data_5TTT # _entry.id 5TTT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5TTT pdb_00005ttt 10.2210/pdb5ttt/pdb WWPDB D_1000224817 ? ? BMRB 30200 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type BMRB ;Sparse-restraint solution NMR structure of micelle-solubilized cytosolic amino terminal domain of C. elegans mechanosensory ion channel MEC-4 refined by restrained Rosetta ; 30200 unspecified TargetTrack . NESG-WR65 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5TTT _pdbx_database_status.recvd_initial_deposition_date 2016-11-04 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Everett, J.K.' 1 'Liu, G.' 2 'Mao, B.' 3 'Driscoll, M.A.' 4 'Montelione, G.T.' 5 'Northeast Structural Genomics Consortium (NESG)' 6 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Sparse-restraint solution NMR structure of micelle-solubilized cytosolic amino terminal domain of C. elegans mechanosensory ion channel MEC-4 refined by restrained Rosetta ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Everett, J.K.' 1 ? primary 'Liu, G.' 2 ? primary 'Mao, B.' 3 ? primary 'Driscoll, M.A.' 4 ? primary 'Montelione, G.T.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Degenerin mec-4' _entity.formula_weight 13296.793 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'residues 1-103' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Mechanosensory abnormality protein 4' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSWMQNLKNYQHLRDPSEYMSQVYGDPLAYLQETTKFVTEREYYEDFGYGECFNSTESEVQCELITGEFDPKLLPYDKRL AWHFKEFCYKTSAHGIPMIGEAPLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSWMQNLKNYQHLRDPSEYMSQVYGDPLAYLQETTKFVTEREYYEDFGYGECFNSTESEVQCELITGEFDPKLLPYDKRL AWHFKEFCYKTSAHGIPMIGEAPLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NESG-WR65 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 TRP n 1 4 MET n 1 5 GLN n 1 6 ASN n 1 7 LEU n 1 8 LYS n 1 9 ASN n 1 10 TYR n 1 11 GLN n 1 12 HIS n 1 13 LEU n 1 14 ARG n 1 15 ASP n 1 16 PRO n 1 17 SER n 1 18 GLU n 1 19 TYR n 1 20 MET n 1 21 SER n 1 22 GLN n 1 23 VAL n 1 24 TYR n 1 25 GLY n 1 26 ASP n 1 27 PRO n 1 28 LEU n 1 29 ALA n 1 30 TYR n 1 31 LEU n 1 32 GLN n 1 33 GLU n 1 34 THR n 1 35 THR n 1 36 LYS n 1 37 PHE n 1 38 VAL n 1 39 THR n 1 40 GLU n 1 41 ARG n 1 42 GLU n 1 43 TYR n 1 44 TYR n 1 45 GLU n 1 46 ASP n 1 47 PHE n 1 48 GLY n 1 49 TYR n 1 50 GLY n 1 51 GLU n 1 52 CYS n 1 53 PHE n 1 54 ASN n 1 55 SER n 1 56 THR n 1 57 GLU n 1 58 SER n 1 59 GLU n 1 60 VAL n 1 61 GLN n 1 62 CYS n 1 63 GLU n 1 64 LEU n 1 65 ILE n 1 66 THR n 1 67 GLY n 1 68 GLU n 1 69 PHE n 1 70 ASP n 1 71 PRO n 1 72 LYS n 1 73 LEU n 1 74 LEU n 1 75 PRO n 1 76 TYR n 1 77 ASP n 1 78 LYS n 1 79 ARG n 1 80 LEU n 1 81 ALA n 1 82 TRP n 1 83 HIS n 1 84 PHE n 1 85 LYS n 1 86 GLU n 1 87 PHE n 1 88 CYS n 1 89 TYR n 1 90 LYS n 1 91 THR n 1 92 SER n 1 93 ALA n 1 94 HIS n 1 95 GLY n 1 96 ILE n 1 97 PRO n 1 98 MET n 1 99 ILE n 1 100 GLY n 1 101 GLU n 1 102 ALA n 1 103 PRO n 1 104 LEU n 1 105 GLU n 1 106 HIS n 1 107 HIS n 1 108 HIS n 1 109 HIS n 1 110 HIS n 1 111 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 111 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'mec-4, mec-13, T01C8.7' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Caenorhabditis elegans' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6239 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MEC4_CAEEL _struct_ref.pdbx_db_accession P24612 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSWMQNLKNYQHLRDPSEYMSQVYGDPLAYLQETTKFVTEREYYEDFGYGECFNSTESEVQCELITGEFDPKLLPYDKRL AWHFKEFCYKTSAHGIPMIGEAP ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5TTT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 103 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P24612 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 103 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 103 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5TTT LEU A 104 ? UNP P24612 ? ? 'expression tag' 104 1 1 5TTT GLU A 105 ? UNP P24612 ? ? 'expression tag' 105 2 1 5TTT HIS A 106 ? UNP P24612 ? ? 'expression tag' 106 3 1 5TTT HIS A 107 ? UNP P24612 ? ? 'expression tag' 107 4 1 5TTT HIS A 108 ? UNP P24612 ? ? 'expression tag' 108 5 1 5TTT HIS A 109 ? UNP P24612 ? ? 'expression tag' 109 6 1 5TTT HIS A 110 ? UNP P24612 ? ? 'expression tag' 110 7 1 5TTT HIS A 111 ? UNP P24612 ? ? 'expression tag' 111 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '3D HNCO' 1 isotropic 3 1 1 '3D HNCA' 1 isotropic 4 1 1 '3D HNCACO' 1 isotropic 5 1 1 '3D HN(CO)CA' 1 isotropic 6 1 1 '2D 1H-1H NOESY' 1 isotropic 7 1 1 '3D 1H-15N NOESY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.025 _pdbx_nmr_exptl_sample_conditions.details ;1.5 MM [U-100% 13C; U-100% 15N; 100% 2H; ILV METHYL 1H; FY RING 1H] MEC4, 25 MM SODIUM; PHOSPHATE, 5 MM ZWITTERGENT 3-12, 25 MM SODIUM CHLORIDE, 5MM TCEP, 95% H2O/5% D2O ; _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units M _pdbx_nmr_exptl_sample_conditions.label condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;1.5 mM [U-13C; U-15N; U-2H] micelle-solubilized cytosolic amino terminal domain of C. elegans mechanosensory ion channel MEC-4, 95% H2O/5% D2O ; _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label CND _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ;1.5 MM [U-100% 13C; U-100% 15N; 100% 2H; ILV METHYL 1H; FY RING 1H] MEC4, 25 MM SODIUM; PHOSPHATE, 5 MM ZWITTERGENT 3-12, 25 MM SODIUM CHLORIDE, 5MM TCEP, 95% H2O/5% D2O ; # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 5TTT _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 5TTT _pdbx_nmr_ensemble.conformers_calculated_total_number 250 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5TTT _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement 'Restrained Rosetta' ? 'Mao, Baker, Montelione' 2 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' AutoAssign 2.4.0 'Zimmerman, Moseley, Kulikowski and Montelione' 4 'peak picking' Sparky ? Goddard 5 'structure solution' CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 6 'structure solution' TALOS ? 'Cornilescu, Delaglio and Bax' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5TTT _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5TTT _struct.title ;Sparse-restraint solution NMR structure of micelle-solubilized cytosolic amino terminal domain of C. elegans mechanosensory ion channel MEC-4 refined by restrained Rosetta ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5TTT _struct_keywords.text 'Structural Genomics, PSI-Biology, Northeast Structural Genomics Consortium, NESG, TRANSPORT PROTEIN' _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details 'Monomer as determined by light scatering' # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 2 ? ASN A 9 ? SER A 2 ASN A 9 1 ? 8 HELX_P HELX_P2 AA2 PRO A 16 ? VAL A 23 ? PRO A 16 VAL A 23 1 ? 8 HELX_P HELX_P3 AA3 ASP A 26 ? LYS A 36 ? ASP A 26 LYS A 36 1 ? 11 HELX_P HELX_P4 AA4 GLU A 40 ? ASP A 46 ? GLU A 40 ASP A 46 1 ? 7 HELX_P HELX_P5 AA5 ASP A 77 ? TYR A 89 ? ASP A 77 TYR A 89 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 5TTT _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 TRP 3 3 3 TRP TRP A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 HIS 12 12 12 HIS HIS A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 MET 20 20 20 MET MET A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 CYS 52 52 52 CYS CYS A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 CYS 62 62 62 CYS CYS A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 TRP 82 82 82 TRP TRP A . n A 1 83 HIS 83 83 83 HIS HIS A . n A 1 84 PHE 84 84 84 PHE PHE A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 CYS 88 88 88 CYS CYS A . n A 1 89 TYR 89 89 89 TYR TYR A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 HIS 94 94 94 HIS HIS A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 PRO 97 97 97 PRO PRO A . n A 1 98 MET 98 98 98 MET MET A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 PRO 103 103 103 PRO PRO A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 HIS 106 106 106 HIS HIS A . n A 1 107 HIS 107 107 107 HIS HIS A . n A 1 108 HIS 108 108 108 HIS HIS A . n A 1 109 HIS 109 109 109 HIS HIS A . n A 1 110 HIS 110 110 110 HIS HIS A . n A 1 111 HIS 111 111 111 HIS HIS A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name PSI:Biology _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 6970 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-02-01 2 'Structure model' 1 1 2017-09-20 3 'Structure model' 1 2 2017-11-01 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 2 'Structure model' 'Structure summary' 3 3 'Structure model' 'Author supporting evidence' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' entity 2 2 'Structure model' pdbx_audit_support 3 3 'Structure model' pdbx_struct_assembly_auth_evidence 4 4 'Structure model' database_2 5 4 'Structure model' pdbx_database_status 6 4 'Structure model' pdbx_nmr_software 7 4 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_entity.pdbx_number_of_molecules' 2 2 'Structure model' '_pdbx_audit_support.funding_organization' 3 4 'Structure model' '_database_2.pdbx_DOI' 4 4 'Structure model' '_database_2.pdbx_database_accession' 5 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 6 4 'Structure model' '_pdbx_nmr_software.name' 7 4 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component 'micelle-solubilized cytosolic amino terminal domain of C. elegans mechanosensory ion channel MEC-4' _pdbx_nmr_exptl_sample.concentration 1.5 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-13C; U-15N; U-2H]' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 37 ? ? 82.84 -4.58 2 1 CYS A 52 ? ? -119.49 58.39 3 1 LEU A 64 ? ? -115.02 -70.76 4 1 PHE A 69 ? ? -95.49 31.19 5 1 HIS A 94 ? ? -104.95 -165.05 6 1 PRO A 103 ? ? -69.49 77.47 7 2 TYR A 24 ? ? -97.24 30.06 8 2 PHE A 37 ? ? 83.15 -2.19 9 2 LEU A 64 ? ? -100.33 -64.07 10 2 HIS A 94 ? ? -105.01 -165.09 11 3 LEU A 64 ? ? -120.80 -77.10 12 3 HIS A 94 ? ? -104.42 -165.37 13 4 PHE A 37 ? ? 76.80 -3.85 14 4 CYS A 52 ? ? -119.60 53.33 15 4 LEU A 64 ? ? -124.94 -76.65 16 4 PHE A 69 ? ? -90.71 30.03 17 4 HIS A 94 ? ? -115.06 -155.02 18 5 PHE A 37 ? ? 82.91 -3.61 19 5 GLU A 57 ? ? -49.89 109.94 20 5 LEU A 64 ? ? -124.94 -75.05 21 5 HIS A 94 ? ? -115.05 -154.98 22 5 PRO A 103 ? ? -69.45 74.71 23 6 PHE A 37 ? ? 76.93 -3.20 24 6 LEU A 64 ? ? -125.24 -75.10 25 6 HIS A 94 ? ? -104.98 -164.98 26 7 TYR A 24 ? ? -98.02 30.07 27 7 PHE A 37 ? ? 78.56 -2.82 28 7 LEU A 64 ? ? -115.05 -78.60 29 7 HIS A 94 ? ? -104.91 -165.02 30 7 PRO A 103 ? ? -67.98 75.14 31 8 TYR A 24 ? ? -95.34 30.05 32 8 PHE A 37 ? ? 77.43 -2.94 33 8 LEU A 64 ? ? -100.08 -63.74 34 8 HIS A 94 ? ? -108.39 -160.01 35 8 PRO A 103 ? ? -68.96 74.83 36 9 LEU A 64 ? ? -87.57 -72.89 37 9 HIS A 94 ? ? -104.98 -163.60 38 9 HIS A 106 ? ? -108.26 69.99 39 10 LEU A 7 ? ? -102.92 -60.61 40 10 ASP A 26 ? ? -39.93 125.12 41 10 LEU A 64 ? ? -119.93 -78.37 42 10 HIS A 94 ? ? -103.59 -166.60 43 11 PHE A 37 ? ? 77.73 -4.11 44 11 LEU A 64 ? ? -124.63 -75.20 45 11 HIS A 94 ? ? -105.15 -162.25 46 11 PRO A 103 ? ? -68.63 74.98 47 12 TYR A 24 ? ? -95.18 30.91 48 12 PHE A 37 ? ? 83.03 -5.04 49 12 THR A 39 ? ? -52.34 109.49 50 12 LEU A 64 ? ? -125.05 -75.01 51 12 HIS A 94 ? ? -115.02 -155.02 52 12 PRO A 103 ? ? -69.10 74.99 53 13 PHE A 37 ? ? 78.23 -3.32 54 13 LEU A 64 ? ? -95.93 -67.40 55 13 LYS A 90 ? ? -59.96 108.68 56 13 HIS A 94 ? ? -105.00 -166.85 57 13 PRO A 103 ? ? -69.74 77.01 58 14 LEU A 64 ? ? -96.73 -68.23 59 14 HIS A 94 ? ? -104.94 -165.44 60 14 HIS A 106 ? ? -106.48 69.91 61 15 PHE A 37 ? ? 84.05 -7.39 62 15 THR A 39 ? ? -53.67 108.84 63 15 LEU A 64 ? ? -113.87 -73.96 64 15 HIS A 94 ? ? -115.10 -154.91 65 15 PRO A 103 ? ? -69.14 75.67 66 15 HIS A 108 ? ? -38.27 124.85 67 16 LEU A 64 ? ? -124.95 -75.06 68 16 HIS A 94 ? ? -104.67 -165.21 69 17 ASP A 26 ? ? -40.00 125.33 70 17 PHE A 37 ? ? 78.59 -2.37 71 17 THR A 39 ? ? -52.64 109.93 72 17 LEU A 64 ? ? -122.43 -78.46 73 17 PHE A 69 ? ? -95.31 30.06 74 17 HIS A 94 ? ? -104.94 -165.17 75 17 PRO A 103 ? ? -68.18 75.02 76 18 PHE A 37 ? ? 84.01 -5.38 77 18 LEU A 64 ? ? -124.90 -75.07 78 18 LYS A 90 ? ? -39.96 113.64 79 18 HIS A 94 ? ? -105.05 -160.10 80 18 PRO A 103 ? ? -69.55 74.94 81 19 LEU A 7 ? ? -101.35 -60.71 82 19 ASP A 26 ? ? -39.23 125.05 83 19 PHE A 37 ? ? 83.01 -4.47 84 19 THR A 39 ? ? -51.87 108.43 85 19 LEU A 64 ? ? -114.97 -84.87 86 19 HIS A 94 ? ? -105.03 -161.02 87 19 PRO A 103 ? ? -69.28 74.13 88 20 ASP A 26 ? ? -39.32 125.57 89 20 SER A 58 ? ? -54.93 108.83 90 20 LEU A 64 ? ? -114.86 -84.88 91 20 PHE A 69 ? ? -95.95 30.08 92 20 HIS A 94 ? ? -105.06 -164.98 # _pdbx_audit_support.funding_organization 'National Institutes of Health' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details ? #