data_5TSB # _entry.id 5TSB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5TSB pdb_00005tsb 10.2210/pdb5tsb/pdb WWPDB D_1000224730 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-09-20 2 'Structure model' 1 1 2017-09-27 3 'Structure model' 1 2 2020-01-01 4 'Structure model' 1 3 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 3 'Structure model' 'Author supporting evidence' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 3 'Structure model' pdbx_audit_support 3 4 'Structure model' chem_comp_atom 4 4 'Structure model' chem_comp_bond 5 4 'Structure model' database_2 6 4 'Structure model' pdbx_entry_details 7 4 'Structure model' pdbx_modification_feature 8 4 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 3 'Structure model' '_pdbx_audit_support.funding_organization' 3 4 'Structure model' '_database_2.pdbx_DOI' 4 4 'Structure model' '_database_2.pdbx_database_accession' 5 4 'Structure model' '_struct_conn.conn_type_id' 6 4 'Structure model' '_struct_conn.id' 7 4 'Structure model' '_struct_conn.pdbx_dist_value' 8 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 9 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 10 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 11 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 12 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 13 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 14 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 15 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 16 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 17 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 18 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 19 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5TSB _pdbx_database_status.recvd_initial_deposition_date 2016-10-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zhang, T.' 1 ? 'Fellner, M.' 2 ? 'Sui, D.' 3 ? 'Liu, J.' 4 ? 'Hu, J.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Adv' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2375-2548 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 3 _citation.language ? _citation.page_first e1700344 _citation.page_last e1700344 _citation.title 'Crystal structures of a ZIP zinc transporter reveal a binuclear metal center in the transport pathway.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1126/sciadv.1700344 _citation.pdbx_database_id_PubMed 28875161 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, T.' 1 ? primary 'Liu, J.' 2 ? primary 'Fellner, M.' 3 ? primary 'Zhang, C.' 4 ? primary 'Sui, D.' 5 ? primary 'Hu, J.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Membrane protein' 31618.920 1 ? ? ? ? 2 non-polymer syn 'CADMIUM ION' 112.411 4 ? ? ? ? 3 water nat water 18.015 6 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)NQPSSLAADLRGAWHAQAQSHPLITLGLAASAAGVVLLLVAGIVNALTGENRVHVGYAVLGGAAGFAATALGAL (MSE)ALGLRAISARTQDA(MSE)LGFAAG(MSE)(MSE)LAASAFSLILPGLDAAGTIVGPGPAAAAVVALGLGLGVLL (MSE)LGLDYFTPHEHERTGHQGPEAARVNRVWLFVLTIILHNLPEG(MSE)AIGVSFATGDLRIGLPLTSAIAIQDVPE GLAVALALRAVGLPIGRAVLVAVASGL(MSE)EPLGALVGVGISSGFALAYPIS(MSE)GLAAGA(MSE)IFVVSHEVIP ETHRNGHETTATVGL(MSE)AGFAL(MSE)(MSE)FLDTALG ; _entity_poly.pdbx_seq_one_letter_code_can ;MNQPSSLAADLRGAWHAQAQSHPLITLGLAASAAGVVLLLVAGIVNALTGENRVHVGYAVLGGAAGFAATALGALMALGL RAISARTQDAMLGFAAGMMLAASAFSLILPGLDAAGTIVGPGPAAAAVVALGLGLGVLLMLGLDYFTPHEHERTGHQGPE AARVNRVWLFVLTIILHNLPEGMAIGVSFATGDLRIGLPLTSAIAIQDVPEGLAVALALRAVGLPIGRAVLVAVASGLME PLGALVGVGISSGFALAYPISMGLAAGAMIFVVSHEVIPETHRNGHETTATVGLMAGFALMMFLDTALG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CADMIUM ION' CD 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 ASN n 1 3 GLN n 1 4 PRO n 1 5 SER n 1 6 SER n 1 7 LEU n 1 8 ALA n 1 9 ALA n 1 10 ASP n 1 11 LEU n 1 12 ARG n 1 13 GLY n 1 14 ALA n 1 15 TRP n 1 16 HIS n 1 17 ALA n 1 18 GLN n 1 19 ALA n 1 20 GLN n 1 21 SER n 1 22 HIS n 1 23 PRO n 1 24 LEU n 1 25 ILE n 1 26 THR n 1 27 LEU n 1 28 GLY n 1 29 LEU n 1 30 ALA n 1 31 ALA n 1 32 SER n 1 33 ALA n 1 34 ALA n 1 35 GLY n 1 36 VAL n 1 37 VAL n 1 38 LEU n 1 39 LEU n 1 40 LEU n 1 41 VAL n 1 42 ALA n 1 43 GLY n 1 44 ILE n 1 45 VAL n 1 46 ASN n 1 47 ALA n 1 48 LEU n 1 49 THR n 1 50 GLY n 1 51 GLU n 1 52 ASN n 1 53 ARG n 1 54 VAL n 1 55 HIS n 1 56 VAL n 1 57 GLY n 1 58 TYR n 1 59 ALA n 1 60 VAL n 1 61 LEU n 1 62 GLY n 1 63 GLY n 1 64 ALA n 1 65 ALA n 1 66 GLY n 1 67 PHE n 1 68 ALA n 1 69 ALA n 1 70 THR n 1 71 ALA n 1 72 LEU n 1 73 GLY n 1 74 ALA n 1 75 LEU n 1 76 MSE n 1 77 ALA n 1 78 LEU n 1 79 GLY n 1 80 LEU n 1 81 ARG n 1 82 ALA n 1 83 ILE n 1 84 SER n 1 85 ALA n 1 86 ARG n 1 87 THR n 1 88 GLN n 1 89 ASP n 1 90 ALA n 1 91 MSE n 1 92 LEU n 1 93 GLY n 1 94 PHE n 1 95 ALA n 1 96 ALA n 1 97 GLY n 1 98 MSE n 1 99 MSE n 1 100 LEU n 1 101 ALA n 1 102 ALA n 1 103 SER n 1 104 ALA n 1 105 PHE n 1 106 SER n 1 107 LEU n 1 108 ILE n 1 109 LEU n 1 110 PRO n 1 111 GLY n 1 112 LEU n 1 113 ASP n 1 114 ALA n 1 115 ALA n 1 116 GLY n 1 117 THR n 1 118 ILE n 1 119 VAL n 1 120 GLY n 1 121 PRO n 1 122 GLY n 1 123 PRO n 1 124 ALA n 1 125 ALA n 1 126 ALA n 1 127 ALA n 1 128 VAL n 1 129 VAL n 1 130 ALA n 1 131 LEU n 1 132 GLY n 1 133 LEU n 1 134 GLY n 1 135 LEU n 1 136 GLY n 1 137 VAL n 1 138 LEU n 1 139 LEU n 1 140 MSE n 1 141 LEU n 1 142 GLY n 1 143 LEU n 1 144 ASP n 1 145 TYR n 1 146 PHE n 1 147 THR n 1 148 PRO n 1 149 HIS n 1 150 GLU n 1 151 HIS n 1 152 GLU n 1 153 ARG n 1 154 THR n 1 155 GLY n 1 156 HIS n 1 157 GLN n 1 158 GLY n 1 159 PRO n 1 160 GLU n 1 161 ALA n 1 162 ALA n 1 163 ARG n 1 164 VAL n 1 165 ASN n 1 166 ARG n 1 167 VAL n 1 168 TRP n 1 169 LEU n 1 170 PHE n 1 171 VAL n 1 172 LEU n 1 173 THR n 1 174 ILE n 1 175 ILE n 1 176 LEU n 1 177 HIS n 1 178 ASN n 1 179 LEU n 1 180 PRO n 1 181 GLU n 1 182 GLY n 1 183 MSE n 1 184 ALA n 1 185 ILE n 1 186 GLY n 1 187 VAL n 1 188 SER n 1 189 PHE n 1 190 ALA n 1 191 THR n 1 192 GLY n 1 193 ASP n 1 194 LEU n 1 195 ARG n 1 196 ILE n 1 197 GLY n 1 198 LEU n 1 199 PRO n 1 200 LEU n 1 201 THR n 1 202 SER n 1 203 ALA n 1 204 ILE n 1 205 ALA n 1 206 ILE n 1 207 GLN n 1 208 ASP n 1 209 VAL n 1 210 PRO n 1 211 GLU n 1 212 GLY n 1 213 LEU n 1 214 ALA n 1 215 VAL n 1 216 ALA n 1 217 LEU n 1 218 ALA n 1 219 LEU n 1 220 ARG n 1 221 ALA n 1 222 VAL n 1 223 GLY n 1 224 LEU n 1 225 PRO n 1 226 ILE n 1 227 GLY n 1 228 ARG n 1 229 ALA n 1 230 VAL n 1 231 LEU n 1 232 VAL n 1 233 ALA n 1 234 VAL n 1 235 ALA n 1 236 SER n 1 237 GLY n 1 238 LEU n 1 239 MSE n 1 240 GLU n 1 241 PRO n 1 242 LEU n 1 243 GLY n 1 244 ALA n 1 245 LEU n 1 246 VAL n 1 247 GLY n 1 248 VAL n 1 249 GLY n 1 250 ILE n 1 251 SER n 1 252 SER n 1 253 GLY n 1 254 PHE n 1 255 ALA n 1 256 LEU n 1 257 ALA n 1 258 TYR n 1 259 PRO n 1 260 ILE n 1 261 SER n 1 262 MSE n 1 263 GLY n 1 264 LEU n 1 265 ALA n 1 266 ALA n 1 267 GLY n 1 268 ALA n 1 269 MSE n 1 270 ILE n 1 271 PHE n 1 272 VAL n 1 273 VAL n 1 274 SER n 1 275 HIS n 1 276 GLU n 1 277 VAL n 1 278 ILE n 1 279 PRO n 1 280 GLU n 1 281 THR n 1 282 HIS n 1 283 ARG n 1 284 ASN n 1 285 GLY n 1 286 HIS n 1 287 GLU n 1 288 THR n 1 289 THR n 1 290 ALA n 1 291 THR n 1 292 VAL n 1 293 GLY n 1 294 LEU n 1 295 MSE n 1 296 ALA n 1 297 GLY n 1 298 PHE n 1 299 ALA n 1 300 LEU n 1 301 MSE n 1 302 MSE n 1 303 PHE n 1 304 LEU n 1 305 ASP n 1 306 THR n 1 307 ALA n 1 308 LEU n 1 309 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 309 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene BB2405 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC BAA-588 / NCTC 13252 / RB50' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 257310 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'C41(DE3) pLysS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pLW01 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CD non-polymer . 'CADMIUM ION' ? 'Cd 2' 112.411 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 ASN 2 2 ? ? ? A . n A 1 3 GLN 3 3 ? ? ? A . n A 1 4 PRO 4 4 ? ? ? A . n A 1 5 SER 5 5 ? ? ? A . n A 1 6 SER 6 6 ? ? ? A . n A 1 7 LEU 7 7 ? ? ? A . n A 1 8 ALA 8 8 ? ? ? A . n A 1 9 ALA 9 9 ? ? ? A . n A 1 10 ASP 10 10 ? ? ? A . n A 1 11 LEU 11 11 ? ? ? A . n A 1 12 ARG 12 12 ? ? ? A . n A 1 13 GLY 13 13 ? ? ? A . n A 1 14 ALA 14 14 ? ? ? A . n A 1 15 TRP 15 15 ? ? ? A . n A 1 16 HIS 16 16 ? ? ? A . n A 1 17 ALA 17 17 ? ? ? A . n A 1 18 GLN 18 18 ? ? ? A . n A 1 19 ALA 19 19 ? ? ? A . n A 1 20 GLN 20 20 ? ? ? A . n A 1 21 SER 21 21 ? ? ? A . n A 1 22 HIS 22 22 ? ? ? A . n A 1 23 PRO 23 23 ? ? ? A . n A 1 24 LEU 24 24 ? ? ? A . n A 1 25 ILE 25 25 ? ? ? A . n A 1 26 THR 26 26 ? ? ? A . n A 1 27 LEU 27 27 ? ? ? A . n A 1 28 GLY 28 28 ? ? ? A . n A 1 29 LEU 29 29 ? ? ? A . n A 1 30 ALA 30 30 ? ? ? A . n A 1 31 ALA 31 31 ? ? ? A . n A 1 32 SER 32 32 ? ? ? A . n A 1 33 ALA 33 33 ? ? ? A . n A 1 34 ALA 34 34 ? ? ? A . n A 1 35 GLY 35 35 ? ? ? A . n A 1 36 VAL 36 36 ? ? ? A . n A 1 37 VAL 37 37 ? ? ? A . n A 1 38 LEU 38 38 ? ? ? A . n A 1 39 LEU 39 39 ? ? ? A . n A 1 40 LEU 40 40 ? ? ? A . n A 1 41 VAL 41 41 ? ? ? A . n A 1 42 ALA 42 42 ? ? ? A . n A 1 43 GLY 43 43 ? ? ? A . n A 1 44 ILE 44 44 ? ? ? A . n A 1 45 VAL 45 45 ? ? ? A . n A 1 46 ASN 46 46 ? ? ? A . n A 1 47 ALA 47 47 ? ? ? A . n A 1 48 LEU 48 48 ? ? ? A . n A 1 49 THR 49 49 ? ? ? A . n A 1 50 GLY 50 50 ? ? ? A . n A 1 51 GLU 51 51 ? ? ? A . n A 1 52 ASN 52 52 ? ? ? A . n A 1 53 ARG 53 53 ? ? ? A . n A 1 54 VAL 54 54 ? ? ? A . n A 1 55 HIS 55 55 ? ? ? A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 MSE 76 76 76 MSE MSE A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 MSE 91 91 91 MSE MSE A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 MSE 98 98 98 MSE MSE A . n A 1 99 MSE 99 99 99 MSE MSE A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 PHE 105 105 105 PHE PHE A . n A 1 106 SER 106 106 106 SER SER A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 THR 117 117 117 THR THR A . n A 1 118 ILE 118 118 118 ILE ILE A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 PRO 121 121 121 PRO PRO A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 PRO 123 123 123 PRO PRO A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 GLY 134 134 134 GLY GLY A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 MSE 140 140 140 MSE MSE A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 ASP 144 144 144 ASP ASP A . n A 1 145 TYR 145 145 145 TYR TYR A . n A 1 146 PHE 146 146 ? ? ? A . n A 1 147 THR 147 147 ? ? ? A . n A 1 148 PRO 148 148 ? ? ? A . n A 1 149 HIS 149 149 ? ? ? A . n A 1 150 GLU 150 150 ? ? ? A . n A 1 151 HIS 151 151 ? ? ? A . n A 1 152 GLU 152 152 ? ? ? A . n A 1 153 ARG 153 153 ? ? ? A . n A 1 154 THR 154 154 ? ? ? A . n A 1 155 GLY 155 155 ? ? ? A . n A 1 156 HIS 156 156 ? ? ? A . n A 1 157 GLN 157 157 ? ? ? A . n A 1 158 GLY 158 158 ? ? ? A . n A 1 159 PRO 159 159 ? ? ? A . n A 1 160 GLU 160 160 ? ? ? A . n A 1 161 ALA 161 161 ? ? ? A . n A 1 162 ALA 162 162 ? ? ? A . n A 1 163 ARG 163 163 ? ? ? A . n A 1 164 VAL 164 164 164 VAL VAL A . n A 1 165 ASN 165 165 165 ASN ASN A . n A 1 166 ARG 166 166 166 ARG ARG A . n A 1 167 VAL 167 167 167 VAL VAL A . n A 1 168 TRP 168 168 168 TRP TRP A . n A 1 169 LEU 169 169 169 LEU LEU A . n A 1 170 PHE 170 170 170 PHE PHE A . n A 1 171 VAL 171 171 171 VAL VAL A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 THR 173 173 173 THR THR A . n A 1 174 ILE 174 174 174 ILE ILE A . n A 1 175 ILE 175 175 175 ILE ILE A . n A 1 176 LEU 176 176 176 LEU LEU A . n A 1 177 HIS 177 177 177 HIS HIS A . n A 1 178 ASN 178 178 178 ASN ASN A . n A 1 179 LEU 179 179 179 LEU LEU A . n A 1 180 PRO 180 180 180 PRO PRO A . n A 1 181 GLU 181 181 181 GLU GLU A . n A 1 182 GLY 182 182 182 GLY GLY A . n A 1 183 MSE 183 183 183 MSE MSE A . n A 1 184 ALA 184 184 184 ALA ALA A . n A 1 185 ILE 185 185 185 ILE ILE A . n A 1 186 GLY 186 186 186 GLY GLY A . n A 1 187 VAL 187 187 187 VAL VAL A . n A 1 188 SER 188 188 188 SER SER A . n A 1 189 PHE 189 189 189 PHE PHE A . n A 1 190 ALA 190 190 190 ALA ALA A . n A 1 191 THR 191 191 191 THR THR A . n A 1 192 GLY 192 192 192 GLY GLY A . n A 1 193 ASP 193 193 193 ASP ASP A . n A 1 194 LEU 194 194 194 LEU LEU A . n A 1 195 ARG 195 195 195 ARG ARG A . n A 1 196 ILE 196 196 196 ILE ILE A . n A 1 197 GLY 197 197 197 GLY GLY A . n A 1 198 LEU 198 198 198 LEU LEU A . n A 1 199 PRO 199 199 199 PRO PRO A . n A 1 200 LEU 200 200 200 LEU LEU A . n A 1 201 THR 201 201 201 THR THR A . n A 1 202 SER 202 202 202 SER SER A . n A 1 203 ALA 203 203 203 ALA ALA A . n A 1 204 ILE 204 204 204 ILE ILE A . n A 1 205 ALA 205 205 205 ALA ALA A . n A 1 206 ILE 206 206 206 ILE ILE A . n A 1 207 GLN 207 207 207 GLN GLN A . n A 1 208 ASP 208 208 208 ASP ASP A . n A 1 209 VAL 209 209 209 VAL VAL A . n A 1 210 PRO 210 210 210 PRO PRO A . n A 1 211 GLU 211 211 211 GLU GLU A . n A 1 212 GLY 212 212 212 GLY GLY A . n A 1 213 LEU 213 213 213 LEU LEU A . n A 1 214 ALA 214 214 214 ALA ALA A . n A 1 215 VAL 215 215 215 VAL VAL A . n A 1 216 ALA 216 216 216 ALA ALA A . n A 1 217 LEU 217 217 217 LEU LEU A . n A 1 218 ALA 218 218 218 ALA ALA A . n A 1 219 LEU 219 219 219 LEU LEU A . n A 1 220 ARG 220 220 220 ARG ARG A . n A 1 221 ALA 221 221 221 ALA ALA A . n A 1 222 VAL 222 222 222 VAL VAL A . n A 1 223 GLY 223 223 223 GLY GLY A . n A 1 224 LEU 224 224 224 LEU LEU A . n A 1 225 PRO 225 225 225 PRO PRO A . n A 1 226 ILE 226 226 226 ILE ILE A . n A 1 227 GLY 227 227 227 GLY GLY A . n A 1 228 ARG 228 228 228 ARG ARG A . n A 1 229 ALA 229 229 229 ALA ALA A . n A 1 230 VAL 230 230 230 VAL VAL A . n A 1 231 LEU 231 231 231 LEU LEU A . n A 1 232 VAL 232 232 232 VAL VAL A . n A 1 233 ALA 233 233 233 ALA ALA A . n A 1 234 VAL 234 234 234 VAL VAL A . n A 1 235 ALA 235 235 235 ALA ALA A . n A 1 236 SER 236 236 236 SER SER A . n A 1 237 GLY 237 237 237 GLY GLY A . n A 1 238 LEU 238 238 238 LEU LEU A . n A 1 239 MSE 239 239 239 MSE MSE A . n A 1 240 GLU 240 240 240 GLU GLU A . n A 1 241 PRO 241 241 241 PRO PRO A . n A 1 242 LEU 242 242 242 LEU LEU A . n A 1 243 GLY 243 243 243 GLY GLY A . n A 1 244 ALA 244 244 244 ALA ALA A . n A 1 245 LEU 245 245 245 LEU LEU A . n A 1 246 VAL 246 246 246 VAL VAL A . n A 1 247 GLY 247 247 247 GLY GLY A . n A 1 248 VAL 248 248 248 VAL VAL A . n A 1 249 GLY 249 249 249 GLY GLY A . n A 1 250 ILE 250 250 250 ILE ILE A . n A 1 251 SER 251 251 251 SER SER A . n A 1 252 SER 252 252 252 SER SER A . n A 1 253 GLY 253 253 253 GLY GLY A . n A 1 254 PHE 254 254 254 PHE PHE A . n A 1 255 ALA 255 255 255 ALA ALA A . n A 1 256 LEU 256 256 256 LEU LEU A . n A 1 257 ALA 257 257 257 ALA ALA A . n A 1 258 TYR 258 258 258 TYR TYR A . n A 1 259 PRO 259 259 259 PRO PRO A . n A 1 260 ILE 260 260 260 ILE ILE A . n A 1 261 SER 261 261 261 SER SER A . n A 1 262 MSE 262 262 262 MSE MSE A . n A 1 263 GLY 263 263 263 GLY GLY A . n A 1 264 LEU 264 264 264 LEU LEU A . n A 1 265 ALA 265 265 265 ALA ALA A . n A 1 266 ALA 266 266 266 ALA ALA A . n A 1 267 GLY 267 267 267 GLY GLY A . n A 1 268 ALA 268 268 268 ALA ALA A . n A 1 269 MSE 269 269 269 MSE MSE A . n A 1 270 ILE 270 270 270 ILE ILE A . n A 1 271 PHE 271 271 271 PHE PHE A . n A 1 272 VAL 272 272 272 VAL VAL A . n A 1 273 VAL 273 273 273 VAL VAL A . n A 1 274 SER 274 274 274 SER SER A . n A 1 275 HIS 275 275 275 HIS HIS A . n A 1 276 GLU 276 276 276 GLU GLU A . n A 1 277 VAL 277 277 277 VAL VAL A . n A 1 278 ILE 278 278 ? ? ? A . n A 1 279 PRO 279 279 ? ? ? A . n A 1 280 GLU 280 280 ? ? ? A . n A 1 281 THR 281 281 ? ? ? A . n A 1 282 HIS 282 282 ? ? ? A . n A 1 283 ARG 283 283 ? ? ? A . n A 1 284 ASN 284 284 ? ? ? A . n A 1 285 GLY 285 285 ? ? ? A . n A 1 286 HIS 286 286 ? ? ? A . n A 1 287 GLU 287 287 ? ? ? A . n A 1 288 THR 288 288 ? ? ? A . n A 1 289 THR 289 289 289 THR THR A . n A 1 290 ALA 290 290 290 ALA ALA A . n A 1 291 THR 291 291 291 THR THR A . n A 1 292 VAL 292 292 292 VAL VAL A . n A 1 293 GLY 293 293 293 GLY GLY A . n A 1 294 LEU 294 294 294 LEU LEU A . n A 1 295 MSE 295 295 295 MSE MSE A . n A 1 296 ALA 296 296 296 ALA ALA A . n A 1 297 GLY 297 297 297 GLY GLY A . n A 1 298 PHE 298 298 298 PHE PHE A . n A 1 299 ALA 299 299 299 ALA ALA A . n A 1 300 LEU 300 300 300 LEU LEU A . n A 1 301 MSE 301 301 301 MSE MSE A . n A 1 302 MSE 302 302 302 MSE MSE A . n A 1 303 PHE 303 303 303 PHE PHE A . n A 1 304 LEU 304 304 304 LEU LEU A . n A 1 305 ASP 305 305 305 ASP ASP A . n A 1 306 THR 306 306 306 THR THR A . n A 1 307 ALA 307 307 307 ALA ALA A . n A 1 308 LEU 308 308 308 LEU LEU A . n A 1 309 GLY 309 309 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CD 1 401 1 CD CD A . C 2 CD 1 402 2 CD CD A . D 2 CD 1 403 3 CD CD A . E 2 CD 1 404 4 CD CD A . F 3 HOH 1 501 5 HOH HOH A . F 3 HOH 2 502 6 HOH HOH A . F 3 HOH 3 503 4 HOH HOH A . F 3 HOH 4 504 2 HOH HOH A . F 3 HOH 5 505 1 HOH HOH A . F 3 HOH 6 506 3 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A TYR 58 ? CG ? A TYR 58 CG 2 1 Y 1 A TYR 58 ? CD1 ? A TYR 58 CD1 3 1 Y 1 A TYR 58 ? CD2 ? A TYR 58 CD2 4 1 Y 1 A TYR 58 ? CE1 ? A TYR 58 CE1 5 1 Y 1 A TYR 58 ? CE2 ? A TYR 58 CE2 6 1 Y 1 A TYR 58 ? CZ ? A TYR 58 CZ 7 1 Y 1 A TYR 58 ? OH ? A TYR 58 OH 8 1 Y 1 A ARG 86 ? CG ? A ARG 86 CG 9 1 Y 1 A ARG 86 ? CD ? A ARG 86 CD 10 1 Y 1 A ARG 86 ? NE ? A ARG 86 NE 11 1 Y 1 A ARG 86 ? CZ ? A ARG 86 CZ 12 1 Y 1 A ARG 86 ? NH1 ? A ARG 86 NH1 13 1 Y 1 A ARG 86 ? NH2 ? A ARG 86 NH2 14 1 Y 1 A GLN 88 ? CG ? A GLN 88 CG 15 1 Y 1 A GLN 88 ? CD ? A GLN 88 CD 16 1 Y 1 A GLN 88 ? OE1 ? A GLN 88 OE1 17 1 Y 1 A GLN 88 ? NE2 ? A GLN 88 NE2 18 1 Y 1 A TYR 145 ? CG ? A TYR 145 CG 19 1 Y 1 A TYR 145 ? CD1 ? A TYR 145 CD1 20 1 Y 1 A TYR 145 ? CD2 ? A TYR 145 CD2 21 1 Y 1 A TYR 145 ? CE1 ? A TYR 145 CE1 22 1 Y 1 A TYR 145 ? CE2 ? A TYR 145 CE2 23 1 Y 1 A TYR 145 ? CZ ? A TYR 145 CZ 24 1 Y 1 A TYR 145 ? OH ? A TYR 145 OH 25 1 Y 1 A VAL 164 ? CG1 ? A VAL 164 CG1 26 1 Y 1 A VAL 164 ? CG2 ? A VAL 164 CG2 27 1 Y 1 A ASN 165 ? CG ? A ASN 165 CG 28 1 Y 1 A ASN 165 ? OD1 ? A ASN 165 OD1 29 1 Y 1 A ASN 165 ? ND2 ? A ASN 165 ND2 30 1 Y 1 A THR 191 ? OG1 ? A THR 191 OG1 31 1 Y 1 A THR 191 ? CG2 ? A THR 191 CG2 32 1 Y 1 A ASP 193 ? CG ? A ASP 193 CG 33 1 Y 1 A ASP 193 ? OD1 ? A ASP 193 OD1 34 1 Y 1 A ASP 193 ? OD2 ? A ASP 193 OD2 35 1 Y 1 A ARG 195 ? CG ? A ARG 195 CG 36 1 Y 1 A ARG 195 ? CD ? A ARG 195 CD 37 1 Y 1 A ARG 195 ? NE ? A ARG 195 NE 38 1 Y 1 A ARG 195 ? CZ ? A ARG 195 CZ 39 1 Y 1 A ARG 195 ? NH1 ? A ARG 195 NH1 40 1 Y 1 A ARG 195 ? NH2 ? A ARG 195 NH2 41 1 Y 1 A GLU 276 ? CG ? A GLU 276 CG 42 1 Y 1 A GLU 276 ? CD ? A GLU 276 CD 43 1 Y 1 A GLU 276 ? OE1 ? A GLU 276 OE1 44 1 Y 1 A GLU 276 ? OE2 ? A GLU 276 OE2 45 1 Y 1 A VAL 277 ? CG1 ? A VAL 277 CG1 46 1 Y 1 A VAL 277 ? CG2 ? A VAL 277 CG2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? SOLVE ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 108.740 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5TSB _cell.details ? _cell.formula_units_Z ? _cell.length_a 96.076 _cell.length_a_esd ? _cell.length_b 61.596 _cell.length_b_esd ? _cell.length_c 54.870 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5TSB _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5TSB _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.48 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.39 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity 0.529 _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'LIPIDIC CUBIC PHASE' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 294 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;protein concentration: 15 mg/mL; buffer: 10 mM Hepes pH 7.3, 300 mM NaCl, 5% Glycerol, 0.02% DDM; crystallization condition: 0.1 M Sodium chloride, 0.1 M Cadmium chloride hemi, 0.1 M Tris-HCl pH 7.5, 33% PEG 400 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 193 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-10-08 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97918 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-D' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97918 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-D _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 53.740 _reflns.entry_id 5TSB _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.700 _reflns.d_resolution_low 26.494 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7889 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 93.200 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.100 _reflns.pdbx_Rmerge_I_obs 0.162 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI 17.400 _reflns.pdbx_netI_over_sigmaI 4.600 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.132 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.169 _reflns.pdbx_Rpim_I_all 0.048 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 79447 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.700 2.800 ? ? ? ? ? ? ? 83.300 ? ? ? ? 0.482 ? ? ? ? ? ? ? ? 4.200 ? ? ? ? ? ? ? 1 1 0.896 ? 2.800 2.910 ? ? ? ? ? ? ? 91.100 ? ? ? ? 0.452 ? ? ? ? ? ? ? ? 5.500 ? ? ? ? ? ? ? 2 1 0.904 ? 2.910 3.040 ? ? ? ? ? ? ? 96.500 ? ? ? ? 0.432 ? ? ? ? ? ? ? ? 6.900 ? ? ? ? ? ? ? 3 1 0.953 ? 3.040 3.200 ? ? ? ? ? ? ? 96.800 ? ? ? ? 0.409 ? ? ? ? ? ? ? ? 9.000 ? ? ? ? ? ? ? 4 1 0.961 ? 3.200 3.400 ? ? ? ? ? ? ? 96.200 ? ? ? ? 0.354 ? ? ? ? ? ? ? ? 10.800 ? ? ? ? ? ? ? 5 1 0.976 ? 3.400 3.660 ? ? ? ? ? ? ? 85.900 ? ? ? ? 0.268 ? ? ? ? ? ? ? ? 11.300 ? ? ? ? ? ? ? 6 1 0.985 ? 3.660 4.030 ? ? ? ? ? ? ? 96.800 ? ? ? ? 0.194 ? ? ? ? ? ? ? ? 12.900 ? ? ? ? ? ? ? 7 1 0.994 ? 4.030 4.620 ? ? ? ? ? ? ? 98.000 ? ? ? ? 0.146 ? ? ? ? ? ? ? ? 12.700 ? ? ? ? ? ? ? 8 1 0.994 ? 4.620 5.810 ? ? ? ? ? ? ? 95.500 ? ? ? ? 0.131 ? ? ? ? ? ? ? ? 13.500 ? ? ? ? ? ? ? 9 1 0.996 ? 5.810 50.000 ? ? ? ? ? ? ? 91.900 ? ? ? ? 0.100 ? ? ? ? ? ? ? ? 12.700 ? ? ? ? ? ? ? 10 1 0.998 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 138.170 _refine.B_iso_mean 48.1683 _refine.B_iso_min 16.940 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5TSB _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.700 _refine.ls_d_res_low 26.4940 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7857 _refine.ls_number_reflns_R_free 395 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 91.0700 _refine.ls_percent_reflns_R_free 5.0300 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2286 _refine.ls_R_factor_R_free 0.2675 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2265 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.980 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 28.2000 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3300 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.700 _refine_hist.d_res_low 26.4940 _refine_hist.pdbx_number_atoms_ligand 3 _refine_hist.number_atoms_solvent 6 _refine_hist.number_atoms_total 1508 _refine_hist.pdbx_number_residues_total 225 _refine_hist.pdbx_B_iso_mean_ligand 81.72 _refine_hist.pdbx_B_iso_mean_solvent 38.69 _refine_hist.pdbx_number_atoms_protein 1499 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.011 ? 1539 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.209 ? 2070 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.064 ? 271 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 257 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 13.864 ? 495 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.6958 2.9037 2646 . 136 2510 81.0000 . . . 0.2979 . 0.2580 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 2.9037 3.1955 3137 . 148 2989 95.0000 . . . 0.2308 . 0.2267 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 3.1955 3.6568 2971 . 162 2809 91.0000 . . . 0.2781 . 0.2152 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 3.6568 4.6033 3179 . 157 3022 97.0000 . . . 0.2643 . 0.2077 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 4.6033 26.4950 3011 . 148 2863 91.0000 . . . 0.2688 . 0.2420 . . . . . . 5 . . . # _struct.entry_id 5TSB _struct.title 'Crystal structure of the Zrt-/Irt-like protein from Bordetella bronchiseptica with bound Cd2+' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5TSB _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text 'ZIP, transporter, zinc, cadmium, lipidic cubic phase, binuclear metal center, membrane protein, METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A0H3LM39_BORBR _struct_ref.pdbx_db_accession A0A0H3LM39 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNQPSSLAADLRGAWHAQAQSHPLITLGLAASAAGVVLLLVAGIVNALTGENRVHVGYAVLGGAAGFAATALGALMALGL RAISARTQDAMLGFAAGMMLAASAFSLILPGLDAAGTIVGPGPAAAAVVALGLGLGVLLMLGLDYFTPHEHERTGHQGPE AARVNRVWLFVLTIILHNLPEGMAIGVSFATGDLRIGLPLTSAIAIQDVPEGLAVALALRAVGLPIGRAVLVAVASGLME PLGALVGVGISSGFALAYPISMGLAAGAMIFVVSHEVIPETHRNGHETTATVGLMAGFALMMFLDTALG ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5TSB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 309 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A0H3LM39 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 309 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 309 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1940 ? 1 MORE -60 ? 1 'SSA (A^2)' 18890 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_655 -x+1,y,-z -1.0000000000 0.0000000000 0.0000000000 96.0760000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 VAL A 56 ? ARG A 81 ? VAL A 56 ARG A 81 1 ? 26 HELX_P HELX_P2 AA2 SER A 84 ? SER A 106 ? SER A 84 SER A 106 1 ? 23 HELX_P HELX_P3 AA3 LEU A 107 ? GLY A 120 ? LEU A 107 GLY A 120 1 ? 14 HELX_P HELX_P4 AA4 GLY A 122 ? ASP A 144 ? GLY A 122 ASP A 144 1 ? 23 HELX_P HELX_P5 AA5 ARG A 166 ? ALA A 190 ? ARG A 166 ALA A 190 1 ? 25 HELX_P HELX_P6 AA6 ASP A 193 ? VAL A 222 ? ASP A 193 VAL A 222 1 ? 30 HELX_P HELX_P7 AA7 PRO A 225 ? LEU A 238 ? PRO A 225 LEU A 238 1 ? 14 HELX_P HELX_P8 AA8 LEU A 238 ? SER A 251 ? LEU A 238 SER A 251 1 ? 14 HELX_P HELX_P9 AA9 LEU A 256 ? VAL A 277 ? LEU A 256 VAL A 277 1 ? 22 HELX_P HELX_P10 AB1 ALA A 290 ? LEU A 308 ? ALA A 290 LEU A 308 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A LEU 75 C ? ? ? 1_555 A MSE 76 N ? ? A LEU 75 A MSE 76 1_555 ? ? ? ? ? ? ? 1.323 ? ? covale2 covale both ? A MSE 76 C ? ? ? 1_555 A ALA 77 N ? ? A MSE 76 A ALA 77 1_555 ? ? ? ? ? ? ? 1.341 ? ? covale3 covale both ? A ALA 90 C ? ? ? 1_555 A MSE 91 N ? ? A ALA 90 A MSE 91 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale4 covale both ? A MSE 91 C ? ? ? 1_555 A LEU 92 N ? ? A MSE 91 A LEU 92 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale5 covale both ? A GLY 97 C ? ? ? 1_555 A MSE 98 N ? ? A GLY 97 A MSE 98 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale6 covale both ? A MSE 98 C ? ? ? 1_555 A MSE 99 N ? ? A MSE 98 A MSE 99 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale7 covale both ? A MSE 99 C ? ? ? 1_555 A LEU 100 N ? ? A MSE 99 A LEU 100 1_555 ? ? ? ? ? ? ? 1.340 ? ? covale8 covale both ? A LEU 139 C ? ? ? 1_555 A MSE 140 N ? ? A LEU 139 A MSE 140 1_555 ? ? ? ? ? ? ? 1.317 ? ? covale9 covale both ? A MSE 140 C ? ? ? 1_555 A LEU 141 N ? ? A MSE 140 A LEU 141 1_555 ? ? ? ? ? ? ? 1.320 ? ? covale10 covale both ? A GLY 182 C ? ? ? 1_555 A MSE 183 N ? ? A GLY 182 A MSE 183 1_555 ? ? ? ? ? ? ? 1.374 ? ? covale11 covale both ? A MSE 183 C ? ? ? 1_555 A ALA 184 N ? ? A MSE 183 A ALA 184 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale12 covale both ? A LEU 238 C ? ? ? 1_555 A MSE 239 N ? ? A LEU 238 A MSE 239 1_555 ? ? ? ? ? ? ? 1.339 ? ? covale13 covale both ? A MSE 239 C ? ? ? 1_555 A GLU 240 N ? ? A MSE 239 A GLU 240 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale14 covale both ? A SER 261 C ? ? ? 1_555 A MSE 262 N ? ? A SER 261 A MSE 262 1_555 ? ? ? ? ? ? ? 1.318 ? ? covale15 covale both ? A MSE 262 C ? ? ? 1_555 A GLY 263 N ? ? A MSE 262 A GLY 263 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale16 covale both ? A ALA 268 C ? ? ? 1_555 A MSE 269 N ? ? A ALA 268 A MSE 269 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale17 covale both ? A MSE 269 C ? ? ? 1_555 A ILE 270 N ? ? A MSE 269 A ILE 270 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale18 covale both ? A LEU 294 C ? ? ? 1_555 A MSE 295 N ? ? A LEU 294 A MSE 295 1_555 ? ? ? ? ? ? ? 1.312 ? ? covale19 covale both ? A MSE 295 C ? ? ? 1_555 A ALA 296 N ? ? A MSE 295 A ALA 296 1_555 ? ? ? ? ? ? ? 1.308 ? ? covale20 covale both ? A LEU 300 C ? ? ? 1_555 A MSE 301 N ? ? A LEU 300 A MSE 301 1_555 ? ? ? ? ? ? ? 1.310 ? ? covale21 covale both ? A MSE 301 C ? ? ? 1_555 A MSE 302 N ? ? A MSE 301 A MSE 302 1_555 ? ? ? ? ? ? ? 1.313 ? ? covale22 covale both ? A MSE 302 C ? ? ? 1_555 A PHE 303 N ? ? A MSE 302 A PHE 303 1_555 ? ? ? ? ? ? ? 1.311 ? ? metalc1 metalc ? ? A HIS 177 NE2 ? ? ? 1_555 C CD . CD ? ? A HIS 177 A CD 402 1_555 ? ? ? ? ? ? ? 2.599 ? ? metalc2 metalc ? ? A ASN 178 OD1 ? ? ? 1_555 B CD . CD ? ? A ASN 178 A CD 401 1_555 ? ? ? ? ? ? ? 2.682 ? ? metalc3 metalc ? ? A GLU 181 OE2 ? ? ? 1_555 C CD . CD ? ? A GLU 181 A CD 402 1_555 ? ? ? ? ? ? ? 2.590 ? ? metalc4 metalc ? ? A GLN 207 OE1 ? ? ? 1_555 C CD . CD ? ? A GLN 207 A CD 402 1_555 ? ? ? ? ? ? ? 2.675 ? ? metalc5 metalc ? ? A GLU 211 OE1 ? ? ? 1_555 C CD . CD ? ? A GLU 211 A CD 402 1_555 ? ? ? ? ? ? ? 2.644 ? ? metalc6 metalc ? ? A GLU 211 OE2 ? ? ? 1_555 C CD . CD ? ? A GLU 211 A CD 402 1_555 ? ? ? ? ? ? ? 2.652 ? ? metalc7 metalc ? ? A GLU 240 OE2 ? ? ? 1_555 B CD . CD ? ? A GLU 240 A CD 401 1_555 ? ? ? ? ? ? ? 2.600 ? ? metalc8 metalc ? ? D CD . CD ? ? ? 1_555 F HOH . O ? ? A CD 403 A HOH 503 3_454 ? ? ? ? ? ? ? 2.687 ? ? metalc9 metalc ? ? D CD . CD ? ? ? 1_555 F HOH . O ? ? A CD 403 A HOH 506 4_555 ? ? ? ? ? ? ? 2.571 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 177 ? A HIS 177 ? 1_555 CD ? C CD . ? A CD 402 ? 1_555 OE2 ? A GLU 181 ? A GLU 181 ? 1_555 64.3 ? 2 NE2 ? A HIS 177 ? A HIS 177 ? 1_555 CD ? C CD . ? A CD 402 ? 1_555 OE1 ? A GLN 207 ? A GLN 207 ? 1_555 158.9 ? 3 OE2 ? A GLU 181 ? A GLU 181 ? 1_555 CD ? C CD . ? A CD 402 ? 1_555 OE1 ? A GLN 207 ? A GLN 207 ? 1_555 134.7 ? 4 NE2 ? A HIS 177 ? A HIS 177 ? 1_555 CD ? C CD . ? A CD 402 ? 1_555 OE1 ? A GLU 211 ? A GLU 211 ? 1_555 86.2 ? 5 OE2 ? A GLU 181 ? A GLU 181 ? 1_555 CD ? C CD . ? A CD 402 ? 1_555 OE1 ? A GLU 211 ? A GLU 211 ? 1_555 107.2 ? 6 OE1 ? A GLN 207 ? A GLN 207 ? 1_555 CD ? C CD . ? A CD 402 ? 1_555 OE1 ? A GLU 211 ? A GLU 211 ? 1_555 94.1 ? 7 NE2 ? A HIS 177 ? A HIS 177 ? 1_555 CD ? C CD . ? A CD 402 ? 1_555 OE2 ? A GLU 211 ? A GLU 211 ? 1_555 65.5 ? 8 OE2 ? A GLU 181 ? A GLU 181 ? 1_555 CD ? C CD . ? A CD 402 ? 1_555 OE2 ? A GLU 211 ? A GLU 211 ? 1_555 125.8 ? 9 OE1 ? A GLN 207 ? A GLN 207 ? 1_555 CD ? C CD . ? A CD 402 ? 1_555 OE2 ? A GLU 211 ? A GLU 211 ? 1_555 98.7 ? 10 OE1 ? A GLU 211 ? A GLU 211 ? 1_555 CD ? C CD . ? A CD 402 ? 1_555 OE2 ? A GLU 211 ? A GLU 211 ? 1_555 50.3 ? 11 OD1 ? A ASN 178 ? A ASN 178 ? 1_555 CD ? B CD . ? A CD 401 ? 1_555 OE2 ? A GLU 240 ? A GLU 240 ? 1_555 88.0 ? 12 O ? F HOH . ? A HOH 503 ? 3_454 CD ? D CD . ? A CD 403 ? 1_555 O ? F HOH . ? A HOH 506 ? 4_555 109.1 ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 76 ? . . . . MSE A 76 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 91 ? . . . . MSE A 91 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 3 MSE A 98 ? . . . . MSE A 98 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 4 MSE A 99 ? . . . . MSE A 99 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 5 MSE A 140 ? . . . . MSE A 140 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 6 MSE A 183 ? . . . . MSE A 183 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 7 MSE A 239 ? . . . . MSE A 239 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 8 MSE A 262 ? . . . . MSE A 262 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 9 MSE A 269 ? . . . . MSE A 269 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 10 MSE A 295 ? . . . . MSE A 295 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 11 MSE A 301 ? . . . . MSE A 301 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 12 MSE A 302 ? . . . . MSE A 302 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CD 401 ? 6 'binding site for residue CD A 401' AC2 Software A CD 402 ? 5 'binding site for residue CD A 402' AC3 Software A CD 403 ? 5 'binding site for residue CD A 403' AC4 Software A CD 404 ? 3 'binding site for residue CD A 404' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ASN A 178 ? ASN A 178 . ? 1_555 ? 2 AC1 6 GLU A 181 ? GLU A 181 . ? 1_555 ? 3 AC1 6 ASP A 208 ? ASP A 208 . ? 1_555 ? 4 AC1 6 GLU A 211 ? GLU A 211 . ? 1_555 ? 5 AC1 6 GLU A 240 ? GLU A 240 . ? 1_555 ? 6 AC1 6 HOH F . ? HOH A 501 . ? 1_555 ? 7 AC2 5 MSE A 99 ? MSE A 99 . ? 1_555 ? 8 AC2 5 HIS A 177 ? HIS A 177 . ? 1_555 ? 9 AC2 5 GLU A 181 ? GLU A 181 . ? 1_555 ? 10 AC2 5 GLN A 207 ? GLN A 207 . ? 1_555 ? 11 AC2 5 GLU A 211 ? GLU A 211 . ? 1_555 ? 12 AC3 5 LEU A 224 ? LEU A 224 . ? 4_555 ? 13 AC3 5 HOH F . ? HOH A 503 . ? 3_454 ? 14 AC3 5 HOH F . ? HOH A 504 . ? 1_555 ? 15 AC3 5 HOH F . ? HOH A 505 . ? 1_555 ? 16 AC3 5 HOH F . ? HOH A 506 . ? 4_555 ? 17 AC4 3 ASP A 144 ? ASP A 144 . ? 1_555 ? 18 AC4 3 HIS A 275 ? HIS A 275 . ? 1_555 ? 19 AC4 3 HOH F . ? HOH A 502 . ? 1_555 ? # _pdbx_entry_details.entry_id 5TSB _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 VAL _pdbx_validate_symm_contact.auth_seq_id_1 119 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 NH2 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 ARG _pdbx_validate_symm_contact.auth_seq_id_2 228 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 4_555 _pdbx_validate_symm_contact.dist 2.09 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 81 ? ? 69.81 -31.30 2 1 ASN A 165 ? ? 59.70 9.90 3 1 ASP A 193 ? ? -59.20 99.94 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 76 A MSE 76 ? MET 'modified residue' 2 A MSE 91 A MSE 91 ? MET 'modified residue' 3 A MSE 98 A MSE 98 ? MET 'modified residue' 4 A MSE 99 A MSE 99 ? MET 'modified residue' 5 A MSE 140 A MSE 140 ? MET 'modified residue' 6 A MSE 183 A MSE 183 ? MET 'modified residue' 7 A MSE 239 A MSE 239 ? MET 'modified residue' 8 A MSE 262 A MSE 262 ? MET 'modified residue' 9 A MSE 269 A MSE 269 ? MET 'modified residue' 10 A MSE 295 A MSE 295 ? MET 'modified residue' 11 A MSE 301 A MSE 301 ? MET 'modified residue' 12 A MSE 302 A MSE 302 ? MET 'modified residue' # _phasing.method SAD # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A ASN 2 ? A ASN 2 3 1 Y 1 A GLN 3 ? A GLN 3 4 1 Y 1 A PRO 4 ? A PRO 4 5 1 Y 1 A SER 5 ? A SER 5 6 1 Y 1 A SER 6 ? A SER 6 7 1 Y 1 A LEU 7 ? A LEU 7 8 1 Y 1 A ALA 8 ? A ALA 8 9 1 Y 1 A ALA 9 ? A ALA 9 10 1 Y 1 A ASP 10 ? A ASP 10 11 1 Y 1 A LEU 11 ? A LEU 11 12 1 Y 1 A ARG 12 ? A ARG 12 13 1 Y 1 A GLY 13 ? A GLY 13 14 1 Y 1 A ALA 14 ? A ALA 14 15 1 Y 1 A TRP 15 ? A TRP 15 16 1 Y 1 A HIS 16 ? A HIS 16 17 1 Y 1 A ALA 17 ? A ALA 17 18 1 Y 1 A GLN 18 ? A GLN 18 19 1 Y 1 A ALA 19 ? A ALA 19 20 1 Y 1 A GLN 20 ? A GLN 20 21 1 Y 1 A SER 21 ? A SER 21 22 1 Y 1 A HIS 22 ? A HIS 22 23 1 Y 1 A PRO 23 ? A PRO 23 24 1 Y 1 A LEU 24 ? A LEU 24 25 1 Y 1 A ILE 25 ? A ILE 25 26 1 Y 1 A THR 26 ? A THR 26 27 1 Y 1 A LEU 27 ? A LEU 27 28 1 Y 1 A GLY 28 ? A GLY 28 29 1 Y 1 A LEU 29 ? A LEU 29 30 1 Y 1 A ALA 30 ? A ALA 30 31 1 Y 1 A ALA 31 ? A ALA 31 32 1 Y 1 A SER 32 ? A SER 32 33 1 Y 1 A ALA 33 ? A ALA 33 34 1 Y 1 A ALA 34 ? A ALA 34 35 1 Y 1 A GLY 35 ? A GLY 35 36 1 Y 1 A VAL 36 ? A VAL 36 37 1 Y 1 A VAL 37 ? A VAL 37 38 1 Y 1 A LEU 38 ? A LEU 38 39 1 Y 1 A LEU 39 ? A LEU 39 40 1 Y 1 A LEU 40 ? A LEU 40 41 1 Y 1 A VAL 41 ? A VAL 41 42 1 Y 1 A ALA 42 ? A ALA 42 43 1 Y 1 A GLY 43 ? A GLY 43 44 1 Y 1 A ILE 44 ? A ILE 44 45 1 Y 1 A VAL 45 ? A VAL 45 46 1 Y 1 A ASN 46 ? A ASN 46 47 1 Y 1 A ALA 47 ? A ALA 47 48 1 Y 1 A LEU 48 ? A LEU 48 49 1 Y 1 A THR 49 ? A THR 49 50 1 Y 1 A GLY 50 ? A GLY 50 51 1 Y 1 A GLU 51 ? A GLU 51 52 1 Y 1 A ASN 52 ? A ASN 52 53 1 Y 1 A ARG 53 ? A ARG 53 54 1 Y 1 A VAL 54 ? A VAL 54 55 1 Y 1 A HIS 55 ? A HIS 55 56 1 Y 1 A PHE 146 ? A PHE 146 57 1 Y 1 A THR 147 ? A THR 147 58 1 Y 1 A PRO 148 ? A PRO 148 59 1 Y 1 A HIS 149 ? A HIS 149 60 1 Y 1 A GLU 150 ? A GLU 150 61 1 Y 1 A HIS 151 ? A HIS 151 62 1 Y 1 A GLU 152 ? A GLU 152 63 1 Y 1 A ARG 153 ? A ARG 153 64 1 Y 1 A THR 154 ? A THR 154 65 1 Y 1 A GLY 155 ? A GLY 155 66 1 Y 1 A HIS 156 ? A HIS 156 67 1 Y 1 A GLN 157 ? A GLN 157 68 1 Y 1 A GLY 158 ? A GLY 158 69 1 Y 1 A PRO 159 ? A PRO 159 70 1 Y 1 A GLU 160 ? A GLU 160 71 1 Y 1 A ALA 161 ? A ALA 161 72 1 Y 1 A ALA 162 ? A ALA 162 73 1 Y 1 A ARG 163 ? A ARG 163 74 1 Y 1 A ILE 278 ? A ILE 278 75 1 Y 1 A PRO 279 ? A PRO 279 76 1 Y 1 A GLU 280 ? A GLU 280 77 1 Y 1 A THR 281 ? A THR 281 78 1 Y 1 A HIS 282 ? A HIS 282 79 1 Y 1 A ARG 283 ? A ARG 283 80 1 Y 1 A ASN 284 ? A ASN 284 81 1 Y 1 A GLY 285 ? A GLY 285 82 1 Y 1 A HIS 286 ? A HIS 286 83 1 Y 1 A GLU 287 ? A GLU 287 84 1 Y 1 A THR 288 ? A THR 288 85 1 Y 1 A GLY 309 ? A GLY 309 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CD CD CD N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 HIS N N N N 124 HIS CA C N S 125 HIS C C N N 126 HIS O O N N 127 HIS CB C N N 128 HIS CG C Y N 129 HIS ND1 N Y N 130 HIS CD2 C Y N 131 HIS CE1 C Y N 132 HIS NE2 N Y N 133 HIS OXT O N N 134 HIS H H N N 135 HIS H2 H N N 136 HIS HA H N N 137 HIS HB2 H N N 138 HIS HB3 H N N 139 HIS HD1 H N N 140 HIS HD2 H N N 141 HIS HE1 H N N 142 HIS HE2 H N N 143 HIS HXT H N N 144 HOH O O N N 145 HOH H1 H N N 146 HOH H2 H N N 147 ILE N N N N 148 ILE CA C N S 149 ILE C C N N 150 ILE O O N N 151 ILE CB C N S 152 ILE CG1 C N N 153 ILE CG2 C N N 154 ILE CD1 C N N 155 ILE OXT O N N 156 ILE H H N N 157 ILE H2 H N N 158 ILE HA H N N 159 ILE HB H N N 160 ILE HG12 H N N 161 ILE HG13 H N N 162 ILE HG21 H N N 163 ILE HG22 H N N 164 ILE HG23 H N N 165 ILE HD11 H N N 166 ILE HD12 H N N 167 ILE HD13 H N N 168 ILE HXT H N N 169 LEU N N N N 170 LEU CA C N S 171 LEU C C N N 172 LEU O O N N 173 LEU CB C N N 174 LEU CG C N N 175 LEU CD1 C N N 176 LEU CD2 C N N 177 LEU OXT O N N 178 LEU H H N N 179 LEU H2 H N N 180 LEU HA H N N 181 LEU HB2 H N N 182 LEU HB3 H N N 183 LEU HG H N N 184 LEU HD11 H N N 185 LEU HD12 H N N 186 LEU HD13 H N N 187 LEU HD21 H N N 188 LEU HD22 H N N 189 LEU HD23 H N N 190 LEU HXT H N N 191 MSE N N N N 192 MSE CA C N S 193 MSE C C N N 194 MSE O O N N 195 MSE OXT O N N 196 MSE CB C N N 197 MSE CG C N N 198 MSE SE SE N N 199 MSE CE C N N 200 MSE H H N N 201 MSE H2 H N N 202 MSE HA H N N 203 MSE HXT H N N 204 MSE HB2 H N N 205 MSE HB3 H N N 206 MSE HG2 H N N 207 MSE HG3 H N N 208 MSE HE1 H N N 209 MSE HE2 H N N 210 MSE HE3 H N N 211 PHE N N N N 212 PHE CA C N S 213 PHE C C N N 214 PHE O O N N 215 PHE CB C N N 216 PHE CG C Y N 217 PHE CD1 C Y N 218 PHE CD2 C Y N 219 PHE CE1 C Y N 220 PHE CE2 C Y N 221 PHE CZ C Y N 222 PHE OXT O N N 223 PHE H H N N 224 PHE H2 H N N 225 PHE HA H N N 226 PHE HB2 H N N 227 PHE HB3 H N N 228 PHE HD1 H N N 229 PHE HD2 H N N 230 PHE HE1 H N N 231 PHE HE2 H N N 232 PHE HZ H N N 233 PHE HXT H N N 234 PRO N N N N 235 PRO CA C N S 236 PRO C C N N 237 PRO O O N N 238 PRO CB C N N 239 PRO CG C N N 240 PRO CD C N N 241 PRO OXT O N N 242 PRO H H N N 243 PRO HA H N N 244 PRO HB2 H N N 245 PRO HB3 H N N 246 PRO HG2 H N N 247 PRO HG3 H N N 248 PRO HD2 H N N 249 PRO HD3 H N N 250 PRO HXT H N N 251 SER N N N N 252 SER CA C N S 253 SER C C N N 254 SER O O N N 255 SER CB C N N 256 SER OG O N N 257 SER OXT O N N 258 SER H H N N 259 SER H2 H N N 260 SER HA H N N 261 SER HB2 H N N 262 SER HB3 H N N 263 SER HG H N N 264 SER HXT H N N 265 THR N N N N 266 THR CA C N S 267 THR C C N N 268 THR O O N N 269 THR CB C N R 270 THR OG1 O N N 271 THR CG2 C N N 272 THR OXT O N N 273 THR H H N N 274 THR H2 H N N 275 THR HA H N N 276 THR HB H N N 277 THR HG1 H N N 278 THR HG21 H N N 279 THR HG22 H N N 280 THR HG23 H N N 281 THR HXT H N N 282 TRP N N N N 283 TRP CA C N S 284 TRP C C N N 285 TRP O O N N 286 TRP CB C N N 287 TRP CG C Y N 288 TRP CD1 C Y N 289 TRP CD2 C Y N 290 TRP NE1 N Y N 291 TRP CE2 C Y N 292 TRP CE3 C Y N 293 TRP CZ2 C Y N 294 TRP CZ3 C Y N 295 TRP CH2 C Y N 296 TRP OXT O N N 297 TRP H H N N 298 TRP H2 H N N 299 TRP HA H N N 300 TRP HB2 H N N 301 TRP HB3 H N N 302 TRP HD1 H N N 303 TRP HE1 H N N 304 TRP HE3 H N N 305 TRP HZ2 H N N 306 TRP HZ3 H N N 307 TRP HH2 H N N 308 TRP HXT H N N 309 TYR N N N N 310 TYR CA C N S 311 TYR C C N N 312 TYR O O N N 313 TYR CB C N N 314 TYR CG C Y N 315 TYR CD1 C Y N 316 TYR CD2 C Y N 317 TYR CE1 C Y N 318 TYR CE2 C Y N 319 TYR CZ C Y N 320 TYR OH O N N 321 TYR OXT O N N 322 TYR H H N N 323 TYR H2 H N N 324 TYR HA H N N 325 TYR HB2 H N N 326 TYR HB3 H N N 327 TYR HD1 H N N 328 TYR HD2 H N N 329 TYR HE1 H N N 330 TYR HE2 H N N 331 TYR HH H N N 332 TYR HXT H N N 333 VAL N N N N 334 VAL CA C N S 335 VAL C C N N 336 VAL O O N N 337 VAL CB C N N 338 VAL CG1 C N N 339 VAL CG2 C N N 340 VAL OXT O N N 341 VAL H H N N 342 VAL H2 H N N 343 VAL HA H N N 344 VAL HB H N N 345 VAL HG11 H N N 346 VAL HG12 H N N 347 VAL HG13 H N N 348 VAL HG21 H N N 349 VAL HG22 H N N 350 VAL HG23 H N N 351 VAL HXT H N N 352 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 MSE N CA sing N N 181 MSE N H sing N N 182 MSE N H2 sing N N 183 MSE CA C sing N N 184 MSE CA CB sing N N 185 MSE CA HA sing N N 186 MSE C O doub N N 187 MSE C OXT sing N N 188 MSE OXT HXT sing N N 189 MSE CB CG sing N N 190 MSE CB HB2 sing N N 191 MSE CB HB3 sing N N 192 MSE CG SE sing N N 193 MSE CG HG2 sing N N 194 MSE CG HG3 sing N N 195 MSE SE CE sing N N 196 MSE CE HE1 sing N N 197 MSE CE HE2 sing N N 198 MSE CE HE3 sing N N 199 PHE N CA sing N N 200 PHE N H sing N N 201 PHE N H2 sing N N 202 PHE CA C sing N N 203 PHE CA CB sing N N 204 PHE CA HA sing N N 205 PHE C O doub N N 206 PHE C OXT sing N N 207 PHE CB CG sing N N 208 PHE CB HB2 sing N N 209 PHE CB HB3 sing N N 210 PHE CG CD1 doub Y N 211 PHE CG CD2 sing Y N 212 PHE CD1 CE1 sing Y N 213 PHE CD1 HD1 sing N N 214 PHE CD2 CE2 doub Y N 215 PHE CD2 HD2 sing N N 216 PHE CE1 CZ doub Y N 217 PHE CE1 HE1 sing N N 218 PHE CE2 CZ sing Y N 219 PHE CE2 HE2 sing N N 220 PHE CZ HZ sing N N 221 PHE OXT HXT sing N N 222 PRO N CA sing N N 223 PRO N CD sing N N 224 PRO N H sing N N 225 PRO CA C sing N N 226 PRO CA CB sing N N 227 PRO CA HA sing N N 228 PRO C O doub N N 229 PRO C OXT sing N N 230 PRO CB CG sing N N 231 PRO CB HB2 sing N N 232 PRO CB HB3 sing N N 233 PRO CG CD sing N N 234 PRO CG HG2 sing N N 235 PRO CG HG3 sing N N 236 PRO CD HD2 sing N N 237 PRO CD HD3 sing N N 238 PRO OXT HXT sing N N 239 SER N CA sing N N 240 SER N H sing N N 241 SER N H2 sing N N 242 SER CA C sing N N 243 SER CA CB sing N N 244 SER CA HA sing N N 245 SER C O doub N N 246 SER C OXT sing N N 247 SER CB OG sing N N 248 SER CB HB2 sing N N 249 SER CB HB3 sing N N 250 SER OG HG sing N N 251 SER OXT HXT sing N N 252 THR N CA sing N N 253 THR N H sing N N 254 THR N H2 sing N N 255 THR CA C sing N N 256 THR CA CB sing N N 257 THR CA HA sing N N 258 THR C O doub N N 259 THR C OXT sing N N 260 THR CB OG1 sing N N 261 THR CB CG2 sing N N 262 THR CB HB sing N N 263 THR OG1 HG1 sing N N 264 THR CG2 HG21 sing N N 265 THR CG2 HG22 sing N N 266 THR CG2 HG23 sing N N 267 THR OXT HXT sing N N 268 TRP N CA sing N N 269 TRP N H sing N N 270 TRP N H2 sing N N 271 TRP CA C sing N N 272 TRP CA CB sing N N 273 TRP CA HA sing N N 274 TRP C O doub N N 275 TRP C OXT sing N N 276 TRP CB CG sing N N 277 TRP CB HB2 sing N N 278 TRP CB HB3 sing N N 279 TRP CG CD1 doub Y N 280 TRP CG CD2 sing Y N 281 TRP CD1 NE1 sing Y N 282 TRP CD1 HD1 sing N N 283 TRP CD2 CE2 doub Y N 284 TRP CD2 CE3 sing Y N 285 TRP NE1 CE2 sing Y N 286 TRP NE1 HE1 sing N N 287 TRP CE2 CZ2 sing Y N 288 TRP CE3 CZ3 doub Y N 289 TRP CE3 HE3 sing N N 290 TRP CZ2 CH2 doub Y N 291 TRP CZ2 HZ2 sing N N 292 TRP CZ3 CH2 sing Y N 293 TRP CZ3 HZ3 sing N N 294 TRP CH2 HH2 sing N N 295 TRP OXT HXT sing N N 296 TYR N CA sing N N 297 TYR N H sing N N 298 TYR N H2 sing N N 299 TYR CA C sing N N 300 TYR CA CB sing N N 301 TYR CA HA sing N N 302 TYR C O doub N N 303 TYR C OXT sing N N 304 TYR CB CG sing N N 305 TYR CB HB2 sing N N 306 TYR CB HB3 sing N N 307 TYR CG CD1 doub Y N 308 TYR CG CD2 sing Y N 309 TYR CD1 CE1 sing Y N 310 TYR CD1 HD1 sing N N 311 TYR CD2 CE2 doub Y N 312 TYR CD2 HD2 sing N N 313 TYR CE1 CZ doub Y N 314 TYR CE1 HE1 sing N N 315 TYR CE2 CZ sing Y N 316 TYR CE2 HE2 sing N N 317 TYR CZ OH sing N N 318 TYR OH HH sing N N 319 TYR OXT HXT sing N N 320 VAL N CA sing N N 321 VAL N H sing N N 322 VAL N H2 sing N N 323 VAL CA C sing N N 324 VAL CA CB sing N N 325 VAL CA HA sing N N 326 VAL C O doub N N 327 VAL C OXT sing N N 328 VAL CB CG1 sing N N 329 VAL CB CG2 sing N N 330 VAL CB HB sing N N 331 VAL CG1 HG11 sing N N 332 VAL CG1 HG12 sing N N 333 VAL CG1 HG13 sing N N 334 VAL CG2 HG21 sing N N 335 VAL CG2 HG22 sing N N 336 VAL CG2 HG23 sing N N 337 VAL OXT HXT sing N N 338 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number R01GM115373 _pdbx_audit_support.ordinal 1 # _atom_sites.entry_id 5TSB _atom_sites.fract_transf_matrix[1][1] 0.010408 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.003532 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016235 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019245 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CD N O SE # loop_ #