIS 38 30 30 HIS HIS C . n C 1 39 VAL 39 31 31 VAL VAL C . n C 1 40 ILE 40 32 32 ILE ILE C . n C 1 41 ILE 41 33 33 ILE ILE C . n C 1 42 ALA 42 34 34 ALA ALA C . n C 1 43 VAL 43 35 35 VAL VAL C . n C 1 44 ALA 44 36 36 ALA ALA C . n C 1 45 ALA 45 37 37 ALA ALA C . n C 1 46 SER 46 38 38 SER SER C . n C 1 47 PRO 47 39 39 PRO PRO C . n C 1 48 LYS 48 40 40 LYS LYS C . n C 1 49 LYS 49 41 41 LYS LYS C . n C 1 50 ASN 50 42 42 ASN ASN C . n C 1 51 PRO 51 43 43 PRO PRO C . n C 1 52 LEU 52 44 44 LEU LEU C . n C 1 53 PHE 53 45 45 PHE PHE C . n C 1 54 SER 54 46 46 SER SER C . n C 1 55 LEU 55 47 47 LEU LEU C . n C 1 56 GLU 56 48 48 GLU GLU C . n C 1 57 GLN 57 49 49 GLN GLN C . n C 1 58 ARG 58 50 50 ARG ARG C . n C 1 59 VAL 59 51 51 VAL VAL C . n C 1 60 ALA 60 52 52 ALA ALA C . n C 1 61 LEU 61 53 53 LEU LEU C . n C 1 62 ALA 62 54 54 ALA ALA C . n C 1 63 GLN 63 55 55 GLN GLN C . n C 1 64 GLU 64 56 56 GLU GLU C . n C 1 65 VAL 65 57 57 VAL VAL C . n C 1 66 THR 66 58 58 THR THR C . n C 1 67 LYS 67 59 59 LYS LYS C . n C 1 68 HIS 68 60 60 HIS HIS C . n C 1 69 LEU 69 61 61 LEU LEU C . n C 1 70 PRO 70 62 62 PRO PRO C . n C 1 71 ASN 71 63 63 ASN ASN C . n C 1 72 VAL 72 64 64 VAL VAL C . n C 1 73 GLU 73 65 65 GLU GLU C . n C 1 74 VAL 74 66 66 VAL VAL C . n C 1 75 VAL 75 67 67 VAL VAL C . n C 1 76 GLY 76 68 68 GLY GLY C . n C 1 77 PHE 77 69 69 PHE PHE C . n C 1 78 SER 78 70 70 SER SER C . n C 1 79 THR 79 71 71 THR THR C . n C 1 80 LEU 80 72 72 LEU LEU C . n C 1 81 LEU 81 73 73 LEU LEU C . n C 1 82 ALA 82 74 74 ALA ALA C . n C 1 83 HIS 83 75 75 HIS HIS C . n C 1 84 PHE 84 76 76 PHE PHE C . n C 1 85 VAL 85 77 77 VAL VAL C . n C 1 86 LYS 86 78 78 LYS LYS C . n C 1 87 GLU 87 79 79 GLU GLU C . n C 1 88 GLN 88 80 80 GLN GLN C . n C 1 89 LYS 89 81 81 LYS LYS C . n C 1 90 ALA 90 82 82 ALA ALA C . n C 1 91 ASN 91 83 83 ASN ASN C . n C 1 92 VAL 92 84 84 VAL VAL C . n C 1 93 PHE 93 85 85 PHE PHE C . n C 1 94 LEU 94 86 86 LEU LEU C . n C 1 95 ARG 95 87 87 ARG ARG C . n C 1 96 GLY 96 88 88 GLY GLY C . n C 1 97 LEU 97 89 89 LEU LEU C . n C 1 98 ARG 98 90 90 ARG ARG C . n C 1 99 ALA 99 91 91 ALA ALA C . n C 1 100 VAL 100 92 92 VAL VAL C . n C 1 101 SER 101 93 93 SER SER C . n C 1 102 ASP 102 94 94 ASP ASP C . n C 1 103 PHE 103 95 95 PHE PHE C . n C 1 104 GLU 104 96 96 GLU GLU C . n C 1 105 TYR 105 97 97 TYR TYR C . n C 1 106 GLU 106 98 98 GLU GLU C . n C 1 107 PHE 107 99 99 PHE PHE C . n C 1 108 GLN 108 100 100 GLN GLN C . n C 1 109 LEU 109 101 101 LEU LEU C . n C 1 110 ALA 110 102 102 ALA ALA C . n C 1 111 ASN 111 103 103 ASN ASN C . n C 1 112 MET 112 104 104 MET MET C . n C 1 113 ASN 113 105 105 ASN ASN C . n C 1 114 ARG 114 106 106 ARG ARG C . n C 1 115 GLN 115 107 107 GLN GLN C . n C 1 116 LEU 116 108 108 LEU LEU C . n C 1 117 ALA 117 109 109 ALA ALA C . n C 1 118 PRO 118 110 110 PRO PRO C . n C 1 119 ASP 119 111 111 ASP ASP C . n C 1 120 VAL 120 112 112 VAL VAL C . n C 1 121 GLU 121 113 113 GLU GLU C . n C 1 122 SER 122 114 114 SER SER C . n C 1 123 MET 123 115 115 MET MET C . n C 1 124 PHE 124 116 116 PHE PHE C . n C 1 125 LEU 125 117 117 LEU LEU C . n C 1 126 THR 126 118 118 THR THR C . n C 1 127 PRO 127 119 119 PRO PRO C . n C 1 128 SER 128 120 120 SER SER C . n C 1 129 GLU 129 121 121 GLU GLU C . n C 1 130 LYS 130 122 122 LYS LYS C . n C 1 131 TYR 131 123 123 TYR TYR C . n C 1 132 SER 132 124 124 SER SER C . n C 1 133 PHE 133 125 125 PHE PHE C . n C 1 134 ILE 134 126 126 ILE ILE C . n C 1 135 SER 135 127 127 SER SER C . n C 1 136 SER 136 128 128 SER SER C . n C 1 137 THR 137 129 129 THR THR C . n C 1 138 LEU 138 130 130 LEU LEU C . n C 1 139 VAL 139 131 131 VAL VAL C . n C 1 140 ARG 140 132 132 ARG ARG C . n C 1 141 GLU 141 133 133 GLU GLU C . n C 1 142 ILE 142 134 134 ILE ILE C . n C 1 143 ALA 143 135 135 ALA ALA C . n C 1 144 ALA 144 136 136 ALA ALA C . n C 1 145 LEU 145 137 137 LEU LEU C . n C 1 146 GLY 146 138 138 GLY GLY C . n C 1 147 GLY 147 139 139 GLY GLY C . n C 1 148 ASP 148 140 140 ASP ASP C . n C 1 149 ILE 149 141 141 ILE ILE C . n C 1 150 SER 150 142 142 SER SER C . n C 1 151 LYS 151 143 143 LYS LYS C . n C 1 152 PHE 152 144 144 PHE PHE C . n C 1 153 VAL 153 145 145 VAL VAL C . n C 1 154 HIS 154 146 146 HIS HIS C . n C 1 155 PRO 155 147 147 PRO PRO C . n C 1 156 ALA 156 148 148 ALA ALA C . n C 1 157 VAL 157 149 149 VAL VAL C . n C 1 158 ALA 158 150 150 ALA ALA C . n C 1 159 ASP 159 151 151 ASP ASP C . n C 1 160 ALA 160 152 152 ALA ALA C . n C 1 161 LEU 161 153 153 LEU LEU C . n C 1 162 ALA 162 154 154 ALA ALA C . n C 1 163 GLU 163 155 155 GLU GLU C . n C 1 164 ARG 164 156 156 ARG ARG C . n C 1 165 PHE 165 157 157 PHE PHE C . n C 1 166 LYS 166 158 158 LYS LYS C . n C 1 167 ARG 167 159 ? ? ? C . n D 1 1 MET 1 -7 ? ? ? D . n D 1 2 ALA 2 -6 ? ? ? D . n D 1 3 HIS 3 -5 ? ? ? D . n D 1 4 HIS 4 -4 ? ? ? D . n D 1 5 HIS 5 -3 ? ? ? D . n D 1 6 HIS 6 -2 ? ? ? D . n D 1 7 HIS 7 -1 -1 HIS HIS D . n D 1 8 HIS 8 0 0 HIS HIS D . n D 1 9 MET 9 1 1 MET MET D . n D 1 10 ASN 10 2 2 ASN ASN D . n D 1 11 ARG 11 3 3 ARG ARG D . n D 1 12 VAL 12 4 4 VAL VAL D . n D 1 13 LEU 13 5 5 LEU LEU D . n D 1 14 TYR 14 6 6 TYR TYR D . n D 1 15 PRO 15 7 7 PRO PRO D . n D 1 16 GLY 16 8 8 GLY GLY D . n D 1 17 THR 17 9 9 THR THR D . n D 1 18 PHE 18 10 10 PHE PHE D . n D 1 19 ASP 19 11 11 ASP ASP D . n D 1 20 PRO 20 12 12 PRO PRO D . n D 1 21 ILE 21 13 13 ILE ILE D . n D 1 22 THR 22 14 14 THR THR D . n D 1 23 LYS 23 15 15 LYS LYS D . n D 1 24 GLY 24 16 16 GLY GLY D . n D 1 25 HIS 25 17 17 HIS HIS D . n D 1 26 GLY 26 18 18 GLY GLY D . n D 1 27 ASP 27 19 19 ASP ASP D . n D 1 28 LEU 28 20 20 LEU LEU D . n D 1 29 ILE 29 21 21 ILE ILE D . n D 1 30 GLU 30 22 22 GLU GLU D . n D 1 31 ARG 31 23 23 ARG ARG D . n D 1 32 ALA 32 24 24 ALA ALA D . n D 1 33 SER 33 25 25 SER SER D . n D 1 34 ARG 34 26 26 ARG ARG D . n D 1 35 LEU 35 27 27 LEU LEU D . n D 1 36 PHE 36 28 28 PHE PHE D . n D 1 37 ASP 37 29 29 ASP ASP D . n D 1 38 HIS 38 30 30 HIS HIS D . n D 1 39 VAL 39 31 31 VAL VAL D . n D 1 40 ILE 40 32 32 ILE ILE D . n D 1 41 ILE 41 33 33 ILE ILE D . n D 1 42 ALA 42 34 34 ALA ALA D . n D 1 43 VAL 43 35 35 VAL VAL D . n D 1 44 ALA 44 36 36 ALA ALA D . n D 1 45 ALA 45 37 37 ALA ALA D . n D 1 46 SER 46 38 38 SER SER D . n D 1 47 PRO 47 39 39 PRO PRO D . n D 1 48 LYS 48 40 40 LYS LYS D . n D 1 49 LYS 49 41 41 LYS LYS D . n D 1 50 ASN 50 42 42 ASN ASN D . n D 1 51 PRO 51 43 43 PRO PRO D . n D 1 52 LEU 52 44 44 LEU LEU D . n D 1 53 PHE 53 45 45 PHE PHE D . n D 1 54 SER 54 46 46 SER SER D . n D 1 55 LEU 55 47 47 LEU LEU D . n D 1 56 GLU 56 48 48 GLU GLU D . n D 1 57 GLN 57 49 49 GLN GLN D . n D 1 58 ARG 58 50 50 ARG ARG D . n D 1 59 VAL 59 51 51 VAL VAL D . n D 1 60 ALA 60 52 52 ALA ALA D . n D 1 61 LEU 61 53 53 LEU LEU D . n D 1 62 ALA 62 54 54 ALA ALA D . n D 1 63 GLN 63 55 55 GLN GLN D . n D 1 64 GLU 64 56 56 GLU GLU D . n D 1 65 VAL 65 57 57 VAL VAL D . n D 1 66 THR 66 58 58 THR THR D . n D 1 67 LYS 67 59 59 LYS LYS D . n D 1 68 HIS 68 60 60 HIS HIS D . n D 1 69 LEU 69 61 61 LEU LEU D . n D 1 70 PRO 70 62 62 PRO PRO D . n D 1 71 ASN 71 63 63 ASN ASN D . n D 1 72 VAL 72 64 64 VAL VAL D . n D 1 73 GLU 73 65 65 GLU GLU D . n D 1 74 VAL 74 66 66 VAL VAL D . n D 1 75 VAL 75 67 67 VAL VAL D . n D 1 76 GLY 76 68 68 GLY GLY D . n D 1 77 PHE 77 69 69 PHE PHE D . n D 1 78 SER 78 70 70 SER SER D . n D 1 79 THR 79 71 71 THR THR D . n D 1 80 LEU 80 72 72 LEU LEU D . n D 1 81 LEU 81 73 73 LEU LEU D . n D 1 82 ALA 82 74 74 ALA ALA D . n D 1 83 HIS 83 75 75 HIS HIS D . n D 1 84 PHE 84 76 76 PHE PHE D . n D 1 85 VAL 85 77 77 VAL VAL D . n D 1 86 LYS 86 78 78 LYS LYS D . n D 1 87 GLU 87 79 79 GLU GLU D . n D 1 88 GLN 88 80 80 GLN GLN D . n D 1 89 LYS 89 81 81 LYS LYS D . n D 1 90 ALA 90 82 82 ALA ALA D . n D 1 91 ASN 91 83 83 ASN ASN D . n D 1 92 VAL 92 84 84 VAL VAL D . n D 1 93 PHE 93 85 85 PHE PHE D . n D 1 94 LEU 94 86 86 LEU LEU D . n D 1 95 ARG 95 87 87 ARG ARG D . n D 1 96 GLY 96 88 88 GLY GLY D . n D 1 97 LEU 97 89 89 LEU LEU D . n D 1 98 ARG 98 90 90 ARG ARG D . n D 1 99 ALA 99 91 91 ALA ALA D . n D 1 100 VAL 100 92 92 VAL VAL D . n D 1 101 SER 101 93 93 SER SER D . n D 1 102 ASP 102 94 94 ASP ASP D . n D 1 103 PHE 103 95 95 PHE PHE D . n D 1 104 GLU 104 96 96 GLU GLU D . n D 1 105 TYR 105 97 97 TYR TYR D . n D 1 106 GLU 106 98 98 GLU GLU D . n D 1 107 PHE 107 99 99 PHE PHE D . n D 1 108 GLN 108 100 100 GLN GLN D . n D 1 109 LEU 109 101 101 LEU LEU D . n D 1 110 ALA 110 102 102 ALA ALA D . n D 1 111 ASN 111 103 103 ASN ASN D . n D 1 112 MET 112 104 104 MET MET D . n D 1 113 ASN 113 105 105 ASN ASN D . n D 1 114 ARG 114 106 106 ARG ARG D . n D 1 115 GLN 115 107 107 GLN GLN D . n D 1 116 LEU 116 108 108 LEU LEU D . n D 1 117 ALA 117 109 109 ALA ALA D . n D 1 118 PRO 118 110 110 PRO PRO D . n D 1 119 ASP 119 111 111 ASP ASP D . n D 1 120 VAL 120 112 112 VAL VAL D . n D 1 121 GLU 121 113 113 GLU GLU D . n D 1 122 SER 122 114 114 SER SER D . n D 1 123 MET 123 115 115 MET MET D . n D 1 124 PHE 124 116 116 PHE PHE D . n D 1 125 LEU 125 117 117 LEU LEU D . n D 1 126 THR 126 118 118 THR THR D . n D 1 127 PRO 127 119 119 PRO PRO D . n D 1 128 SER 128 120 120 SER SER D . n D 1 129 GLU 129 121 121 GLU GLU D . n D 1 130 LYS 130 122 122 LYS LYS D . n D 1 131 TYR 131 123 123 TYR TYR D . n D 1 132 SER 132 124 124 SER SER D . n D 1 133 PHE 133 125 125 PHE PHE D . n D 1 134 ILE 134 126 126 ILE ILE D . n D 1 135 SER 135 127 127 SER SER D . n D 1 136 SER 136 128 128 SER SER D . n D 1 137 THR 137 129 129 THR THR D . n D 1 138 LEU 138 130 130 LEU LEU D . n D 1 139 VAL 139 131 131 VAL VAL D . n D 1 140 ARG 140 132 132 ARG ARG D . n D 1 141 GLU 141 133 133 GLU GLU D . n D 1 142 ILE 142 134 134 ILE ILE D . n D 1 143 ALA 143 135 135 ALA ALA D . n D 1 144 ALA 144 136 136 ALA ALA D . n D 1 145 LEU 145 137 137 LEU LEU D . n D 1 146 GLY 146 138 138 GLY GLY D . n D 1 147 GLY 147 139 139 GLY GLY D . n D 1 148 ASP 148 140 140 ASP ASP D . n D 1 149 ILE 149 141 141 ILE ILE D . n D 1 150 SER 150 142 142 SER SER D . n D 1 151 LYS 151 143 143 LYS LYS D . n D 1 152 PHE 152 144 144 PHE PHE D . n D 1 153 VAL 153 145 145 VAL VAL D . n D 1 154 HIS 154 146 146 HIS HIS D . n D 1 155 PRO 155 147 147 PRO PRO D . n D 1 156 ALA 156 148 148 ALA ALA D . n D 1 157 VAL 157 149 149 VAL VAL D . n D 1 158 ALA 158 150 150 ALA ALA D . n D 1 159 ASP 159 151 151 ASP ASP D . n D 1 160 ALA 160 152 152 ALA ALA D . n D 1 161 LEU 161 153 153 LEU LEU D . n D 1 162 ALA 162 154 154 ALA ALA D . n D 1 163 GLU 163 155 155 GLU GLU D . n D 1 164 ARG 164 156 156 ARG ARG D . n D 1 165 PHE 165 157 157 PHE PHE D . n D 1 166 LYS 166 158 ? ? ? D . n D 1 167 ARG 167 159 ? ? ? D . n E 1 1 MET 1 -7 ? ? ? E . n E 1 2 ALA 2 -6 -6 ALA ALA E . n E 1 3 HIS 3 -5 -5 HIS HIS E . n E 1 4 HIS 4 -4 -4 HIS HIS E . n E 1 5 HIS 5 -3 -3 HIS HIS E . n E 1 6 HIS 6 -2 -2 HIS HIS E . n E 1 7 HIS 7 -1 -1 HIS HIS E . n E 1 8 HIS 8 0 0 HIS HIS E . n E 1 9 MET 9 1 1 MET MET E . n E 1 10 ASN 10 2 2 ASN ASN E . n E 1 11 ARG 11 3 3 ARG ARG E . n E 1 12 VAL 12 4 4 VAL VAL E . n E 1 13 LEU 13 5 5 LEU LEU E . n E 1 14 TYR 14 6 6 TYR TYR E . n E 1 15 PRO 15 7 7 PRO PRO E . n E 1 16 GLY 16 8 8 GLY GLY E . n E 1 17 THR 17 9 9 THR THR E . n E 1 18 PHE 18 10 10 PHE PHE E . n E 1 19 ASP 19 11 11 ASP ASP E . n E 1 20 PRO 20 12 12 PRO PRO E . n E 1 21 ILE 21 13 13 ILE ILE E . n E 1 22 THR 22 14 14 THR THR E . n E 1 23 LYS 23 15 15 LYS LYS E . n E 1 24 GLY 24 16 16 GLY GLY E . n E 1 25 HIS 25 17 17 HIS HIS E . n E 1 26 GLY 26 18 18 GLY GLY E . n E 1 27 ASP 27 19 19 ASP ASP E . n E 1 28 LEU 28 20 20 LEU LEU E . n E 1 29 ILE 29 21 21 ILE ILE E . n E 1 30 GLU 30 22 22 GLU GLU E . n E 1 31 ARG 31 23 23 ARG ARG E . n E 1 32 ALA 32 24 24 ALA ALA E . n E 1 33 SER 33 25 25 SER SER E . n E 1 34 ARG 34 26 26 ARG ARG E . n E 1 35 LEU 35 27 27 LEU LEU E . n E 1 36 PHE 36 28 28 PHE PHE E . n E 1 37 ASP 37 29 29 ASP ASP E . n E 1 38 HIS 38 30 30 HIS HIS E . n E 1 39 VAL 39 31 31 VAL VAL E . n E 1 40 ILE 40 32 32 ILE ILE E . n E 1 41 ILE 41 33 33 ILE ILE E . n E 1 42 ALA 42 34 34 ALA ALA E . n E 1 43 VAL 43 35 35 VAL VAL E . n E 1 44 ALA 44 36 36 ALA ALA E . n E 1 45 ALA 45 37 37 ALA ALA E . n E 1 46 SER 46 38 38 SER SER E . n E 1 47 PRO 47 39 39 PRO PRO E . n E 1 48 LYS 48 40 40 LYS LYS E . n E 1 49 LYS 49 41 41 LYS LYS E . n E 1 50 ASN 50 42 42 ASN ASN E . n E 1 51 PRO 51 43 43 PRO PRO E . n E 1 52 LEU 52 44 44 LEU LEU E . n E 1 53 PHE 53 45 45 PHE PHE E . n E 1 54 SER 54 46 46 SER SER E . n E 1 55 LEU 55 47 47 LEU LEU E . n E 1 56 GLU 56 48 48 GLU GLU E . n E 1 57 GLN 57 49 49 GLN GLN E . n E 1 58 ARG 58 50 50 ARG ARG E . n E 1 59 VAL 59 51 51 VAL VAL E . n E 1 60 ALA 60 52 52 ALA ALA E . n E 1 61 LEU 61 53 53 LEU LEU E . n E 1 62 ALA 62 54 54 ALA ALA E . n E 1 63 GLN 63 55 55 GLN GLN E . n E 1 64 GLU 64 56 56 GLU GLU E . n E 1 65 VAL 65 57 57 VAL VAL E . n E 1 66 THR 66 58 58 THR THR E . n E 1 67 LYS 67 59 59 LYS LYS E . n E 1 68 HIS 68 60 60 HIS HIS E . n E 1 69 LEU 69 61 61 LEU LEU E . n E 1 70 PRO 70 62 62 PRO PRO E . n E 1 71 ASN 71 63 63 ASN ASN E . n E 1 72 VAL 72 64 64 VAL VAL E . n E 1 73 GLU 73 65 65 GLU GLU E . n E 1 74 VAL 74 66 66 VAL VAL E . n E 1 75 VAL 75 67 67 VAL VAL E . n E 1 76 GLY 76 68 68 GLY GLY E . n E 1 77 PHE 77 69 69 PHE PHE E . n E 1 78 SER 78 70 70 SER SER E . n E 1 79 THR 79 71 71 THR THR E . n E 1 80 LEU 80 72 72 LEU LEU E . n E 1 81 LEU 81 73 73 LEU LEU E . n E 1 82 ALA 82 74 74 ALA ALA E . n E 1 83 HIS 83 75 75 HIS HIS E . n E 1 84 PHE 84 76 76 PHE PHE E . n E 1 85 VAL 85 77 77 VAL VAL E . n E 1 86 LYS 86 78 78 LYS LYS E . n E 1 87 GLU 87 79 79 GLU GLU E . n E 1 88 GLN 88 80 80 GLN GLN E . n E 1 89 LYS 89 81 81 LYS LYS E . n E 1 90 ALA 90 82 82 ALA ALA E . n E 1 91 ASN 91 83 83 ASN ASN E . n E 1 92 VAL 92 84 84 VAL VAL E . n E 1 93 PHE 93 85 85 PHE PHE E . n E 1 94 LEU 94 86 86 LEU LEU E . n E 1 95 ARG 95 87 87 ARG ARG E . n E 1 96 GLY 96 88 88 GLY GLY E . n E 1 97 LEU 97 89 89 LEU LEU E . n E 1 98 ARG 98 90 90 ARG ARG E . n E 1 99 ALA 99 91 91 ALA ALA E . n E 1 100 VAL 100 92 92 VAL VAL E . n E 1 101 SER 101 93 93 SER SER E . n E 1 102 ASP 102 94 94 ASP ASP E . n E 1 103 PHE 103 95 95 PHE PHE E . n E 1 104 GLU 104 96 96 GLU GLU E . n E 1 105 TYR 105 97 97 TYR TYR E . n E 1 106 GLU 106 98 98 GLU GLU E . n E 1 107 PHE 107 99 99 PHE PHE E . n E 1 108 GLN 108 100 100 GLN GLN E . n E 1 109 LEU 109 101 101 LEU LEU E . n E 1 110 ALA 110 102 102 ALA ALA E . n E 1 111 ASN 111 103 103 ASN ASN E . n E 1 112 MET 112 104 104 MET MET E . n E 1 113 ASN 113 105 105 ASN ASN E . n E 1 114 ARG 114 106 106 ARG ARG E . n E 1 115 GLN 115 107 107 GLN GLN E . n E 1 116 LEU 116 108 108 LEU LEU E . n E 1 117 ALA 117 109 109 ALA ALA E . n E 1 118 PRO 118 110 110 PRO PRO E . n E 1 119 ASP 119 111 111 ASP ASP E . n E 1 120 VAL 120 112 112 VAL VAL E . n E 1 121 GLU 121 113 113 GLU GLU E . n E 1 122 SER 122 114 114 SER SER E . n E 1 123 MET 123 115 115 MET MET E . n E 1 124 PHE 124 116 116 PHE PHE E . n E 1 125 LEU 125 117 117 LEU LEU E . n E 1 126 THR 126 118 118 THR THR E . n E 1 127 PRO 127 119 119 PRO PRO E . n E 1 128 SER 128 120 120 SER SER E . n E 1 129 GLU 129 121 121 GLU GLU E . n E 1 130 LYS 130 122 122 LYS LYS E . n E 1 131 TYR 131 123 123 TYR TYR E . n E 1 132 SER 132 124 124 SER SER E . n E 1 133 PHE 133 125 125 PHE PHE E . n E 1 134 ILE 134 126 126 ILE ILE E . n E 1 135 SER 135 127 127 SER SER E . n E 1 136 SER 136 128 128 SER SER E . n E 1 137 THR 137 129 129 THR THR E . n E 1 138 LEU 138 130 130 LEU LEU E . n E 1 139 VAL 139 131 131 VAL VAL E . n E 1 140 ARG 140 132 132 ARG ARG E . n E 1 141 GLU 141 133 133 GLU GLU E . n E 1 142 ILE 142 134 134 ILE ILE E . n E 1 143 ALA 143 135 135 ALA ALA E . n E 1 144 ALA 144 136 136 ALA ALA E . n E 1 145 LEU 145 137 137 LEU LEU E . n E 1 146 GLY 146 138 138 GLY GLY E . n E 1 147 GLY 147 139 139 GLY GLY E . n E 1 148 ASP 148 140 140 ASP ASP E . n E 1 149 ILE 149 141 141 ILE ILE E . n E 1 150 SER 150 142 142 SER SER E . n E 1 151 LYS 151 143 143 LYS LYS E . n E 1 152 PHE 152 144 144 PHE PHE E . n E 1 153 VAL 153 145 145 VAL VAL E . n E 1 154 HIS 154 146 146 HIS HIS E . n E 1 155 PRO 155 147 147 PRO PRO E . n E 1 156 ALA 156 148 148 ALA ALA E . n E 1 157 VAL 157 149 149 VAL VAL E . n E 1 158 ALA 158 150 150 ALA ALA E . n E 1 159 ASP 159 151 151 ASP ASP E . n E 1 160 ALA 160 152 152 ALA ALA E . n E 1 161 LEU 161 153 153 LEU LEU E . n E 1 162 ALA 162 154 154 ALA ALA E . n E 1 163 GLU 163 155 155 GLU GLU E . n E 1 164 ARG 164 156 156 ARG ARG E . n E 1 165 PHE 165 157 157 PHE PHE E . n E 1 166 LYS 166 158 158 LYS LYS E . n E 1 167 ARG 167 159 ? ? ? E . n F 1 1 MET 1 -7 ? ? ? F . n F 1 2 ALA 2 -6 ? ? ? F . n F 1 3 HIS 3 -5 ? ? ? F . n F 1 4 HIS 4 -4 ? ? ? F . n F 1 5 HIS 5 -3 ? ? ? F . n F 1 6 HIS 6 -2 ? ? ? F . n F 1 7 HIS 7 -1 ? ? ? F . n F 1 8 HIS 8 0 0 HIS HIS F . n F 1 9 MET 9 1 1 MET MET F . n F 1 10 ASN 10 2 2 ASN ASN F . n F 1 11 ARG 11 3 3 ARG ARG F . n F 1 12 VAL 12 4 4 VAL VAL F . n F 1 13 LEU 13 5 5 LEU LEU F . n F 1 14 TYR 14 6 6 TYR TYR F . n F 1 15 PRO 15 7 7 PRO PRO F . n F 1 16 GLY 16 8 8 GLY GLY F . n F 1 17 THR 17 9 9 THR THR F . n F 1 18 PHE 18 10 10 PHE PHE F . n F 1 19 ASP 19 11 11 ASP ASP F . n F 1 20 PRO 20 12 12 PRO PRO F . n F 1 21 ILE 21 13 13 ILE ILE F . n F 1 22 THR 22 14 14 THR THR F . n F 1 23 LYS 23 15 15 LYS LYS F . n F 1 24 GLY 24 16 16 GLY GLY F . n F 1 25 HIS 25 17 17 HIS HIS F . n F 1 26 GLY 26 18 18 GLY GLY F . n F 1 27 ASP 27 19 19 ASP ASP F . n F 1 28 LEU 28 20 20 LEU LEU F . n F 1 29 ILE 29 21 21 ILE ILE F . n F 1 30 GLU 30 22 22 GLU GLU F . n F 1 31 ARG 31 23 23 ARG ARG F . n F 1 32 ALA 32 24 24 ALA ALA F . n F 1 33 SER 33 25 25 SER SER F . n F 1 34 ARG 34 26 26 ARG ARG F . n F 1 35 LEU 35 27 27 LEU LEU F . n F 1 36 PHE 36 28 28 PHE PHE F . n F 1 37 ASP 37 29 29 ASP ASP F . n F 1 38 HIS 38 30 30 HIS HIS F . n F 1 39 VAL 39 31 31 VAL VAL F . n F 1 40 ILE 40 32 32 ILE ILE F . n F 1 41 ILE 41 33 33 ILE ILE F . n F 1 42 ALA 42 34 34 ALA ALA F . n F 1 43 VAL 43 35 35 VAL VAL F . n F 1 44 ALA 44 36 36 ALA ALA F . n F 1 45 ALA 45 37 37 ALA ALA F . n F 1 46 SER 46 38 38 SER SER F . n F 1 47 PRO 47 39 39 PRO PRO F . n F 1 48 LYS 48 40 40 LYS LYS F . n F 1 49 LYS 49 41 41 LYS LYS F . n F 1 50 ASN 50 42 42 ASN ASN F . n F 1 51 PRO 51 43 43 PRO PRO F . n F 1 52 LEU 52 44 44 LEU LEU F . n F 1 53 PHE 53 45 45 PHE PHE F . n F 1 54 SER 54 46 46 SER SER F . n F 1 55 LEU 55 47 47 LEU LEU F . n F 1 56 GLU 56 48 48 GLU GLU F . n F 1 57 GLN 57 49 49 GLN GLN F . n F 1 58 ARG 58 50 50 ARG ARG F . n F 1 59 VAL 59 51 51 VAL VAL F . n F 1 60 ALA 60 52 52 ALA ALA F . n F 1 61 LEU 61 53 53 LEU LEU F . n F 1 62 ALA 62 54 54 ALA ALA F . n F 1 63 GLN 63 55 55 GLN GLN F . n F 1 64 GLU 64 56 56 GLU GLU F . n F 1 65 VAL 65 57 57 VAL VAL F . n F 1 66 THR 66 58 58 THR THR F . n F 1 67 LYS 67 59 59 LYS LYS F . n F 1 68 HIS 68 60 60 HIS HIS F . n F 1 69 LEU 69 61 61 LEU LEU F . n F 1 70 PRO 70 62 62 PRO PRO F . n F 1 71 ASN 71 63 63 ASN ASN F . n F 1 72 VAL 72 64 64 VAL VAL F . n F 1 73 GLU 73 65 65 GLU GLU F . n F 1 74 VAL 74 66 66 VAL VAL F . n F 1 75 VAL 75 67 67 VAL VAL F . n F 1 76 GLY 76 68 68 GLY GLY F . n F 1 77 PHE 77 69 69 PHE PHE F . n F 1 78 SER 78 70 70 SER SER F . n F 1 79 THR 79 71 71 THR THR F . n F 1 80 LEU 80 72 72 LEU LEU F . n F 1 81 LEU 81 73 73 LEU LEU F . n F 1 82 ALA 82 74 74 ALA ALA F . n F 1 83 HIS 83 75 75 HIS HIS F . n F 1 84 PHE 84 76 76 PHE PHE F . n F 1 85 VAL 85 77 77 VAL VAL F . n F 1 86 LYS 86 78 78 LYS LYS F . n F 1 87 GLU 87 79 79 GLU GLU F . n F 1 88 GLN 88 80 80 GLN GLN F . n F 1 89 LYS 89 81 81 LYS LYS F . n F 1 90 ALA 90 82 82 ALA ALA F . n F 1 91 ASN 91 83 83 ASN ASN F . n F 1 92 VAL 92 84 84 VAL VAL F . n F 1 93 PHE 93 85 85 PHE PHE F . n F 1 94 LEU 94 86 86 LEU LEU F . n F 1 95 ARG 95 87 87 ARG ARG F . n F 1 96 GLY 96 88 88 GLY GLY F . n F 1 97 LEU 97 89 89 LEU LEU F . n F 1 98 ARG 98 90 90 ARG ARG F . n F 1 99 ALA 99 91 91 ALA ALA F . n F 1 100 VAL 100 92 92 VAL VAL F . n F 1 101 SER 101 93 93 SER SER F . n F 1 102 ASP 102 94 94 ASP ASP F . n F 1 103 PHE 103 95 95 PHE PHE F . n F 1 104 GLU 104 96 96 GLU GLU F . n F 1 105 TYR 105 97 97 TYR TYR F . n F 1 106 GLU 106 98 98 GLU GLU F . n F 1 107 PHE 107 99 99 PHE PHE F . n F 1 108 GLN 108 100 100 GLN GLN F . n F 1 109 LEU 109 101 101 LEU LEU F . n F 1 110 ALA 110 102 102 ALA ALA F . n F 1 111 ASN 111 103 103 ASN ASN F . n F 1 112 MET 112 104 104 MET MET F . n F 1 113 ASN 113 105 105 ASN ASN F . n F 1 114 ARG 114 106 106 ARG ARG F . n F 1 115 GLN 115 107 107 GLN GLN F . n F 1 116 LEU 116 108 108 LEU LEU F . n F 1 117 ALA 117 109 109 ALA ALA F . n F 1 118 PRO 118 110 110 PRO PRO F . n F 1 119 ASP 119 111 111 ASP ASP F . n F 1 120 VAL 120 112 112 VAL VAL F . n F 1 121 GLU 121 113 113 GLU GLU F . n F 1 122 SER 122 114 114 SER SER F . n F 1 123 MET 123 115 115 MET MET F . n F 1 124 PHE 124 116 116 PHE PHE F . n F 1 125 LEU 125 117 117 LEU LEU F . n F 1 126 THR 126 118 118 THR THR F . n F 1 127 PRO 127 119 119 PRO PRO F . n F 1 128 SER 128 120 120 SER SER F . n F 1 129 GLU 129 121 121 GLU GLU F . n F 1 130 LYS 130 122 122 LYS LYS F . n F 1 131 TYR 131 123 123 TYR TYR F . n F 1 132 SER 132 124 124 SER SER F . n F 1 133 PHE 133 125 125 PHE PHE F . n F 1 134 ILE 134 126 126 ILE ILE F . n F 1 135 SER 135 127 127 SER SER F . n F 1 136 SER 136 128 128 SER SER F . n F 1 137 THR 137 129 129 THR THR F . n F 1 138 LEU 138 130 130 LEU LEU F . n F 1 139 VAL 139 131 131 VAL VAL F . n F 1 140 ARG 140 132 132 ARG ARG F . n F 1 141 GLU 141 133 133 GLU GLU F . n F 1 142 ILE 142 134 134 ILE ILE F . n F 1 143 ALA 143 135 135 ALA ALA F . n F 1 144 ALA 144 136 136 ALA ALA F . n F 1 145 LEU 145 137 137 LEU LEU F . n F 1 146 GLY 146 138 138 GLY GLY F . n F 1 147 GLY 147 139 139 GLY GLY F . n F 1 148 ASP 148 140 140 ASP ASP F . n F 1 149 ILE 149 141 141 ILE ILE F . n F 1 150 SER 150 142 142 SER SER F . n F 1 151 LYS 151 143 143 LYS LYS F . n F 1 152 PHE 152 144 144 PHE PHE F . n F 1 153 VAL 153 145 145 VAL VAL F . n F 1 154 HIS 154 146 146 HIS HIS F . n F 1 155 PRO 155 147 147 PRO PRO F . n F 1 156 ALA 156 148 148 ALA ALA F . n F 1 157 VAL 157 149 149 VAL VAL F . n F 1 158 ALA 158 150 150 ALA ALA F . n F 1 159 ASP 159 151 151 ASP ASP F . n F 1 160 ALA 160 152 152 ALA ALA F . n F 1 161 LEU 161 153 153 LEU LEU F . n F 1 162 ALA 162 154 154 ALA ALA F . n F 1 163 GLU 163 155 155 GLU GLU F . n F 1 164 ARG 164 156 156 ARG ARG F . n F 1 165 PHE 165 157 157 PHE PHE F . n F 1 166 LYS 166 158 158 LYS LYS F . n F 1 167 ARG 167 159 ? ? ? F . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NIAID, National Institute of Allergy and Infectious Diseases' _pdbx_SG_project.full_name_of_center 'Seattle Structural Genomics Center for Infectious Disease' _pdbx_SG_project.initial_of_center SSGCID # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code G 2 COD 1 201 201 COD COD A . H 3 CA 1 202 1 CA CA A . I 4 CL 1 203 5 CL CL A . J 2 COD 1 201 201 COD COD B . K 4 CL 1 202 6 CL CL B . L 4 CL 1 203 9 CL CL B . M 2 COD 1 201 201 COD COD C . N 4 CL 1 202 4 CL CL C . O 4 CL 1 203 8 CL CL C . P 4 CL 1 204 13 CL CL C . Q 2 COD 1 201 201 COD COD D . R 4 CL 1 202 7 CL CL D . S 4 CL 1 203 10 CL CL D . T 2 COD 1 201 201 COD COD E . U 3 CA 1 202 2 CA CA E . V 4 CL 1 203 11 CL CL E . W 2 COD 1 201 201 COD COD F . X 4 CL 1 202 3 CL CL F . Y 4 CL 1 203 12 CL CL F . Z 5 HOH 1 301 12 HOH HOH A . Z 5 HOH 2 302 83 HOH HOH A . Z 5 HOH 3 303 77 HOH HOH A . Z 5 HOH 4 304 64 HOH HOH A . Z 5 HOH 5 305 151 HOH HOH A . Z 5 HOH 6 306 71 HOH HOH A . Z 5 HOH 7 307 72 HOH HOH A . Z 5 HOH 8 308 116 HOH HOH A . Z 5 HOH 9 309 8 HOH HOH A . Z 5 HOH 10 310 152 HOH HOH A . Z 5 HOH 11 311 89 HOH HOH A . Z 5 HOH 12 312 9 HOH HOH A . Z 5 HOH 13 313 2 HOH HOH A . Z 5 HOH 14 314 117 HOH HOH A . Z 5 HOH 15 315 38 HOH HOH A . Z 5 HOH 16 316 145 HOH HOH A . Z 5 HOH 17 317 32 HOH HOH A . Z 5 HOH 18 318 148 HOH HOH A . Z 5 HOH 19 319 31 HOH HOH A . Z 5 HOH 20 320 3 HOH HOH A . Z 5 HOH 21 321 13 HOH HOH A . Z 5 HOH 22 322 44 HOH HOH A . Z 5 HOH 23 323 26 HOH HOH A . Z 5 HOH 24 324 107 HOH HOH A . Z 5 HOH 25 325 158 HOH HOH A . Z 5 HOH 26 326 114 HOH HOH A . Z 5 HOH 27 327 84 HOH HOH A . Z 5 HOH 28 328 35 HOH HOH A . Z 5 HOH 29 329 58 HOH HOH A . Z 5 HOH 30 330 143 HOH HOH A . Z 5 HOH 31 331 10 HOH HOH A . Z 5 HOH 32 332 36 HOH HOH A . Z 5 HOH 33 333 153 HOH HOH A . Z 5 HOH 34 334 154 HOH HOH A . Z 5 HOH 35 335 146 HOH HOH A . Z 5 HOH 36 336 97 HOH HOH A . AA 5 HOH 1 301 120 HOH HOH B . AA 5 HOH 2 302 34 HOH HOH B . AA 5 HOH 3 303 91 HOH HOH B . AA 5 HOH 4 304 7 HOH HOH B . AA 5 HOH 5 305 60 HOH HOH B . AA 5 HOH 6 306 82 HOH HOH B . AA 5 HOH 7 307 55 HOH HOH B . AA 5 HOH 8 308 30 HOH HOH B . AA 5 HOH 9 309 99 HOH HOH B . AA 5 HOH 10 310 70 HOH HOH B . AA 5 HOH 11 311 189 HOH HOH B . AA 5 HOH 12 312 81 HOH HOH B . AA 5 HOH 13 313 69 HOH HOH B . AA 5 HOH 14 314 121 HOH HOH B . AA 5 HOH 15 315 108 HOH HOH B . AA 5 HOH 16 316 118 HOH HOH B . AA 5 HOH 17 317 75 HOH HOH B . AA 5 HOH 18 318 169 HOH HOH B . AA 5 HOH 19 319 155 HOH HOH B . AA 5 HOH 20 320 119 HOH HOH B . AA 5 HOH 21 321 150 HOH HOH B . BA 5 HOH 1 301 87 HOH HOH C . BA 5 HOH 2 302 126 HOH HOH C . BA 5 HOH 3 303 125 HOH HOH C . BA 5 HOH 4 304 41 HOH HOH C . BA 5 HOH 5 305 17 HOH HOH C . BA 5 HOH 6 306 129 HOH HOH C . BA 5 HOH 7 307 25 HOH HOH C . BA 5 HOH 8 308 45 HOH HOH C . BA 5 HOH 9 309 19 HOH HOH C . BA 5 HOH 10 310 123 HOH HOH C . BA 5 HOH 11 311 46 HOH HOH C . BA 5 HOH 12 312 100 HOH HOH C . BA 5 HOH 13 313 47 HOH HOH C . BA 5 HOH 14 314 21 HOH HOH C . BA 5 HOH 15 315 57 HOH HOH C . BA 5 HOH 16 316 79 HOH HOH C . BA 5 HOH 17 317 101 HOH HOH C . BA 5 HOH 18 318 14 HOH HOH C . BA 5 HOH 19 319 67 HOH HOH C . BA 5 HOH 20 320 16 HOH HOH C . BA 5 HOH 21 321 112 HOH HOH C . BA 5 HOH 22 322 171 HOH HOH C . BA 5 HOH 23 323 103 HOH HOH C . BA 5 HOH 24 324 102 HOH HOH C . BA 5 HOH 25 325 156 HOH HOH C . BA 5 HOH 26 326 37 HOH HOH C . BA 5 HOH 27 327 124 HOH HOH C . BA 5 HOH 28 328 48 HOH HOH C . CA 5 HOH 1 301 105 HOH HOH D . CA 5 HOH 2 302 128 HOH HOH D . CA 5 HOH 3 303 52 HOH HOH D . CA 5 HOH 4 304 147 HOH HOH D . CA 5 HOH 5 305 165 HOH HOH D . CA 5 HOH 6 306 66 HOH HOH D . CA 5 HOH 7 307 15 HOH HOH D . CA 5 HOH 8 308 39 HOH HOH D . CA 5 HOH 9 309 167 HOH HOH D . CA 5 HOH 10 310 23 HOH HOH D . CA 5 HOH 11 311 157 HOH HOH D . CA 5 HOH 12 312 159 HOH HOH D . CA 5 HOH 13 313 163 HOH HOH D . CA 5 HOH 14 314 104 HOH HOH D . CA 5 HOH 15 315 74 HOH HOH D . CA 5 HOH 16 316 162 HOH HOH D . CA 5 HOH 17 317 110 HOH HOH D . CA 5 HOH 18 318 22 HOH HOH D . CA 5 HOH 19 319 11 HOH HOH D . CA 5 HOH 20 320 29 HOH HOH D . CA 5 HOH 21 321 62 HOH HOH D . CA 5 HOH 22 322 106 HOH HOH D . CA 5 HOH 23 323 20 HOH HOH D . CA 5 HOH 24 324 1 HOH HOH D . CA 5 HOH 25 325 122 HOH HOH D . CA 5 HOH 26 326 166 HOH HOH D . CA 5 HOH 27 327 144 HOH HOH D . CA 5 HOH 28 328 4 HOH HOH D . CA 5 HOH 29 329 49 HOH HOH D . CA 5 HOH 30 330 6 HOH HOH D . CA 5 HOH 31 331 111 HOH HOH D . CA 5 HOH 32 332 68 HOH HOH D . CA 5 HOH 33 333 164 HOH HOH D . CA 5 HOH 34 334 131 HOH HOH D . CA 5 HOH 35 335 73 HOH HOH D . CA 5 HOH 36 336 109 HOH HOH D . CA 5 HOH 37 337 160 HOH HOH D . CA 5 HOH 38 338 134 HOH HOH D . CA 5 HOH 39 339 133 HOH HOH D . CA 5 HOH 40 340 88 HOH HOH D . CA 5 HOH 41 341 56 HOH HOH D . CA 5 HOH 42 342 161 HOH HOH D . CA 5 HOH 43 343 130 HOH HOH D . CA 5 HOH 44 344 127 HOH HOH D . DA 5 HOH 1 301 175 HOH HOH E . DA 5 HOH 2 302 168 HOH HOH E . DA 5 HOH 3 303 33 HOH HOH E . DA 5 HOH 4 304 115 HOH HOH E . DA 5 HOH 5 305 149 HOH HOH E . DA 5 HOH 6 306 188 HOH HOH E . DA 5 HOH 7 307 187 HOH HOH E . DA 5 HOH 8 308 95 HOH HOH E . DA 5 HOH 9 309 186 HOH HOH E . DA 5 HOH 10 310 42 HOH HOH E . DA 5 HOH 11 311 173 HOH HOH E . DA 5 HOH 12 312 51 HOH HOH E . DA 5 HOH 13 313 178 HOH HOH E . DA 5 HOH 14 314 50 HOH HOH E . DA 5 HOH 15 315 176 HOH HOH E . DA 5 HOH 16 316 40 HOH HOH E . DA 5 HOH 17 317 76 HOH HOH E . DA 5 HOH 18 318 86 HOH HOH E . DA 5 HOH 19 319 174 HOH HOH E . DA 5 HOH 20 320 113 HOH HOH E . DA 5 HOH 21 321 61 HOH HOH E . DA 5 HOH 22 322 177 HOH HOH E . DA 5 HOH 23 323 24 HOH HOH E . DA 5 HOH 24 324 138 HOH HOH E . DA 5 HOH 25 325 5 HOH HOH E . DA 5 HOH 26 326 137 HOH HOH E . DA 5 HOH 27 327 135 HOH HOH E . DA 5 HOH 28 328 136 HOH HOH E . DA 5 HOH 29 329 170 HOH HOH E . DA 5 HOH 30 330 172 HOH HOH E . EA 5 HOH 1 301 94 HOH HOH F . EA 5 HOH 2 302 93 HOH HOH F . EA 5 HOH 3 303 53 HOH HOH F . EA 5 HOH 4 304 179 HOH HOH F . EA 5 HOH 5 305 181 HOH HOH F . EA 5 HOH 6 306 132 HOH HOH F . EA 5 HOH 7 307 182 HOH HOH F . EA 5 HOH 8 308 78 HOH HOH F . EA 5 HOH 9 309 184 HOH HOH F . EA 5 HOH 10 310 180 HOH HOH F . EA 5 HOH 11 311 92 HOH HOH F . EA 5 HOH 12 312 85 HOH HOH F . EA 5 HOH 13 313 96 HOH HOH F . EA 5 HOH 14 314 28 HOH HOH F . EA 5 HOH 15 315 185 HOH HOH F . EA 5 HOH 16 316 27 HOH HOH F . EA 5 HOH 17 317 183 HOH HOH F . EA 5 HOH 18 318 90 HOH HOH F . EA 5 HOH 19 319 80 HOH HOH F . EA 5 HOH 20 320 59 HOH HOH F . EA 5 HOH 21 321 18 HOH HOH F . EA 5 HOH 22 322 43 HOH HOH F . EA 5 HOH 23 323 139 HOH HOH F . EA 5 HOH 24 324 65 HOH HOH F . EA 5 HOH 25 325 54 HOH HOH F . EA 5 HOH 26 326 142 HOH HOH F . EA 5 HOH 27 327 140 HOH HOH F . EA 5 HOH 28 328 98 HOH HOH F . EA 5 HOH 29 329 63 HOH HOH F . EA 5 HOH 30 330 141 HOH HOH F . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? dimeric 2 2 author_defined_assembly ? dimeric 2 3 author_defined_assembly ? dimeric 2 4 software_defined_assembly PISA hexameric 6 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,D,G,H,I,Q,R,S,Z,CA 2 1 B,E,J,K,L,T,U,V,AA,DA 3 1 C,F,M,N,O,P,W,X,Y,BA,EA 4 1 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,AA,BA,CA,DA,EA # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5160 ? 1 MORE -58 ? 1 'SSA (A^2)' 15110 ? 2 'ABSA (A^2)' 5130 ? 2 MORE -65 ? 2 'SSA (A^2)' 15040 ? 3 'ABSA (A^2)' 5710 ? 3 MORE -79 ? 3 'SSA (A^2)' 15040 ? 4 'ABSA (A^2)' 25250 ? 4 MORE -307 ? 4 'SSA (A^2)' 35950 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? BA HOH . ? C HOH 322 ? 4_465 CA ? U CA . ? E CA 202 ? 1_555 O ? E VAL 72 ? E VAL 64 ? 1_555 86.3 ? 2 O ? BA HOH . ? C HOH 322 ? 4_465 CA ? U CA . ? E CA 202 ? 1_555 O ? DA HOH . ? E HOH 311 ? 1_555 91.3 ? 3 O ? E VAL 72 ? E VAL 64 ? 1_555 CA ? U CA . ? E CA 202 ? 1_555 O ? DA HOH . ? E HOH 311 ? 1_555 76.2 ? 4 O ? BA HOH . ? C HOH 322 ? 4_465 CA ? U CA . ? E CA 202 ? 1_555 O ? DA HOH . ? E HOH 319 ? 1_555 140.9 ? 5 O ? E VAL 72 ? E VAL 64 ? 1_555 CA ? U CA . ? E CA 202 ? 1_555 O ? DA HOH . ? E HOH 319 ? 1_555 74.8 ? 6 O ? DA HOH . ? E HOH 311 ? 1_555 CA ? U CA . ? E CA 202 ? 1_555 O ? DA HOH . ? E HOH 319 ? 1_555 51.3 ? 7 O ? BA HOH . ? C HOH 322 ? 4_465 CA ? U CA . ? E CA 202 ? 1_555 O ? DA HOH . ? E HOH 330 ? 1_555 77.1 ? 8 O ? E VAL 72 ? E VAL 64 ? 1_555 CA ? U CA . ? E CA 202 ? 1_555 O ? DA HOH . ? E HOH 330 ? 1_555 91.9 ? 9 O ? DA HOH . ? E HOH 311 ? 1_555 CA ? U CA . ? E CA 202 ? 1_555 O ? DA HOH . ? E HOH 330 ? 1_555 164.0 ? 10 O ? DA HOH . ? E HOH 319 ? 1_555 CA ? U CA . ? E CA 202 ? 1_555 O ? DA HOH . ? E HOH 330 ? 1_555 136.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-11-09 2 'Structure model' 1 1 2017-11-22 3 'Structure model' 1 2 2023-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Derived calculations' 2 2 'Structure model' 'Refinement description' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Derived calculations' 6 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_struct_oper_list 2 2 'Structure model' software 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model 7 3 'Structure model' pdbx_struct_conn_angle 8 3 'Structure model' struct_conn 9 3 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 2 3 'Structure model' '_database_2.pdbx_DOI' 3 3 'Structure model' '_database_2.pdbx_database_accession' 4 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_asym_id' 5 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_asym_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 15 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 16 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 17 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 18 3 'Structure model' '_pdbx_struct_conn_angle.value' 19 3 'Structure model' '_struct_conn.pdbx_dist_value' 20 3 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 21 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 22 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 23 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 24 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 25 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 26 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 27 3 'Structure model' '_struct_conn.ptnr1_symmetry' 28 3 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 29 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 30 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 31 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 32 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 33 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 34 3 'Structure model' '_struct_conn.ptnr2_symmetry' 35 3 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 36 3 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 37 3 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 38 3 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 39 3 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 40 3 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 41 3 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 42 3 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined -1.8244 35.3518 -22.3685 0.3868 0.4032 0.4234 -0.0414 0.0566 -0.0940 9.2625 1.7543 2.9822 4.1862 4.1074 1.1205 0.0707 0.1986 -0.2854 0.4236 -0.2454 -0.1049 0.0318 0.1647 -0.0540 'X-RAY DIFFRACTION' 2 ? refined 7.2608 31.9384 -14.4447 0.3928 0.4070 0.5454 -0.0119 0.1561 -0.1201 3.5555 2.3981 5.2998 2.0633 4.1481 1.6430 0.0158 0.0865 -0.1838 0.3093 -0.1538 -0.2669 0.2647 0.9881 0.5347 'X-RAY DIFFRACTION' 3 ? refined 8.7225 44.4644 -21.6425 0.5116 0.3761 0.4747 -0.0844 0.1567 -0.0736 6.8544 6.9068 5.6710 1.8074 2.0031 3.1685 -0.3996 0.2327 0.1349 0.0885 0.6780 0.2021 -1.1826 -0.8431 0.2185 'X-RAY DIFFRACTION' 4 ? refined 8.7928 41.4847 -25.2597 0.4623 0.4399 0.3717 -0.0961 0.1451 -0.1654 5.0594 4.5270 1.6661 -0.2143 0.0425 -1.3451 0.0004 0.1312 -0.1475 0.6752 -0.1651 -0.7616 -0.6783 -0.3159 0.4158 'X-RAY DIFFRACTION' 5 ? refined -0.1162 41.5098 -14.9697 0.3526 0.5130 0.4608 0.0228 0.0721 -0.0397 6.2106 7.5004 6.7544 -0.5271 4.7545 -3.2962 -0.5061 -0.1070 0.5980 -0.4704 0.4486 -0.8416 0.1324 -0.8899 0.3064 'X-RAY DIFFRACTION' 6 ? refined -6.1120 49.5697 -12.4775 0.5255 0.4242 0.5258 0.0142 -0.0050 -0.0403 4.6254 6.5940 4.4469 0.0021 4.4771 0.3015 0.3863 -0.1981 -0.2014 -0.7948 0.0208 -0.6897 -0.1453 -0.0870 -1.0178 'X-RAY DIFFRACTION' 7 ? refined -7.3047 40.6856 -17.4200 0.4740 0.4027 0.3340 0.0382 -0.0364 -0.0497 4.8705 5.9054 4.6158 -1.9868 3.7782 -4.5384 0.1420 0.0685 -0.1656 -0.1214 -0.4641 0.3684 -0.5994 0.3532 -0.2874 'X-RAY DIFFRACTION' 8 ? refined 10.0901 36.2255 -4.8767 0.5409 0.4091 0.6307 -0.0417 0.0136 -0.0470 3.1807 3.1580 6.5793 2.3088 2.1129 -1.1832 0.3496 -0.3081 -0.1923 -0.3734 0.8043 -0.6917 -0.3172 -0.3334 -0.4567 'X-RAY DIFFRACTION' 9 ? refined 19.4043 48.2323 -7.7518 0.4458 0.2530 0.5814 -0.0487 0.1169 -0.0326 6.1549 3.2726 8.8961 -4.3214 3.2323 -1.1860 -0.4745 0.7278 -0.1036 0.2454 -0.1699 -0.2309 0.0356 -0.7465 -0.4491 'X-RAY DIFFRACTION' 10 ? refined 24.6919 42.2516 -12.3432 0.3599 0.4748 0.7131 -0.0813 0.0980 -0.0787 4.3096 3.0366 9.1998 -2.3244 2.8116 2.1148 0.0365 0.4672 -0.5181 0.5436 -0.7823 -0.7591 -0.3532 0.1096 0.2814 'X-RAY DIFFRACTION' 11 ? refined -22.8845 57.7222 17.1733 0.4212 0.2808 0.4382 0.1187 -0.0148 -0.1153 7.0314 3.2910 6.4311 2.0489 -2.9762 2.8351 -0.4716 0.0061 0.3681 -0.2594 0.6793 -0.5502 -0.2961 -0.2021 -0.1312 'X-RAY DIFFRACTION' 12 ? refined -15.4944 64.1300 19.1757 0.4749 0.4636 0.3327 0.1441 -0.0426 -0.0685 6.0350 2.6793 2.6936 -2.2839 2.0205 1.1375 -0.0802 0.0545 0.0542 -0.2201 0.6177 -0.8154 0.6255 -0.5587 0.4852 'X-RAY DIFFRACTION' 13 ? refined -24.9853 52.9293 22.7203 0.4280 0.4256 0.4211 0.1633 0.0982 -0.0382 4.1219 6.6500 5.4745 -0.6429 1.8057 -4.3709 -0.1552 0.1656 -0.0479 -0.4924 -0.5278 0.4298 0.0424 0.1923 -0.1717 'X-RAY DIFFRACTION' 14 ? refined -24.8911 57.2523 13.7128 0.3468 0.3554 0.3907 0.1365 0.0204 -0.0128 4.8732 2.5233 3.5216 0.4680 1.8305 1.1336 -0.1841 -0.0054 0.2591 -0.0094 -0.1028 0.0937 0.1913 -0.0074 0.0298 'X-RAY DIFFRACTION' 15 ? refined -16.5937 54.4440 7.0370 0.4189 0.3924 0.3832 0.0509 0.0805 0.0037 6.6322 4.4392 5.7169 1.5846 3.7085 2.8716 -0.2366 0.2579 -0.0488 0.0321 -0.2792 -0.1359 -0.1241 -0.1084 0.2233 'X-RAY DIFFRACTION' 16 ? refined -12.6952 48.5152 31.5559 0.5149 0.5599 0.3614 0.1850 0.0335 0.0251 6.5213 5.2826 6.6430 -2.7439 3.5768 -0.7713 -0.7071 0.5518 0.1484 -0.9074 -0.0077 -0.0984 1.0512 0.1060 -0.0800 'X-RAY DIFFRACTION' 17 ? refined 22.7879 47.3744 16.9719 0.5506 0.3064 0.5072 -0.0152 -0.1012 0.0251 0.4165 5.2872 7.1644 -1.2325 0.6084 -6.7410 -0.1683 -0.2396 0.4409 -0.0062 0.1444 -1.1917 0.2620 -0.5029 0.3636 'X-RAY DIFFRACTION' 18 ? refined 19.4253 57.8069 12.5167 0.5454 0.2916 0.3624 -0.0485 -0.1261 -0.0431 3.5228 7.6387 2.0075 -0.9882 -0.9585 -1.7669 -0.0749 -0.0410 0.1665 -0.0118 0.0095 -0.3932 -0.0209 -0.6860 -0.1492 'X-RAY DIFFRACTION' 19 ? refined 26.4503 57.9748 11.4600 0.5109 0.3589 0.6031 -0.0838 -0.0905 -0.0033 1.1936 3.1857 3.8761 0.4272 -0.5622 1.4057 0.0147 0.0812 -0.1338 -0.1034 -0.0999 -0.4418 -0.1559 -0.5920 0.2182 'X-RAY DIFFRACTION' 20 ? refined 15.5186 45.4897 7.7439 0.3239 0.2675 0.4172 -0.0664 -0.0171 0.1040 8.7870 3.3648 7.9271 -1.4048 -0.7902 3.0858 -0.1382 -0.0243 0.1506 0.2417 0.0456 0.1076 0.0245 -0.2274 -0.5319 'X-RAY DIFFRACTION' 21 ? refined 10.6722 69.7024 10.3962 0.6802 0.3547 0.3573 0.0433 0.0212 -0.0448 3.7065 8.1325 3.6140 -1.0142 1.8321 -2.9288 -0.4059 0.2157 0.1932 -0.2202 0.2961 -0.3378 0.0024 -0.4928 -0.1424 'X-RAY DIFFRACTION' 22 ? refined -15.1534 27.3895 -9.2135 0.1921 0.2949 0.3644 0.0207 -0.0319 -0.0689 4.0560 4.9045 8.5862 -0.4399 -2.0064 -0.5895 -0.2906 -0.0864 0.3474 -0.0049 -0.5758 -0.0065 -0.0961 0.4881 0.6396 'X-RAY DIFFRACTION' 23 ? refined -17.3323 35.7746 -14.0217 0.3125 0.3339 0.3364 0.0288 -0.0795 -0.0457 5.8198 5.5365 3.7677 -0.6586 -4.6013 1.2310 0.1541 -0.1281 0.0046 -0.0340 0.1169 0.1372 -0.2526 -0.9763 -0.2617 'X-RAY DIFFRACTION' 24 ? refined -21.5924 26.2893 -3.7956 0.2847 0.2730 0.3479 -0.0192 0.0108 -0.0748 4.3865 4.7934 2.8106 -0.3573 -2.5562 0.3573 -0.1371 -0.1065 0.2902 0.0343 -0.2142 0.6886 0.3814 0.3598 -0.2376 'X-RAY DIFFRACTION' 25 ? refined -15.3569 21.5213 -7.7863 0.2857 0.2938 0.3783 -0.0569 -0.0123 -0.0349 3.0715 1.5614 3.6175 -1.9081 2.1747 -1.1746 0.0348 -0.0863 -0.0284 -0.0961 -0.3842 0.1569 -0.1654 0.2608 -0.4697 'X-RAY DIFFRACTION' 26 ? refined -8.8417 31.6280 -6.4853 0.3198 0.3409 0.3966 0.0297 -0.0150 -0.0040 1.8019 2.3038 2.7637 0.7226 0.9610 -0.2664 -0.1658 0.3557 0.0203 -0.0654 0.3514 0.1180 0.9331 -0.0601 0.1765 'X-RAY DIFFRACTION' 27 ? refined -1.9322 30.4547 -2.6049 0.2262 0.4098 0.4188 -0.0564 -0.0533 0.0117 4.2101 7.4532 4.0360 -0.7688 1.4096 -2.4805 -0.1490 -0.0287 0.1980 0.0252 0.1184 -0.4921 0.4306 -0.2246 0.0376 'X-RAY DIFFRACTION' 28 ? refined -26.9054 40.1245 -1.1332 0.3038 0.3130 0.4342 0.0201 -0.0348 -0.1040 7.9272 4.1515 4.2747 -1.1532 -0.1136 0.6814 0.1141 -0.4662 0.3560 -0.0240 -0.1216 0.4045 -0.0241 -0.4209 -0.3753 'X-RAY DIFFRACTION' 29 ? refined -13.4250 71.4616 -1.5723 0.5224 0.2748 0.3487 0.0838 0.0038 -0.0131 1.3494 1.5871 4.7847 -0.0856 -1.3649 1.1450 0.1490 -0.0856 -0.1293 0.0393 -0.1038 0.0582 -0.4474 -0.6236 -0.2033 'X-RAY DIFFRACTION' 30 ? refined -9.6731 73.5296 -3.4978 0.7730 0.2936 0.3824 0.0894 -0.0085 -0.0068 2.4769 0.5497 3.0183 0.0989 0.3516 -0.3265 0.0612 -0.0554 0.0102 0.1892 0.0916 -0.0556 -0.2500 -0.3348 -0.0190 'X-RAY DIFFRACTION' 31 ? refined -5.0402 65.0851 8.2539 0.4888 0.3692 0.3496 0.0799 0.0151 0.0196 7.7720 3.5925 3.9442 2.3195 4.2789 -1.0708 0.0309 -0.2058 0.0123 0.0592 -0.3777 -0.0137 0.2446 -0.1160 0.2170 'X-RAY DIFFRACTION' 32 ? refined -8.1043 61.9908 -18.5305 0.7192 0.3663 0.3126 -0.0613 -0.0857 -0.0160 5.3318 2.0929 7.7476 -1.8923 -3.0349 -0.4872 0.0766 -0.4428 0.3971 0.0023 0.1066 0.2244 -0.0711 -0.7131 0.2714 'X-RAY DIFFRACTION' 33 ? refined 6.9476 30.8925 22.5050 0.2571 0.3642 0.2699 0.0822 -0.0489 0.0194 6.0398 4.9746 5.6377 2.9099 -0.1574 0.5768 0.2511 -0.1639 -0.0968 -0.1052 -0.0273 -0.0148 0.2021 0.0770 -0.4203 'X-RAY DIFFRACTION' 34 ? refined 7.3333 34.0350 30.0085 0.4170 0.5532 0.3222 0.0333 -0.1092 0.0844 6.4104 3.5762 3.8649 -1.5764 1.7444 -2.0601 0.1090 0.1038 -0.1974 -0.5172 -0.4395 -0.0746 0.6270 -0.1636 -0.0301 'X-RAY DIFFRACTION' 35 ? refined 6.3083 40.8219 19.3677 0.5530 0.5933 0.4645 0.0857 -0.0953 -0.0057 4.3162 2.8061 4.3005 -0.8693 4.2246 -0.9539 0.7441 -0.2197 -0.4782 0.7409 -0.6216 0.2397 -0.6841 0.5970 -0.6549 'X-RAY DIFFRACTION' 36 ? refined -0.5248 48.2989 20.4685 0.7139 0.6072 0.5202 0.1694 -0.0684 -0.0263 4.8198 4.1229 4.8327 4.3059 4.6549 4.3509 -0.6926 0.4344 0.3797 0.4438 0.3454 0.0240 -0.7036 -1.7310 -0.4913 'X-RAY DIFFRACTION' 37 ? refined 8.2862 39.6316 15.1251 0.3949 0.4021 0.2897 0.0528 -0.0287 0.1305 4.6614 7.0354 5.9080 -0.4636 -2.1298 5.7792 -0.2291 0.4019 -0.1326 0.4623 0.2369 0.0417 -0.4203 -0.2138 0.2772 'X-RAY DIFFRACTION' 38 ? refined -1.0765 19.3454 12.1541 0.4463 0.4017 0.3911 -0.1139 -0.0129 0.0041 8.7755 6.5419 5.7293 -1.9830 5.0669 -1.4537 0.4694 0.1157 -0.5530 -0.2651 -0.8622 0.3453 0.2791 0.6679 -0.2587 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A -6 A 14 ;chain 'A' and (resid -6 through 14 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 15 A 27 ;chain 'A' and (resid 15 through 27 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 28 A 46 ;chain 'A' and (resid 28 through 46 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 47 A 79 ;chain 'A' and (resid 47 through 79 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 5 5 A 80 A 94 ;chain 'A' and (resid 80 through 94 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 6 6 A 95 A 108 ;chain 'A' and (resid 95 through 108 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 7 7 A 109 A 117 ;chain 'A' and (resid 109 through 117 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 8 8 A 118 A 127 ;chain 'A' and (resid 118 through 127 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 9 9 A 128 A 136 ;chain 'A' and (resid 128 through 136 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 10 10 A 137 A 158 ;chain 'A' and (resid 137 through 158 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 11 11 B 1 B 14 ;chain 'B' and (resid 1 through 14 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 12 12 B 15 B 27 ;chain 'B' and (resid 15 through 27 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 13 13 B 28 B 58 ;chain 'B' and (resid 28 through 58 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 14 14 B 59 B 94 ;chain 'B' and (resid 59 through 94 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 15 15 B 95 B 127 ;chain 'B' and (resid 95 through 127 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 16 16 B 128 B 158 ;chain 'B' and (resid 128 through 158 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 17 17 C -6 C 14 ;chain 'C' and (resid -6 through 14 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 18 18 C 15 C 46 ;chain 'C' and (resid 15 through 46 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 19 19 C 47 C 79 ;chain 'C' and (resid 47 through 79 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 20 20 C 80 C 117 ;chain 'C' and (resid 80 through 117 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 21 21 C 118 C 158 ;chain 'C' and (resid 118 through 158 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 22 22 D -1 D 14 ;chain 'D' and (resid -1 through 14 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 23 23 D 15 D 27 ;chain 'D' and (resid 15 through 27 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 24 24 D 28 D 58 ;chain 'D' and (resid 28 through 58 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 25 25 D 59 D 79 ;chain 'D' and (resid 59 through 79 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 26 26 D 80 D 94 ;chain 'D' and (resid 80 through 94 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 27 27 D 95 D 117 ;chain 'D' and (resid 95 through 117 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 28 28 D 118 D 157 ;chain 'D' and (resid 118 through 157 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 29 29 E -6 E 46 ;chain 'E' and (resid -6 through 46 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 30 30 E 47 E 94 ;chain 'E' and (resid 47 through 94 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 31 31 E 95 E 118 ;chain 'E' and (resid 95 through 118 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 32 32 E 119 E 158 ;chain 'E' and (resid 119 through 158 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 33 33 F 0 F 58 ;chain 'F' and (resid 0 through 58 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 34 34 F 59 F 79 ;chain 'F' and (resid 59 through 79 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 35 35 F 80 F 94 ;chain 'F' and (resid 80 through 94 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 36 36 F 95 F 108 ;chain 'F' and (resid 95 through 108 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 37 37 F 109 F 127 ;chain 'F' and (resid 109 through 127 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 38 38 F 128 F 158 ;chain 'F' and (resid 128 through 158 ) ; ? ? ? ? ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD1 F ASN 103 ? ? O F HOH 301 ? ? 2.18 2 1 NH2 A ARG 3 ? ? O A GLN 80 ? ? 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN B 63 ? ? -140.12 32.48 2 1 ASN D 63 ? ? -144.06 30.07 3 1 PHE E 157 ? ? -99.33 42.42 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 40 ? CG ? A LYS 48 CG 2 1 Y 1 A LYS 40 ? CD ? A LYS 48 CD 3 1 Y 1 A LYS 40 ? CE ? A LYS 48 CE 4 1 Y 1 A LYS 40 ? NZ ? A LYS 48 NZ 5 1 Y 1 A LYS 41 ? CG ? A LYS 49 CG 6 1 Y 1 A LYS 41 ? CD ? A LYS 49 CD 7 1 Y 1 A LYS 41 ? CE ? A LYS 49 CE 8 1 Y 1 A LYS 41 ? NZ ? A LYS 49 NZ 9 1 Y 1 A GLU 79 ? CG ? A GLU 87 CG 10 1 Y 1 A GLU 79 ? CD ? A GLU 87 CD 11 1 Y 1 A GLU 79 ? OE1 ? A GLU 87 OE1 12 1 Y 1 A GLU 79 ? OE2 ? A GLU 87 OE2 13 1 Y 1 A GLU 121 ? CG ? A GLU 129 CG 14 1 Y 1 A GLU 121 ? CD ? A GLU 129 CD 15 1 Y 1 A GLU 121 ? OE1 ? A GLU 129 OE1 16 1 Y 1 A GLU 121 ? OE2 ? A GLU 129 OE2 17 1 Y 1 A LYS 143 ? CG ? A LYS 151 CG 18 1 Y 1 A LYS 143 ? CD ? A LYS 151 CD 19 1 Y 1 A LYS 143 ? CE ? A LYS 151 CE 20 1 Y 1 A LYS 143 ? NZ ? A LYS 151 NZ 21 1 Y 1 A GLU 155 ? CG ? A GLU 163 CG 22 1 Y 1 A GLU 155 ? CD ? A GLU 163 CD 23 1 Y 1 A GLU 155 ? OE1 ? A GLU 163 OE1 24 1 Y 1 A GLU 155 ? OE2 ? A GLU 163 OE2 25 1 Y 1 A LYS 158 ? CG ? A LYS 166 CG 26 1 Y 1 A LYS 158 ? CD ? A LYS 166 CD 27 1 Y 1 A LYS 158 ? CE ? A LYS 166 CE 28 1 Y 1 A LYS 158 ? NZ ? A LYS 166 NZ 29 1 Y 1 B LYS 41 ? CG ? B LYS 49 CG 30 1 Y 1 B LYS 41 ? CD ? B LYS 49 CD 31 1 Y 1 B LYS 41 ? CE ? B LYS 49 CE 32 1 Y 1 B LYS 41 ? NZ ? B LYS 49 NZ 33 1 Y 1 B LYS 59 ? CG ? B LYS 67 CG 34 1 Y 1 B LYS 59 ? CD ? B LYS 67 CD 35 1 Y 1 B LYS 59 ? CE ? B LYS 67 CE 36 1 Y 1 B LYS 59 ? NZ ? B LYS 67 NZ 37 1 Y 1 B GLU 79 ? CG ? B GLU 87 CG 38 1 Y 1 B GLU 79 ? CD ? B GLU 87 CD 39 1 Y 1 B GLU 79 ? OE1 ? B GLU 87 OE1 40 1 Y 1 B GLU 79 ? OE2 ? B GLU 87 OE2 41 1 Y 1 B SER 120 ? OG ? B SER 128 OG 42 1 Y 1 B GLU 121 ? CG ? B GLU 129 CG 43 1 Y 1 B GLU 121 ? CD ? B GLU 129 CD 44 1 Y 1 B GLU 121 ? OE1 ? B GLU 129 OE1 45 1 Y 1 B GLU 121 ? OE2 ? B GLU 129 OE2 46 1 Y 1 B LYS 122 ? CG ? B LYS 130 CG 47 1 Y 1 B LYS 122 ? CD ? B LYS 130 CD 48 1 Y 1 B LYS 122 ? CE ? B LYS 130 CE 49 1 Y 1 B LYS 122 ? NZ ? B LYS 130 NZ 50 1 Y 1 B LYS 143 ? CG ? B LYS 151 CG 51 1 Y 1 B LYS 143 ? CD ? B LYS 151 CD 52 1 Y 1 B LYS 143 ? CE ? B LYS 151 CE 53 1 Y 1 B LYS 143 ? NZ ? B LYS 151 NZ 54 1 Y 1 B LYS 158 ? CG ? B LYS 166 CG 55 1 Y 1 B LYS 158 ? CD ? B LYS 166 CD 56 1 Y 1 B LYS 158 ? CE ? B LYS 166 CE 57 1 Y 1 B LYS 158 ? NZ ? B LYS 166 NZ 58 1 Y 1 C GLU 48 ? CG ? C GLU 56 CG 59 1 Y 1 C GLU 48 ? CD ? C GLU 56 CD 60 1 Y 1 C GLU 48 ? OE1 ? C GLU 56 OE1 61 1 Y 1 C GLU 48 ? OE2 ? C GLU 56 OE2 62 1 Y 1 C LYS 81 ? CG ? C LYS 89 CG 63 1 Y 1 C LYS 81 ? CD ? C LYS 89 CD 64 1 Y 1 C LYS 81 ? CE ? C LYS 89 CE 65 1 Y 1 C LYS 81 ? NZ ? C LYS 89 NZ 66 1 Y 1 C VAL 92 ? CG1 ? C VAL 100 CG1 67 1 Y 1 C VAL 92 ? CG2 ? C VAL 100 CG2 68 1 Y 1 C GLU 96 ? CG ? C GLU 104 CG 69 1 Y 1 C GLU 96 ? CD ? C GLU 104 CD 70 1 Y 1 C GLU 96 ? OE1 ? C GLU 104 OE1 71 1 Y 1 C GLU 96 ? OE2 ? C GLU 104 OE2 72 1 Y 1 C GLU 121 ? CG ? C GLU 129 CG 73 1 Y 1 C GLU 121 ? CD ? C GLU 129 CD 74 1 Y 1 C GLU 121 ? OE1 ? C GLU 129 OE1 75 1 Y 1 C GLU 121 ? OE2 ? C GLU 129 OE2 76 1 Y 1 C LYS 122 ? CG ? C LYS 130 CG 77 1 Y 1 C LYS 122 ? CD ? C LYS 130 CD 78 1 Y 1 C LYS 122 ? CE ? C LYS 130 CE 79 1 Y 1 C LYS 122 ? NZ ? C LYS 130 NZ 80 1 Y 1 C LYS 158 ? CG ? C LYS 166 CG 81 1 Y 1 C LYS 158 ? CD ? C LYS 166 CD 82 1 Y 1 C LYS 158 ? CE ? C LYS 166 CE 83 1 Y 1 C LYS 158 ? NZ ? C LYS 166 NZ 84 1 Y 1 D HIS -1 ? CG ? D HIS 7 CG 85 1 Y 1 D HIS -1 ? ND1 ? D HIS 7 ND1 86 1 Y 1 D HIS -1 ? CD2 ? D HIS 7 CD2 87 1 Y 1 D HIS -1 ? CE1 ? D HIS 7 CE1 88 1 Y 1 D HIS -1 ? NE2 ? D HIS 7 NE2 89 1 Y 1 D HIS 0 ? CG ? D HIS 8 CG 90 1 Y 1 D HIS 0 ? ND1 ? D HIS 8 ND1 91 1 Y 1 D HIS 0 ? CD2 ? D HIS 8 CD2 92 1 Y 1 D HIS 0 ? CE1 ? D HIS 8 CE1 93 1 Y 1 D HIS 0 ? NE2 ? D HIS 8 NE2 94 1 Y 1 D LYS 40 ? CG ? D LYS 48 CG 95 1 Y 1 D LYS 40 ? CD ? D LYS 48 CD 96 1 Y 1 D LYS 40 ? CE ? D LYS 48 CE 97 1 Y 1 D LYS 40 ? NZ ? D LYS 48 NZ 98 1 Y 1 D LYS 41 ? CG ? D LYS 49 CG 99 1 Y 1 D LYS 41 ? CD ? D LYS 49 CD 100 1 Y 1 D LYS 41 ? CE ? D LYS 49 CE 101 1 Y 1 D LYS 41 ? NZ ? D LYS 49 NZ 102 1 Y 1 D GLU 48 ? CG ? D GLU 56 CG 103 1 Y 1 D GLU 48 ? CD ? D GLU 56 CD 104 1 Y 1 D GLU 48 ? OE1 ? D GLU 56 OE1 105 1 Y 1 D GLU 48 ? OE2 ? D GLU 56 OE2 106 1 Y 1 D VAL 92 ? CG1 ? D VAL 100 CG1 107 1 Y 1 D VAL 92 ? CG2 ? D VAL 100 CG2 108 1 Y 1 D LYS 143 ? CG ? D LYS 151 CG 109 1 Y 1 D LYS 143 ? CD ? D LYS 151 CD 110 1 Y 1 D LYS 143 ? CE ? D LYS 151 CE 111 1 Y 1 D LYS 143 ? NZ ? D LYS 151 NZ 112 1 Y 1 E LYS 40 ? CG ? E LYS 48 CG 113 1 Y 1 E LYS 40 ? CD ? E LYS 48 CD 114 1 Y 1 E LYS 40 ? CE ? E LYS 48 CE 115 1 Y 1 E LYS 40 ? NZ ? E LYS 48 NZ 116 1 Y 1 E LYS 41 ? CG ? E LYS 49 CG 117 1 Y 1 E LYS 41 ? CD ? E LYS 49 CD 118 1 Y 1 E LYS 41 ? CE ? E LYS 49 CE 119 1 Y 1 E LYS 41 ? NZ ? E LYS 49 NZ 120 1 Y 1 E ASN 42 ? CG ? E ASN 50 CG 121 1 Y 1 E ASN 42 ? OD1 ? E ASN 50 OD1 122 1 Y 1 E ASN 42 ? ND2 ? E ASN 50 ND2 123 1 Y 1 E GLU 48 ? CG ? E GLU 56 CG 124 1 Y 1 E GLU 48 ? CD ? E GLU 56 CD 125 1 Y 1 E GLU 48 ? OE1 ? E GLU 56 OE1 126 1 Y 1 E GLU 48 ? OE2 ? E GLU 56 OE2 127 1 Y 1 E GLU 65 ? CG ? E GLU 73 CG 128 1 Y 1 E GLU 65 ? CD ? E GLU 73 CD 129 1 Y 1 E GLU 65 ? OE1 ? E GLU 73 OE1 130 1 Y 1 E GLU 65 ? OE2 ? E GLU 73 OE2 131 1 Y 1 E LYS 78 ? CG ? E LYS 86 CG 132 1 Y 1 E LYS 78 ? CD ? E LYS 86 CD 133 1 Y 1 E LYS 78 ? CE ? E LYS 86 CE 134 1 Y 1 E LYS 78 ? NZ ? E LYS 86 NZ 135 1 Y 1 E GLU 121 ? CG ? E GLU 129 CG 136 1 Y 1 E GLU 121 ? CD ? E GLU 129 CD 137 1 Y 1 E GLU 121 ? OE1 ? E GLU 129 OE1 138 1 Y 1 E GLU 121 ? OE2 ? E GLU 129 OE2 139 1 Y 1 E LYS 143 ? CG ? E LYS 151 CG 140 1 Y 1 E LYS 143 ? CD ? E LYS 151 CD 141 1 Y 1 E LYS 143 ? CE ? E LYS 151 CE 142 1 Y 1 E LYS 143 ? NZ ? E LYS 151 NZ 143 1 Y 1 E LYS 158 ? CG ? E LYS 166 CG 144 1 Y 1 E LYS 158 ? CD ? E LYS 166 CD 145 1 Y 1 E LYS 158 ? CE ? E LYS 166 CE 146 1 Y 1 E LYS 158 ? NZ ? E LYS 166 NZ 147 1 Y 1 F MET 1 ? CG ? F MET 9 CG 148 1 Y 1 F MET 1 ? SD ? F MET 9 SD 149 1 Y 1 F MET 1 ? CE ? F MET 9 CE 150 1 Y 1 F GLU 48 ? CG ? F GLU 56 CG 151 1 Y 1 F GLU 48 ? CD ? F GLU 56 CD 152 1 Y 1 F GLU 48 ? OE1 ? F GLU 56 OE1 153 1 Y 1 F GLU 48 ? OE2 ? F GLU 56 OE2 154 1 Y 1 F GLN 49 ? CG ? F GLN 57 CG 155 1 Y 1 F GLN 49 ? CD ? F GLN 57 CD 156 1 Y 1 F GLN 49 ? OE1 ? F GLN 57 OE1 157 1 Y 1 F GLN 49 ? NE2 ? F GLN 57 NE2 158 1 Y 1 F LYS 81 ? CG ? F LYS 89 CG 159 1 Y 1 F LYS 81 ? CD ? F LYS 89 CD 160 1 Y 1 F LYS 81 ? CE ? F LYS 89 CE 161 1 Y 1 F LYS 81 ? NZ ? F LYS 89 NZ 162 1 Y 1 F VAL 92 ? CG1 ? F VAL 100 CG1 163 1 Y 1 F VAL 92 ? CG2 ? F VAL 100 CG2 164 1 Y 1 F GLU 96 ? CG ? F GLU 104 CG 165 1 Y 1 F GLU 96 ? CD ? F GLU 104 CD 166 1 Y 1 F GLU 96 ? OE1 ? F GLU 104 OE1 167 1 Y 1 F GLU 96 ? OE2 ? F GLU 104 OE2 168 1 Y 1 F GLU 121 ? CG ? F GLU 129 CG 169 1 Y 1 F GLU 121 ? CD ? F GLU 129 CD 170 1 Y 1 F GLU 121 ? OE1 ? F GLU 129 OE1 171 1 Y 1 F GLU 121 ? OE2 ? F GLU 129 OE2 172 1 Y 1 F LYS 122 ? CG ? F LYS 130 CG 173 1 Y 1 F LYS 122 ? CD ? F LYS 130 CD 174 1 Y 1 F LYS 122 ? CE ? F LYS 130 CE 175 1 Y 1 F LYS 122 ? NZ ? F LYS 130 NZ 176 1 Y 1 F LYS 158 ? CG ? F LYS 166 CG 177 1 Y 1 F LYS 158 ? CD ? F LYS 166 CD 178 1 Y 1 F LYS 158 ? CE ? F LYS 166 CE 179 1 Y 1 F LYS 158 ? NZ ? F LYS 166 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -7 ? A MET 1 2 1 Y 1 A ARG 159 ? A ARG 167 3 1 Y 1 B MET -7 ? B MET 1 4 1 Y 1 B ALA -6 ? B ALA 2 5 1 Y 1 B HIS -5 ? B HIS 3 6 1 Y 1 B HIS -4 ? B HIS 4 7 1 Y 1 B HIS -3 ? B HIS 5 8 1 Y 1 B HIS -2 ? B HIS 6 9 1 Y 1 B HIS -1 ? B HIS 7 10 1 Y 1 B HIS 0 ? B HIS 8 11 1 Y 1 B ARG 159 ? B ARG 167 12 1 Y 1 C MET -7 ? C MET 1 13 1 Y 1 C ARG 159 ? C ARG 167 14 1 Y 1 D MET -7 ? D MET 1 15 1 Y 1 D ALA -6 ? D ALA 2 16 1 Y 1 D HIS -5 ? D HIS 3 17 1 Y 1 D HIS -4 ? D HIS 4 18 1 Y 1 D HIS -3 ? D HIS 5 19 1 Y 1 D HIS -2 ? D HIS 6 20 1 Y 1 D LYS 158 ? D LYS 166 21 1 Y 1 D ARG 159 ? D ARG 167 22 1 Y 1 E MET -7 ? E MET 1 23 1 Y 1 E ARG 159 ? E ARG 167 24 1 Y 1 F MET -7 ? F MET 1 25 1 Y 1 F ALA -6 ? F ALA 2 26 1 Y 1 F HIS -5 ? F HIS 3 27 1 Y 1 F HIS -4 ? F HIS 4 28 1 Y 1 F HIS -3 ? F HIS 5 29 1 Y 1 F HIS -2 ? F HIS 6 30 1 Y 1 F HIS -1 ? F HIS 7 31 1 Y 1 F ARG 159 ? F ARG 167 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 CL CL CL N N 75 COD N1 N Y N 76 COD C2 C Y N 77 COD N3 N Y N 78 COD C4 C Y N 79 COD C5 C Y N 80 COD C6 C Y N 81 COD N7 N N N 82 COD N8 N Y N 83 COD C9 C Y N 84 COD N10 N Y N 85 COD C11 C N R 86 COD C12 C N R 87 COD O13 O N N 88 COD C14 C N S 89 COD O15 O N N 90 COD C16 C N R 91 COD O17 O N N 92 COD C18 C N N 93 COD O19 O N N 94 COD P20 P N S 95 COD O21 O N N 96 COD O22 O N N 97 COD O23 O N N 98 COD P24 P N R 99 COD O25 O N N 100 COD O26 O N N 101 COD O27 O N N 102 COD C28 C N N 103 COD C29 C N N 104 COD C30 C N N 105 COD C31 C N N 106 COD C32 C N R 107 COD O33 O N N 108 COD C34 C N N 109 COD O35 O N N 110 COD N36 N N N 111 COD C37 C N N 112 COD C38 C N N 113 COD C39 C N N 114 COD O40 O N N 115 COD N41 N N N 116 COD C42 C N N 117 COD C43 C N N 118 COD S44 S N N 119 COD HC2 H N N 120 COD HN71 H N N 121 COD HN72 H N N 122 COD HC9 H N N 123 COD HC11 H N N 124 COD HC12 H N N 125 COD HO13 H N N 126 COD HC14 H N N 127 COD HO15 H N N 128 COD HC16 H N N 129 COD H181 H N N 130 COD H182 H N N 131 COD HO21 H N N 132 COD HO25 H N N 133 COD H281 H N N 134 COD H282 H N N 135 COD H301 H N N 136 COD H302 H N N 137 COD H303 H N N 138 COD H311 H N N 139 COD H312 H N N 140 COD H313 H N N 141 COD HC32 H N N 142 COD HO33 H N N 143 COD HN36 H N N 144 COD H371 H N N 145 COD H372 H N N 146 COD H381 H N N 147 COD H382 H N N 148 COD HN41 H N N 149 COD H421 H N N 150 COD H422 H N N 151 COD H431 H N N 152 COD H432 H N N 153 COD HS44 H N N 154 GLN N N N N 155 GLN CA C N S 156 GLN C C N N 157 GLN O O N N 158 GLN CB C N N 159 GLN CG C N N 160 GLN CD C N N 161 GLN OE1 O N N 162 GLN NE2 N N N 163 GLN OXT O N N 164 GLN H H N N 165 GLN H2 H N N 166 GLN HA H N N 167 GLN HB2 H N N 168 GLN HB3 H N N 169 GLN HG2 H N N 170 GLN HG3 H N N 171 GLN HE21 H N N 172 GLN HE22 H N N 173 GLN HXT H N N 174 GLU N N N N 175 GLU CA C N S 176 GLU C C N N 177 GLU O O N N 178 GLU CB C N N 179 GLU CG C N N 180 GLU CD C N N 181 GLU OE1 O N N 182 GLU OE2 O N N 183 GLU OXT O N N 184 GLU H H N N 185 GLU H2 H N N 186 GLU HA H N N 187 GLU HB2 H N N 188 GLU HB3 H N N 189 GLU HG2 H N N 190 GLU HG3 H N N 191 GLU HE2 H N N 192 GLU HXT H N N 193 GLY N N N N 194 GLY CA C N N 195 GLY C C N N 196 GLY O O N N 197 GLY OXT O N N 198 GLY H H N N 199 GLY H2 H N N 200 GLY HA2 H N N 201 GLY HA3 H N N 202 GLY HXT H N N 203 HIS N N N N 204 HIS CA C N S 205 HIS C C N N 206 HIS O O N N 207 HIS CB C N N 208 HIS CG C Y N 209 HIS ND1 N Y N 210 HIS CD2 C Y N 211 HIS CE1 C Y N 212 HIS NE2 N Y N 213 HIS OXT O N N 214 HIS H H N N 215 HIS H2 H N N 216 HIS HA H N N 217 HIS HB2 H N N 218 HIS HB3 H N N 219 HIS HD1 H N N 220 HIS HD2 H N N 221 HIS HE1 H N N 222 HIS HE2 H N N 223 HIS HXT H N N 224 HOH O O N N 225 HOH H1 H N N 226 HOH H2 H N N 227 ILE N N N N 228 ILE CA C N S 229 ILE C C N N 230 ILE O O N N 231 ILE CB C N S 232 ILE CG1 C N N 233 ILE CG2 C N N 234 ILE CD1 C N N 235 ILE OXT O N N 236 ILE H H N N 237 ILE H2 H N N 238 ILE HA H N N 239 ILE HB H N N 240 ILE HG12 H N N 241 ILE HG13 H N N 242 ILE HG21 H N N 243 ILE HG22 H N N 244 ILE HG23 H N N 245 ILE HD11 H N N 246 ILE HD12 H N N 247 ILE HD13 H N N 248 ILE HXT H N N 249 LEU N N N N 250 LEU CA C N S 251 LEU C C N N 252 LEU O O N N 253 LEU CB C N N 254 LEU CG C N N 255 LEU CD1 C N N 256 LEU CD2 C N N 257 LEU OXT O N N 258 LEU H H N N 259 LEU H2 H N N 260 LEU HA H N N 261 LEU HB2 H N N 262 LEU HB3 H N N 263 LEU HG H N N 264 LEU HD11 H N N 265 LEU HD12 H N N 266 LEU HD13 H N N 267 LEU HD21 H N N 268 LEU HD22 H N N 269 LEU HD23 H N N 270 LEU HXT H N N 271 LYS N N N N 272 LYS CA C N S 273 LYS C C N N 274 LYS O O N N 275 LYS CB C N N 276 LYS CG C N N 277 LYS CD C N N 278 LYS CE C N N 279 LYS NZ N N N 280 LYS OXT O N N 281 LYS H H N N 282 LYS H2 H N N 283 LYS HA H N N 284 LYS HB2 H N N 285 LYS HB3 H N N 286 LYS HG2 H N N 287 LYS HG3 H N N 288 LYS HD2 H N N 289 LYS HD3 H N N 290 LYS HE2 H N N 291 LYS HE3 H N N 292 LYS HZ1 H N N 293 LYS HZ2 H N N 294 LYS HZ3 H N N 295 LYS HXT H N N 296 MET N N N N 297 MET CA C N S 298 MET C C N N 299 MET O O N N 300 MET CB C N N 301 MET CG C N N 302 MET SD S N N 303 MET CE C N N 304 MET OXT O N N 305 MET H H N N 306 MET H2 H N N 307 MET HA H N N 308 MET HB2 H N N 309 MET HB3 H N N 310 MET HG2 H N N 311 MET HG3 H N N 312 MET HE1 H N N 313 MET HE2 H N N 314 MET HE3 H N N 315 MET HXT H N N 316 PHE N N N N 317 PHE CA C N S 318 PHE C C N N 319 PHE O O N N 320 PHE CB C N N 321 PHE CG C Y N 322 PHE CD1 C Y N 323 PHE CD2 C Y N 324 PHE CE1 C Y N 325 PHE CE2 C Y N 326 PHE CZ C Y N 327 PHE OXT O N N 328 PHE H H N N 329 PHE H2 H N N 330 PHE HA H N N 331 PHE HB2 H N N 332 PHE HB3 H N N 333 PHE HD1 H N N 334 PHE HD2 H N N 335 PHE HE1 H N N 336 PHE HE2 H N N 337 PHE HZ H N N 338 PHE HXT H N N 339 PRO N N N N 340 PRO CA C N S 341 PRO C C N N 342 PRO O O N N 343 PRO CB C N N 344 PRO CG C N N 345 PRO CD C N N 346 PRO OXT O N N 347 PRO H H N N 348 PRO HA H N N 349 PRO HB2 H N N 350 PRO HB3 H N N 351 PRO HG2 H N N 352 PRO HG3 H N N 353 PRO HD2 H N N 354 PRO HD3 H N N 355 PRO HXT H N N 356 SER N N N N 357 SER CA C N S 358 SER C C N N 359 SER O O N N 360 SER CB C N N 361 SER OG O N N 362 SER OXT O N N 363 SER H H N N 364 SER H2 H N N 365 SER HA H N N 366 SER HB2 H N N 367 SER HB3 H N N 368 SER HG H N N 369 SER HXT H N N 370 THR N N N N 371 THR CA C N S 372 THR C C N N 373 THR O O N N 374 THR CB C N R 375 THR OG1 O N N 376 THR CG2 C N N 377 THR OXT O N N 378 THR H H N N 379 THR H2 H N N 380 THR HA H N N 381 THR HB H N N 382 THR HG1 H N N 383 THR HG21 H N N 384 THR HG22 H N N 385 THR HG23 H N N 386 THR HXT H N N 387 TYR N N N N 388 TYR CA C N S 389 TYR C C N N 390 TYR O O N N 391 TYR CB C N N 392 TYR CG C Y N 393 TYR CD1 C Y N 394 TYR CD2 C Y N 395 TYR CE1 C Y N 396 TYR CE2 C Y N 397 TYR CZ C Y N 398 TYR OH O N N 399 TYR OXT O N N 400 TYR H H N N 401 TYR H2 H N N 402 TYR HA H N N 403 TYR HB2 H N N 404 TYR HB3 H N N 405 TYR HD1 H N N 406 TYR HD2 H N N 407 TYR HE1 H N N 408 TYR HE2 H N N 409 TYR HH H N N 410 TYR HXT H N N 411 VAL N N N N 412 VAL CA C N S 413 VAL C C N N 414 VAL O O N N 415 VAL CB C N N 416 VAL CG1 C N N 417 VAL CG2 C N N 418 VAL OXT O N N 419 VAL H H N N 420 VAL H2 H N N 421 VAL HA H N N 422 VAL HB H N N 423 VAL HG11 H N N 424 VAL HG12 H N N 425 VAL HG13 H N N 426 VAL HG21 H N N 427 VAL HG22 H N N 428 VAL HG23 H N N 429 VAL HXT H N N 430 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 COD N1 C2 sing Y N 70 COD N1 C6 doub Y N 71 COD C2 N3 doub Y N 72 COD C2 HC2 sing N N 73 COD N3 C4 sing Y N 74 COD C4 C5 doub Y N 75 COD C4 N10 sing Y N 76 COD C5 C6 sing Y N 77 COD C5 N8 sing Y N 78 COD C6 N7 sing N N 79 COD N7 HN71 sing N N 80 COD N7 HN72 sing N N 81 COD N8 C9 doub Y N 82 COD C9 N10 sing Y N 83 COD C9 HC9 sing N N 84 COD N10 C11 sing N N 85 COD C11 C12 sing N N 86 COD C11 O17 sing N N 87 COD C11 HC11 sing N N 88 COD C12 O13 sing N N 89 COD C12 C14 sing N N 90 COD C12 HC12 sing N N 91 COD O13 HO13 sing N N 92 COD C14 O15 sing N N 93 COD C14 C16 sing N N 94 COD C14 HC14 sing N N 95 COD O15 HO15 sing N N 96 COD C16 O17 sing N N 97 COD C16 C18 sing N N 98 COD C16 HC16 sing N N 99 COD C18 O19 sing N N 100 COD C18 H181 sing N N 101 COD C18 H182 sing N N 102 COD O19 P20 sing N N 103 COD P20 O21 sing N N 104 COD P20 O22 doub N N 105 COD P20 O23 sing N N 106 COD O21 HO21 sing N N 107 COD O23 P24 sing N N 108 COD P24 O25 sing N N 109 COD P24 O26 doub N N 110 COD P24 O27 sing N N 111 COD O25 HO25 sing N N 112 COD O27 C28 sing N N 113 COD C28 C29 sing N N 114 COD C28 H281 sing N N 115 COD C28 H282 sing N N 116 COD C29 C30 sing N N 117 COD C29 C31 sing N N 118 COD C29 C32 sing N N 119 COD C30 H301 sing N N 120 COD C30 H302 sing N N 121 COD C30 H303 sing N N 122 COD C31 H311 sing N N 123 COD C31 H312 sing N N 124 COD C31 H313 sing N N 125 COD C32 O33 sing N N 126 COD C32 C34 sing N N 127 COD C32 HC32 sing N N 128 COD O33 HO33 sing N N 129 COD C34 O35 doub N N 130 COD C34 N36 sing N N 131 COD N36 C37 sing N N 132 COD N36 HN36 sing N N 133 COD C37 C38 sing N N 134 COD C37 H371 sing N N 135 COD C37 H372 sing N N 136 COD C38 C39 sing N N 137 COD C38 H381 sing N N 138 COD C38 H382 sing N N 139 COD C39 O40 doub N N 140 COD C39 N41 sing N N 141 COD N41 C42 sing N N 142 COD N41 HN41 sing N N 143 COD C42 C43 sing N N 144 COD C42 H421 sing N N 145 COD C42 H422 sing N N 146 COD C43 S44 sing N N 147 COD C43 H431 sing N N 148 COD C43 H432 sing N N 149 COD S44 HS44 sing N N 150 GLN N CA sing N N 151 GLN N H sing N N 152 GLN N H2 sing N N 153 GLN CA C sing N N 154 GLN CA CB sing N N 155 GLN CA HA sing N N 156 GLN C O doub N N 157 GLN C OXT sing N N 158 GLN CB CG sing N N 159 GLN CB HB2 sing N N 160 GLN CB HB3 sing N N 161 GLN CG CD sing N N 162 GLN CG HG2 sing N N 163 GLN CG HG3 sing N N 164 GLN CD OE1 doub N N 165 GLN CD NE2 sing N N 166 GLN NE2 HE21 sing N N 167 GLN NE2 HE22 sing N N 168 GLN OXT HXT sing N N 169 GLU N CA sing N N 170 GLU N H sing N N 171 GLU N H2 sing N N 172 GLU CA C sing N N 173 GLU CA CB sing N N 174 GLU CA HA sing N N 175 GLU C O doub N N 176 GLU C OXT sing N N 177 GLU CB CG sing N N 178 GLU CB HB2 sing N N 179 GLU CB HB3 sing N N 180 GLU CG CD sing N N 181 GLU CG HG2 sing N N 182 GLU CG HG3 sing N N 183 GLU CD OE1 doub N N 184 GLU CD OE2 sing N N 185 GLU OE2 HE2 sing N N 186 GLU OXT HXT sing N N 187 GLY N CA sing N N 188 GLY N H sing N N 189 GLY N H2 sing N N 190 GLY CA C sing N N 191 GLY CA HA2 sing N N 192 GLY CA HA3 sing N N 193 GLY C O doub N N 194 GLY C OXT sing N N 195 GLY OXT HXT sing N N 196 HIS N CA sing N N 197 HIS N H sing N N 198 HIS N H2 sing N N 199 HIS CA C sing N N 200 HIS CA CB sing N N 201 HIS CA HA sing N N 202 HIS C O doub N N 203 HIS C OXT sing N N 204 HIS CB CG sing N N 205 HIS CB HB2 sing N N 206 HIS CB HB3 sing N N 207 HIS CG ND1 sing Y N 208 HIS CG CD2 doub Y N 209 HIS ND1 CE1 doub Y N 210 HIS ND1 HD1 sing N N 211 HIS CD2 NE2 sing Y N 212 HIS CD2 HD2 sing N N 213 HIS CE1 NE2 sing Y N 214 HIS CE1 HE1 sing N N 215 HIS NE2 HE2 sing N N 216 HIS OXT HXT sing N N 217 HOH O H1 sing N N 218 HOH O H2 sing N N 219 ILE N CA sing N N 220 ILE N H sing N N 221 ILE N H2 sing N N 222 ILE CA C sing N N 223 ILE CA CB sing N N 224 ILE CA HA sing N N 225 ILE C O doub N N 226 ILE C OXT sing N N 227 ILE CB CG1 sing N N 228 ILE CB CG2 sing N N 229 ILE CB HB sing N N 230 ILE CG1 CD1 sing N N 231 ILE CG1 HG12 sing N N 232 ILE CG1 HG13 sing N N 233 ILE CG2 HG21 sing N N 234 ILE CG2 HG22 sing N N 235 ILE CG2 HG23 sing N N 236 ILE CD1 HD11 sing N N 237 ILE CD1 HD12 sing N N 238 ILE CD1 HD13 sing N N 239 ILE OXT HXT sing N N 240 LEU N CA sing N N 241 LEU N H sing N N 242 LEU N H2 sing N N 243 LEU CA C sing N N 244 LEU CA CB sing N N 245 LEU CA HA sing N N 246 LEU C O doub N N 247 LEU C OXT sing N N 248 LEU CB CG sing N N 249 LEU CB HB2 sing N N 250 LEU CB HB3 sing N N 251 LEU CG CD1 sing N N 252 LEU CG CD2 sing N N 253 LEU CG HG sing N N 254 LEU CD1 HD11 sing N N 255 LEU CD1 HD12 sing N N 256 LEU CD1 HD13 sing N N 257 LEU CD2 HD21 sing N N 258 LEU CD2 HD22 sing N N 259 LEU CD2 HD23 sing N N 260 LEU OXT HXT sing N N 261 LYS N CA sing N N 262 LYS N H sing N N 263 LYS N H2 sing N N 264 LYS CA C sing N N 265 LYS CA CB sing N N 266 LYS CA HA sing N N 267 LYS C O doub N N 268 LYS C OXT sing N N 269 LYS CB CG sing N N 270 LYS CB HB2 sing N N 271 LYS CB HB3 sing N N 272 LYS CG CD sing N N 273 LYS CG HG2 sing N N 274 LYS CG HG3 sing N N 275 LYS CD CE sing N N 276 LYS CD HD2 sing N N 277 LYS CD HD3 sing N N 278 LYS CE NZ sing N N 279 LYS CE HE2 sing N N 280 LYS CE HE3 sing N N 281 LYS NZ HZ1 sing N N 282 LYS NZ HZ2 sing N N 283 LYS NZ HZ3 sing N N 284 LYS OXT HXT sing N N 285 MET N CA sing N N 286 MET N H sing N N 287 MET N H2 sing N N 288 MET CA C sing N N 289 MET CA CB sing N N 290 MET CA HA sing N N 291 MET C O doub N N 292 MET C OXT sing N N 293 MET CB CG sing N N 294 MET CB HB2 sing N N 295 MET CB HB3 sing N N 296 MET CG SD sing N N 297 MET CG HG2 sing N N 298 MET CG HG3 sing N N 299 MET SD CE sing N N 300 MET CE HE1 sing N N 301 MET CE HE2 sing N N 302 MET CE HE3 sing N N 303 MET OXT HXT sing N N 304 PHE N CA sing N N 305 PHE N H sing N N 306 PHE N H2 sing N N 307 PHE CA C sing N N 308 PHE CA CB sing N N 309 PHE CA HA sing N N 310 PHE C O doub N N 311 PHE C OXT sing N N 312 PHE CB CG sing N N 313 PHE CB HB2 sing N N 314 PHE CB HB3 sing N N 315 PHE CG CD1 doub Y N 316 PHE CG CD2 sing Y N 317 PHE CD1 CE1 sing Y N 318 PHE CD1 HD1 sing N N 319 PHE CD2 CE2 doub Y N 320 PHE CD2 HD2 sing N N 321 PHE CE1 CZ doub Y N 322 PHE CE1 HE1 sing N N 323 PHE CE2 CZ sing Y N 324 PHE CE2 HE2 sing N N 325 PHE CZ HZ sing N N 326 PHE OXT HXT sing N N 327 PRO N CA sing N N 328 PRO N CD sing N N 329 PRO N H sing N N 330 PRO CA C sing N N 331 PRO CA CB sing N N 332 PRO CA HA sing N N 333 PRO C O doub N N 334 PRO C OXT sing N N 335 PRO CB CG sing N N 336 PRO CB HB2 sing N N 337 PRO CB HB3 sing N N 338 PRO CG CD sing N N 339 PRO CG HG2 sing N N 340 PRO CG HG3 sing N N 341 PRO CD HD2 sing N N 342 PRO CD HD3 sing N N 343 PRO OXT HXT sing N N 344 SER N CA sing N N 345 SER N H sing N N 346 SER N H2 sing N N 347 SER CA C sing N N 348 SER CA CB sing N N 349 SER CA HA sing N N 350 SER C O doub N N 351 SER C OXT sing N N 352 SER CB OG sing N N 353 SER CB HB2 sing N N 354 SER CB HB3 sing N N 355 SER OG HG sing N N 356 SER OXT HXT sing N N 357 THR N CA sing N N 358 THR N H sing N N 359 THR N H2 sing N N 360 THR CA C sing N N 361 THR CA CB sing N N 362 THR CA HA sing N N 363 THR C O doub N N 364 THR C OXT sing N N 365 THR CB OG1 sing N N 366 THR CB CG2 sing N N 367 THR CB HB sing N N 368 THR OG1 HG1 sing N N 369 THR CG2 HG21 sing N N 370 THR CG2 HG22 sing N N 371 THR CG2 HG23 sing N N 372 THR OXT HXT sing N N 373 TYR N CA sing N N 374 TYR N H sing N N 375 TYR N H2 sing N N 376 TYR CA C sing N N 377 TYR CA CB sing N N 378 TYR CA HA sing N N 379 TYR C O doub N N 380 TYR C OXT sing N N 381 TYR CB CG sing N N 382 TYR CB HB2 sing N N 383 TYR CB HB3 sing N N 384 TYR CG CD1 doub Y N 385 TYR CG CD2 sing Y N 386 TYR CD1 CE1 sing Y N 387 TYR CD1 HD1 sing N N 388 TYR CD2 CE2 doub Y N 389 TYR CD2 HD2 sing N N 390 TYR CE1 CZ doub Y N 391 TYR CE1 HE1 sing N N 392 TYR CE2 CZ sing Y N 393 TYR CE2 HE2 sing N N 394 TYR CZ OH sing N N 395 TYR OH HH sing N N 396 TYR OXT HXT sing N N 397 VAL N CA sing N N 398 VAL N H sing N N 399 VAL N H2 sing N N 400 VAL CA C sing N N 401 VAL CA CB sing N N 402 VAL CA HA sing N N 403 VAL C O doub N N 404 VAL C OXT sing N N 405 VAL CB CG1 sing N N 406 VAL CB CG2 sing N N 407 VAL CB HB sing N N 408 VAL CG1 HG11 sing N N 409 VAL CG1 HG12 sing N N 410 VAL CG1 HG13 sing N N 411 VAL CG2 HG21 sing N N 412 VAL CG2 HG22 sing N N 413 VAL CG2 HG23 sing N N 414 VAL OXT HXT sing N N 415 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'DEPHOSPHO COENZYME A' COD 3 'CALCIUM ION' CA 4 'CHLORIDE ION' CL 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3K9W _pdbx_initial_refinement_model.details ? #