data_5TWL # _entry.id 5TWL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.303 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5TWL WWPDB D_1000224939 # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 5TVT unspecified PDB . 5TWY unspecified PDB . 5TWU unspecified PDB . 5TWZ unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5TWL _pdbx_database_status.recvd_initial_deposition_date 2016-11-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Seo, H.-S.' 1 ? 'Huang, H.-T.' 2 ? 'Gray, N.S.' 3 ? 'Dhe-Paganon, S.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Elife _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2050-084X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 6 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'MELK is not necessary for the proliferation of basal-like breast cancer cells.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.7554/eLife.26693 _citation.pdbx_database_id_PubMed 28926338 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Huang, H.T.' 1 0000-0002-4244-2304 primary 'Seo, H.S.' 2 ? primary 'Zhang, T.' 3 ? primary 'Wang, Y.' 4 0000-0003-2703-3104 primary 'Jiang, B.' 5 ? primary 'Li, Q.' 6 ? primary 'Buckley, D.L.' 7 ? primary 'Nabet, B.' 8 ? primary 'Roberts, J.M.' 9 0000-0001-6112-7476 primary 'Paulk, J.' 10 ? primary 'Dastjerdi, S.' 11 ? primary 'Winter, G.E.' 12 ? primary 'McLauchlan, H.' 13 ? primary 'Moran, J.' 14 ? primary 'Bradner, J.E.' 15 ? primary 'Eck, M.J.' 16 ? primary 'Dhe-Paganon, S.' 17 ? primary 'Zhao, J.J.' 18 ? primary 'Gray, N.S.' 19 0000-0001-5354-7403 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5TWL _cell.details ? _cell.formula_units_Z ? _cell.length_a 57.520 _cell.length_a_esd ? _cell.length_b 68.300 _cell.length_b_esd ? _cell.length_c 104.950 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5TWL _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Maternal embryonic leucine zipper kinase' 39381.633 1 2.7.11.1,2.7.10.2 ? ? ? 2 non-polymer syn '9-(3,5-dichloro-4-hydroxyphenyl)-1-{trans-4-[(dimethylamino)methyl]cyclohexyl}-3,4-dihydropyrimido[5,4-c]quinolin-2(1H)-one' 499.432 1 ? ? ? ? 3 water nat water 18.015 36 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'hMELK,Protein kinase Eg3,pEg3 kinase,Protein kinase PK38,hPK38,Tyrosine-protein kinase MELK' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETA NKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKPKG NKDYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILL LQQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLL LLAKKARGKPVRLRLSSFSCG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETA NKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKPKG NKDYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILL LQQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLL LLAKKARGKPVRLRLSSFSCG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 LYS n 1 4 ASP n 1 5 TYR n 1 6 ASP n 1 7 GLU n 1 8 LEU n 1 9 LEU n 1 10 LYS n 1 11 TYR n 1 12 TYR n 1 13 GLU n 1 14 LEU n 1 15 HIS n 1 16 GLU n 1 17 THR n 1 18 ILE n 1 19 GLY n 1 20 THR n 1 21 GLY n 1 22 GLY n 1 23 PHE n 1 24 ALA n 1 25 LYS n 1 26 VAL n 1 27 LYS n 1 28 LEU n 1 29 ALA n 1 30 CYS n 1 31 HIS n 1 32 ILE n 1 33 LEU n 1 34 THR n 1 35 GLY n 1 36 GLU n 1 37 MET n 1 38 VAL n 1 39 ALA n 1 40 ILE n 1 41 LYS n 1 42 ILE n 1 43 MET n 1 44 ASP n 1 45 LYS n 1 46 ASN n 1 47 THR n 1 48 LEU n 1 49 GLY n 1 50 SER n 1 51 ASP n 1 52 LEU n 1 53 PRO n 1 54 ARG n 1 55 ILE n 1 56 LYS n 1 57 THR n 1 58 GLU n 1 59 ILE n 1 60 GLU n 1 61 ALA n 1 62 LEU n 1 63 LYS n 1 64 ASN n 1 65 LEU n 1 66 ARG n 1 67 HIS n 1 68 GLN n 1 69 HIS n 1 70 ILE n 1 71 CYS n 1 72 GLN n 1 73 LEU n 1 74 TYR n 1 75 HIS n 1 76 VAL n 1 77 LEU n 1 78 GLU n 1 79 THR n 1 80 ALA n 1 81 ASN n 1 82 LYS n 1 83 ILE n 1 84 PHE n 1 85 MET n 1 86 VAL n 1 87 LEU n 1 88 GLU n 1 89 TYR n 1 90 CYS n 1 91 PRO n 1 92 GLY n 1 93 GLY n 1 94 GLU n 1 95 LEU n 1 96 PHE n 1 97 ASP n 1 98 TYR n 1 99 ILE n 1 100 ILE n 1 101 SER n 1 102 GLN n 1 103 ASP n 1 104 ARG n 1 105 LEU n 1 106 SER n 1 107 GLU n 1 108 GLU n 1 109 GLU n 1 110 THR n 1 111 ARG n 1 112 VAL n 1 113 VAL n 1 114 PHE n 1 115 ARG n 1 116 GLN n 1 117 ILE n 1 118 VAL n 1 119 SER n 1 120 ALA n 1 121 VAL n 1 122 ALA n 1 123 TYR n 1 124 VAL n 1 125 HIS n 1 126 SER n 1 127 GLN n 1 128 GLY n 1 129 TYR n 1 130 ALA n 1 131 HIS n 1 132 ARG n 1 133 ASP n 1 134 LEU n 1 135 LYS n 1 136 PRO n 1 137 GLU n 1 138 ASN n 1 139 LEU n 1 140 LEU n 1 141 PHE n 1 142 ASP n 1 143 GLU n 1 144 TYR n 1 145 HIS n 1 146 LYS n 1 147 LEU n 1 148 LYS n 1 149 LEU n 1 150 ILE n 1 151 ASP n 1 152 PHE n 1 153 GLY n 1 154 LEU n 1 155 CYS n 1 156 ALA n 1 157 LYS n 1 158 PRO n 1 159 LYS n 1 160 GLY n 1 161 ASN n 1 162 LYS n 1 163 ASP n 1 164 TYR n 1 165 HIS n 1 166 LEU n 1 167 GLN n 1 168 THR n 1 169 CYS n 1 170 CYS n 1 171 GLY n 1 172 SER n 1 173 LEU n 1 174 ALA n 1 175 TYR n 1 176 ALA n 1 177 ALA n 1 178 PRO n 1 179 GLU n 1 180 LEU n 1 181 ILE n 1 182 GLN n 1 183 GLY n 1 184 LYS n 1 185 SER n 1 186 TYR n 1 187 LEU n 1 188 GLY n 1 189 SER n 1 190 GLU n 1 191 ALA n 1 192 ASP n 1 193 VAL n 1 194 TRP n 1 195 SER n 1 196 MET n 1 197 GLY n 1 198 ILE n 1 199 LEU n 1 200 LEU n 1 201 TYR n 1 202 VAL n 1 203 LEU n 1 204 MET n 1 205 CYS n 1 206 GLY n 1 207 PHE n 1 208 LEU n 1 209 PRO n 1 210 PHE n 1 211 ASP n 1 212 ASP n 1 213 ASP n 1 214 ASN n 1 215 VAL n 1 216 MET n 1 217 ALA n 1 218 LEU n 1 219 TYR n 1 220 LYS n 1 221 LYS n 1 222 ILE n 1 223 MET n 1 224 ARG n 1 225 GLY n 1 226 LYS n 1 227 TYR n 1 228 ASP n 1 229 VAL n 1 230 PRO n 1 231 LYS n 1 232 TRP n 1 233 LEU n 1 234 SER n 1 235 PRO n 1 236 SER n 1 237 SER n 1 238 ILE n 1 239 LEU n 1 240 LEU n 1 241 LEU n 1 242 GLN n 1 243 GLN n 1 244 MET n 1 245 LEU n 1 246 GLN n 1 247 VAL n 1 248 ASP n 1 249 PRO n 1 250 LYS n 1 251 LYS n 1 252 ARG n 1 253 ILE n 1 254 SER n 1 255 MET n 1 256 LYS n 1 257 ASN n 1 258 LEU n 1 259 LEU n 1 260 ASN n 1 261 HIS n 1 262 PRO n 1 263 TRP n 1 264 ILE n 1 265 MET n 1 266 GLN n 1 267 ASP n 1 268 TYR n 1 269 ASN n 1 270 TYR n 1 271 PRO n 1 272 VAL n 1 273 GLU n 1 274 TRP n 1 275 GLN n 1 276 SER n 1 277 LYS n 1 278 ASN n 1 279 PRO n 1 280 PHE n 1 281 ILE n 1 282 HIS n 1 283 LEU n 1 284 ASP n 1 285 ASP n 1 286 ASP n 1 287 CYS n 1 288 VAL n 1 289 THR n 1 290 GLU n 1 291 LEU n 1 292 SER n 1 293 VAL n 1 294 HIS n 1 295 HIS n 1 296 ARG n 1 297 ASN n 1 298 ASN n 1 299 ARG n 1 300 GLN n 1 301 THR n 1 302 MET n 1 303 GLU n 1 304 ASP n 1 305 LEU n 1 306 ILE n 1 307 SER n 1 308 LEU n 1 309 TRP n 1 310 GLN n 1 311 TYR n 1 312 ASP n 1 313 HIS n 1 314 LEU n 1 315 THR n 1 316 ALA n 1 317 THR n 1 318 TYR n 1 319 LEU n 1 320 LEU n 1 321 LEU n 1 322 LEU n 1 323 ALA n 1 324 LYS n 1 325 LYS n 1 326 ALA n 1 327 ARG n 1 328 GLY n 1 329 LYS n 1 330 PRO n 1 331 VAL n 1 332 ARG n 1 333 LEU n 1 334 ARG n 1 335 LEU n 1 336 SER n 1 337 SER n 1 338 PHE n 1 339 SER n 1 340 CYS n 1 341 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 341 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MELK, KIAA0175' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MELK_HUMAN _struct_ref.pdbx_db_accession Q14680 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETANK IFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKPKGNK DYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILLLQ QMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLLL AKKARGKPVRLRLSSFSCG ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5TWL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 341 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q14680 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 340 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 340 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5TWL GLY A 1 ? UNP Q14680 ? ? 'expression tag' 0 1 1 5TWL SER A 2 ? UNP Q14680 ? ? 'expression tag' 1 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 H91 non-polymer . '9-(3,5-dichloro-4-hydroxyphenyl)-1-{trans-4-[(dimethylamino)methyl]cyclohexyl}-3,4-dihydropyrimido[5,4-c]quinolin-2(1H)-one' ? 'C26 H28 Cl2 N4 O2' 499.432 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5TWL _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.79 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 55.84 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'magnesium chloride, PEG 3350, BIS-TRIS' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-03-21 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9791 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-E' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9791 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-E _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5TWL _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.42 _reflns.d_resolution_low 38.77 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15943 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.47 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.1 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.52 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 120.360 _refine.B_iso_mean 59.2616 _refine.B_iso_min 28.430 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5TWL _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.4200 _refine.ls_d_res_low 38.7670 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15941 _refine.ls_number_reflns_R_free 815 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.5100 _refine.ls_percent_reflns_R_free 5.1100 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1983 _refine.ls_R_factor_R_free 0.2491 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1956 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.3800 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3000 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.4200 _refine_hist.d_res_low 38.7670 _refine_hist.pdbx_number_atoms_ligand 34 _refine_hist.number_atoms_solvent 36 _refine_hist.number_atoms_total 2600 _refine_hist.pdbx_number_residues_total 319 _refine_hist.pdbx_B_iso_mean_ligand 50.58 _refine_hist.pdbx_B_iso_mean_solvent 51.80 _refine_hist.pdbx_number_atoms_protein 2530 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # _struct.entry_id 5TWL _struct.title 'Structure of Maternal Embryonic Leucine Zipper Kinase' _struct.pdbx_descriptor 'Maternal embryonic leucine zipper kinase (E.C.2.7.11.1,2.7.10.2)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5TWL _struct_keywords.text 'kinase inhibitor, basal-like breast cancer, Transferase-Transferase Inhibitor complex' _struct_keywords.pdbx_keywords 'Transferase/Transferase Inhibitor' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 1 ? ASP A 4 ? GLY A 0 ASP A 3 5 ? 4 HELX_P HELX_P2 AA2 TYR A 5 ? LYS A 10 ? TYR A 4 LYS A 9 1 ? 6 HELX_P HELX_P3 AA3 LYS A 45 ? GLY A 49 ? LYS A 44 GLY A 48 1 ? 5 HELX_P HELX_P4 AA4 ASP A 51 ? LEU A 65 ? ASP A 50 LEU A 64 1 ? 15 HELX_P HELX_P5 AA5 GLU A 94 ? GLN A 102 ? GLU A 93 GLN A 101 1 ? 9 HELX_P HELX_P6 AA6 SER A 106 ? GLN A 127 ? SER A 105 GLN A 126 1 ? 22 HELX_P HELX_P7 AA7 LYS A 135 ? GLU A 137 ? LYS A 134 GLU A 136 5 ? 3 HELX_P HELX_P8 AA8 SER A 172 ? ALA A 176 ? SER A 171 ALA A 175 5 ? 5 HELX_P HELX_P9 AA9 ALA A 177 ? GLN A 182 ? ALA A 176 GLN A 181 1 ? 6 HELX_P HELX_P10 AB1 LEU A 187 ? GLY A 206 ? LEU A 186 GLY A 205 1 ? 20 HELX_P HELX_P11 AB2 ASN A 214 ? GLY A 225 ? ASN A 213 GLY A 224 1 ? 12 HELX_P HELX_P12 AB3 SER A 234 ? LEU A 245 ? SER A 233 LEU A 244 1 ? 12 HELX_P HELX_P13 AB4 ASP A 248 ? ARG A 252 ? ASP A 247 ARG A 251 5 ? 5 HELX_P HELX_P14 AB5 SER A 254 ? ASN A 260 ? SER A 253 ASN A 259 1 ? 7 HELX_P HELX_P15 AB6 HIS A 261 ? GLN A 266 ? HIS A 260 GLN A 265 1 ? 6 HELX_P HELX_P16 AB7 ASP A 284 ? VAL A 293 ? ASP A 283 VAL A 292 1 ? 10 HELX_P HELX_P17 AB8 ASN A 298 ? SER A 307 ? ASN A 297 SER A 306 1 ? 10 HELX_P HELX_P18 AB9 ASP A 312 ? ARG A 327 ? ASP A 311 ARG A 326 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 12 ? GLY A 19 ? TYR A 11 GLY A 18 AA1 2 LYS A 25 ? HIS A 31 ? LYS A 24 HIS A 30 AA1 3 MET A 37 ? ASP A 44 ? MET A 36 ASP A 43 AA1 4 LYS A 82 ? GLU A 88 ? LYS A 81 GLU A 87 AA1 5 LEU A 73 ? GLU A 78 ? LEU A 72 GLU A 77 AA2 1 LEU A 139 ? PHE A 141 ? LEU A 138 PHE A 140 AA2 2 LEU A 147 ? LEU A 149 ? LEU A 146 LEU A 148 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N HIS A 15 ? N HIS A 14 O LEU A 28 ? O LEU A 27 AA1 2 3 N LYS A 25 ? N LYS A 24 O ILE A 42 ? O ILE A 41 AA1 3 4 N ALA A 39 ? N ALA A 38 O LEU A 87 ? O LEU A 86 AA1 4 5 O PHE A 84 ? O PHE A 83 N LEU A 77 ? N LEU A 76 AA2 1 2 N LEU A 140 ? N LEU A 139 O LYS A 148 ? O LYS A 147 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id H91 _struct_site.pdbx_auth_seq_id 4000 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 14 _struct_site.details 'binding site for residue H91 A 4000' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 14 ILE A 18 ? ILE A 17 . ? 1_555 ? 2 AC1 14 GLY A 19 ? GLY A 18 . ? 1_555 ? 3 AC1 14 ALA A 39 ? ALA A 38 . ? 1_555 ? 4 AC1 14 LYS A 41 ? LYS A 40 . ? 1_555 ? 5 AC1 14 GLU A 58 ? GLU A 57 . ? 1_555 ? 6 AC1 14 LEU A 87 ? LEU A 86 . ? 1_555 ? 7 AC1 14 GLU A 88 ? GLU A 87 . ? 1_555 ? 8 AC1 14 CYS A 90 ? CYS A 89 . ? 1_555 ? 9 AC1 14 GLU A 94 ? GLU A 93 . ? 1_555 ? 10 AC1 14 GLU A 137 ? GLU A 136 . ? 1_555 ? 11 AC1 14 ASN A 138 ? ASN A 137 . ? 1_555 ? 12 AC1 14 LEU A 140 ? LEU A 139 . ? 1_555 ? 13 AC1 14 ILE A 150 ? ILE A 149 . ? 1_555 ? 14 AC1 14 ASP A 151 ? ASP A 150 . ? 1_555 ? # _atom_sites.entry_id 5TWL _atom_sites.fract_transf_matrix[1][1] 0.017385 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014641 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009528 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CL N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 0 GLY GLY A . n A 1 2 SER 2 1 1 SER SER A . n A 1 3 LYS 3 2 2 LYS LYS A . n A 1 4 ASP 4 3 3 ASP ASP A . n A 1 5 TYR 5 4 4 TYR TYR A . n A 1 6 ASP 6 5 5 ASP ASP A . n A 1 7 GLU 7 6 6 GLU GLU A . n A 1 8 LEU 8 7 7 LEU LEU A . n A 1 9 LEU 9 8 8 LEU LEU A . n A 1 10 LYS 10 9 9 LYS LYS A . n A 1 11 TYR 11 10 10 TYR TYR A . n A 1 12 TYR 12 11 11 TYR TYR A . n A 1 13 GLU 13 12 12 GLU GLU A . n A 1 14 LEU 14 13 13 LEU LEU A . n A 1 15 HIS 15 14 14 HIS HIS A . n A 1 16 GLU 16 15 15 GLU GLU A . n A 1 17 THR 17 16 16 THR THR A . n A 1 18 ILE 18 17 17 ILE ILE A . n A 1 19 GLY 19 18 18 GLY GLY A . n A 1 20 THR 20 19 19 THR THR A . n A 1 21 GLY 21 20 20 GLY GLY A . n A 1 22 GLY 22 21 21 GLY GLY A . n A 1 23 PHE 23 22 22 PHE PHE A . n A 1 24 ALA 24 23 23 ALA ALA A . n A 1 25 LYS 25 24 24 LYS LYS A . n A 1 26 VAL 26 25 25 VAL VAL A . n A 1 27 LYS 27 26 26 LYS LYS A . n A 1 28 LEU 28 27 27 LEU LEU A . n A 1 29 ALA 29 28 28 ALA ALA A . n A 1 30 CYS 30 29 29 CYS CYS A . n A 1 31 HIS 31 30 30 HIS HIS A . n A 1 32 ILE 32 31 31 ILE ILE A . n A 1 33 LEU 33 32 32 LEU LEU A . n A 1 34 THR 34 33 33 THR THR A . n A 1 35 GLY 35 34 34 GLY GLY A . n A 1 36 GLU 36 35 35 GLU GLU A . n A 1 37 MET 37 36 36 MET MET A . n A 1 38 VAL 38 37 37 VAL VAL A . n A 1 39 ALA 39 38 38 ALA ALA A . n A 1 40 ILE 40 39 39 ILE ILE A . n A 1 41 LYS 41 40 40 LYS LYS A . n A 1 42 ILE 42 41 41 ILE ILE A . n A 1 43 MET 43 42 42 MET MET A . n A 1 44 ASP 44 43 43 ASP ASP A . n A 1 45 LYS 45 44 44 LYS LYS A . n A 1 46 ASN 46 45 45 ASN ASN A . n A 1 47 THR 47 46 46 THR THR A . n A 1 48 LEU 48 47 47 LEU LEU A . n A 1 49 GLY 49 48 48 GLY GLY A . n A 1 50 SER 50 49 49 SER SER A . n A 1 51 ASP 51 50 50 ASP ASP A . n A 1 52 LEU 52 51 51 LEU LEU A . n A 1 53 PRO 53 52 52 PRO PRO A . n A 1 54 ARG 54 53 53 ARG ARG A . n A 1 55 ILE 55 54 54 ILE ILE A . n A 1 56 LYS 56 55 55 LYS LYS A . n A 1 57 THR 57 56 56 THR THR A . n A 1 58 GLU 58 57 57 GLU GLU A . n A 1 59 ILE 59 58 58 ILE ILE A . n A 1 60 GLU 60 59 59 GLU GLU A . n A 1 61 ALA 61 60 60 ALA ALA A . n A 1 62 LEU 62 61 61 LEU LEU A . n A 1 63 LYS 63 62 62 LYS LYS A . n A 1 64 ASN 64 63 63 ASN ASN A . n A 1 65 LEU 65 64 64 LEU LEU A . n A 1 66 ARG 66 65 65 ARG ARG A . n A 1 67 HIS 67 66 66 HIS HIS A . n A 1 68 GLN 68 67 67 GLN GLN A . n A 1 69 HIS 69 68 68 HIS HIS A . n A 1 70 ILE 70 69 69 ILE ILE A . n A 1 71 CYS 71 70 70 CYS CYS A . n A 1 72 GLN 72 71 71 GLN GLN A . n A 1 73 LEU 73 72 72 LEU LEU A . n A 1 74 TYR 74 73 73 TYR TYR A . n A 1 75 HIS 75 74 74 HIS HIS A . n A 1 76 VAL 76 75 75 VAL VAL A . n A 1 77 LEU 77 76 76 LEU LEU A . n A 1 78 GLU 78 77 77 GLU GLU A . n A 1 79 THR 79 78 78 THR THR A . n A 1 80 ALA 80 79 79 ALA ALA A . n A 1 81 ASN 81 80 80 ASN ASN A . n A 1 82 LYS 82 81 81 LYS LYS A . n A 1 83 ILE 83 82 82 ILE ILE A . n A 1 84 PHE 84 83 83 PHE PHE A . n A 1 85 MET 85 84 84 MET MET A . n A 1 86 VAL 86 85 85 VAL VAL A . n A 1 87 LEU 87 86 86 LEU LEU A . n A 1 88 GLU 88 87 87 GLU GLU A . n A 1 89 TYR 89 88 88 TYR TYR A . n A 1 90 CYS 90 89 89 CYS CYS A . n A 1 91 PRO 91 90 90 PRO PRO A . n A 1 92 GLY 92 91 91 GLY GLY A . n A 1 93 GLY 93 92 92 GLY GLY A . n A 1 94 GLU 94 93 93 GLU GLU A . n A 1 95 LEU 95 94 94 LEU LEU A . n A 1 96 PHE 96 95 95 PHE PHE A . n A 1 97 ASP 97 96 96 ASP ASP A . n A 1 98 TYR 98 97 97 TYR TYR A . n A 1 99 ILE 99 98 98 ILE ILE A . n A 1 100 ILE 100 99 99 ILE ILE A . n A 1 101 SER 101 100 100 SER SER A . n A 1 102 GLN 102 101 101 GLN GLN A . n A 1 103 ASP 103 102 102 ASP ASP A . n A 1 104 ARG 104 103 103 ARG ARG A . n A 1 105 LEU 105 104 104 LEU LEU A . n A 1 106 SER 106 105 105 SER SER A . n A 1 107 GLU 107 106 106 GLU GLU A . n A 1 108 GLU 108 107 107 GLU GLU A . n A 1 109 GLU 109 108 108 GLU GLU A . n A 1 110 THR 110 109 109 THR THR A . n A 1 111 ARG 111 110 110 ARG ARG A . n A 1 112 VAL 112 111 111 VAL VAL A . n A 1 113 VAL 113 112 112 VAL VAL A . n A 1 114 PHE 114 113 113 PHE PHE A . n A 1 115 ARG 115 114 114 ARG ARG A . n A 1 116 GLN 116 115 115 GLN GLN A . n A 1 117 ILE 117 116 116 ILE ILE A . n A 1 118 VAL 118 117 117 VAL VAL A . n A 1 119 SER 119 118 118 SER SER A . n A 1 120 ALA 120 119 119 ALA ALA A . n A 1 121 VAL 121 120 120 VAL VAL A . n A 1 122 ALA 122 121 121 ALA ALA A . n A 1 123 TYR 123 122 122 TYR TYR A . n A 1 124 VAL 124 123 123 VAL VAL A . n A 1 125 HIS 125 124 124 HIS HIS A . n A 1 126 SER 126 125 125 SER SER A . n A 1 127 GLN 127 126 126 GLN GLN A . n A 1 128 GLY 128 127 127 GLY GLY A . n A 1 129 TYR 129 128 128 TYR TYR A . n A 1 130 ALA 130 129 129 ALA ALA A . n A 1 131 HIS 131 130 130 HIS HIS A . n A 1 132 ARG 132 131 131 ARG ARG A . n A 1 133 ASP 133 132 132 ASP ASP A . n A 1 134 LEU 134 133 133 LEU LEU A . n A 1 135 LYS 135 134 134 LYS LYS A . n A 1 136 PRO 136 135 135 PRO PRO A . n A 1 137 GLU 137 136 136 GLU GLU A . n A 1 138 ASN 138 137 137 ASN ASN A . n A 1 139 LEU 139 138 138 LEU LEU A . n A 1 140 LEU 140 139 139 LEU LEU A . n A 1 141 PHE 141 140 140 PHE PHE A . n A 1 142 ASP 142 141 141 ASP ASP A . n A 1 143 GLU 143 142 142 GLU GLU A . n A 1 144 TYR 144 143 143 TYR TYR A . n A 1 145 HIS 145 144 144 HIS HIS A . n A 1 146 LYS 146 145 145 LYS LYS A . n A 1 147 LEU 147 146 146 LEU LEU A . n A 1 148 LYS 148 147 147 LYS LYS A . n A 1 149 LEU 149 148 148 LEU LEU A . n A 1 150 ILE 150 149 149 ILE ILE A . n A 1 151 ASP 151 150 150 ASP ASP A . n A 1 152 PHE 152 151 151 PHE PHE A . n A 1 153 GLY 153 152 152 GLY GLY A . n A 1 154 LEU 154 153 153 LEU LEU A . n A 1 155 CYS 155 154 154 CYS CYS A . n A 1 156 ALA 156 155 ? ? ? A . n A 1 157 LYS 157 156 ? ? ? A . n A 1 158 PRO 158 157 ? ? ? A . n A 1 159 LYS 159 158 ? ? ? A . n A 1 160 GLY 160 159 ? ? ? A . n A 1 161 ASN 161 160 ? ? ? A . n A 1 162 LYS 162 161 ? ? ? A . n A 1 163 ASP 163 162 ? ? ? A . n A 1 164 TYR 164 163 ? ? ? A . n A 1 165 HIS 165 164 ? ? ? A . n A 1 166 LEU 166 165 ? ? ? A . n A 1 167 GLN 167 166 ? ? ? A . n A 1 168 THR 168 167 ? ? ? A . n A 1 169 CYS 169 168 ? ? ? A . n A 1 170 CYS 170 169 ? ? ? A . n A 1 171 GLY 171 170 170 GLY GLY A . n A 1 172 SER 172 171 171 SER SER A . n A 1 173 LEU 173 172 172 LEU LEU A . n A 1 174 ALA 174 173 173 ALA ALA A . n A 1 175 TYR 175 174 174 TYR TYR A . n A 1 176 ALA 176 175 175 ALA ALA A . n A 1 177 ALA 177 176 176 ALA ALA A . n A 1 178 PRO 178 177 177 PRO PRO A . n A 1 179 GLU 179 178 178 GLU GLU A . n A 1 180 LEU 180 179 179 LEU LEU A . n A 1 181 ILE 181 180 180 ILE ILE A . n A 1 182 GLN 182 181 181 GLN GLN A . n A 1 183 GLY 183 182 182 GLY GLY A . n A 1 184 LYS 184 183 183 LYS LYS A . n A 1 185 SER 185 184 184 SER SER A . n A 1 186 TYR 186 185 185 TYR TYR A . n A 1 187 LEU 187 186 186 LEU LEU A . n A 1 188 GLY 188 187 187 GLY GLY A . n A 1 189 SER 189 188 188 SER SER A . n A 1 190 GLU 190 189 189 GLU GLU A . n A 1 191 ALA 191 190 190 ALA ALA A . n A 1 192 ASP 192 191 191 ASP ASP A . n A 1 193 VAL 193 192 192 VAL VAL A . n A 1 194 TRP 194 193 193 TRP TRP A . n A 1 195 SER 195 194 194 SER SER A . n A 1 196 MET 196 195 195 MET MET A . n A 1 197 GLY 197 196 196 GLY GLY A . n A 1 198 ILE 198 197 197 ILE ILE A . n A 1 199 LEU 199 198 198 LEU LEU A . n A 1 200 LEU 200 199 199 LEU LEU A . n A 1 201 TYR 201 200 200 TYR TYR A . n A 1 202 VAL 202 201 201 VAL VAL A . n A 1 203 LEU 203 202 202 LEU LEU A . n A 1 204 MET 204 203 203 MET MET A . n A 1 205 CYS 205 204 204 CYS CYS A . n A 1 206 GLY 206 205 205 GLY GLY A . n A 1 207 PHE 207 206 206 PHE PHE A . n A 1 208 LEU 208 207 207 LEU LEU A . n A 1 209 PRO 209 208 208 PRO PRO A . n A 1 210 PHE 210 209 209 PHE PHE A . n A 1 211 ASP 211 210 210 ASP ASP A . n A 1 212 ASP 212 211 211 ASP ASP A . n A 1 213 ASP 213 212 212 ASP ASP A . n A 1 214 ASN 214 213 213 ASN ASN A . n A 1 215 VAL 215 214 214 VAL VAL A . n A 1 216 MET 216 215 215 MET MET A . n A 1 217 ALA 217 216 216 ALA ALA A . n A 1 218 LEU 218 217 217 LEU LEU A . n A 1 219 TYR 219 218 218 TYR TYR A . n A 1 220 LYS 220 219 219 LYS LYS A . n A 1 221 LYS 221 220 220 LYS LYS A . n A 1 222 ILE 222 221 221 ILE ILE A . n A 1 223 MET 223 222 222 MET MET A . n A 1 224 ARG 224 223 223 ARG ARG A . n A 1 225 GLY 225 224 224 GLY GLY A . n A 1 226 LYS 226 225 225 LYS LYS A . n A 1 227 TYR 227 226 226 TYR TYR A . n A 1 228 ASP 228 227 227 ASP ASP A . n A 1 229 VAL 229 228 228 VAL VAL A . n A 1 230 PRO 230 229 229 PRO PRO A . n A 1 231 LYS 231 230 230 LYS LYS A . n A 1 232 TRP 232 231 231 TRP TRP A . n A 1 233 LEU 233 232 232 LEU LEU A . n A 1 234 SER 234 233 233 SER SER A . n A 1 235 PRO 235 234 234 PRO PRO A . n A 1 236 SER 236 235 235 SER SER A . n A 1 237 SER 237 236 236 SER SER A . n A 1 238 ILE 238 237 237 ILE ILE A . n A 1 239 LEU 239 238 238 LEU LEU A . n A 1 240 LEU 240 239 239 LEU LEU A . n A 1 241 LEU 241 240 240 LEU LEU A . n A 1 242 GLN 242 241 241 GLN GLN A . n A 1 243 GLN 243 242 242 GLN GLN A . n A 1 244 MET 244 243 243 MET MET A . n A 1 245 LEU 245 244 244 LEU LEU A . n A 1 246 GLN 246 245 245 GLN GLN A . n A 1 247 VAL 247 246 246 VAL VAL A . n A 1 248 ASP 248 247 247 ASP ASP A . n A 1 249 PRO 249 248 248 PRO PRO A . n A 1 250 LYS 250 249 249 LYS LYS A . n A 1 251 LYS 251 250 250 LYS LYS A . n A 1 252 ARG 252 251 251 ARG ARG A . n A 1 253 ILE 253 252 252 ILE ILE A . n A 1 254 SER 254 253 253 SER SER A . n A 1 255 MET 255 254 254 MET MET A . n A 1 256 LYS 256 255 255 LYS LYS A . n A 1 257 ASN 257 256 256 ASN ASN A . n A 1 258 LEU 258 257 257 LEU LEU A . n A 1 259 LEU 259 258 258 LEU LEU A . n A 1 260 ASN 260 259 259 ASN ASN A . n A 1 261 HIS 261 260 260 HIS HIS A . n A 1 262 PRO 262 261 261 PRO PRO A . n A 1 263 TRP 263 262 262 TRP TRP A . n A 1 264 ILE 264 263 263 ILE ILE A . n A 1 265 MET 265 264 264 MET MET A . n A 1 266 GLN 266 265 265 GLN GLN A . n A 1 267 ASP 267 266 266 ASP ASP A . n A 1 268 TYR 268 267 267 TYR TYR A . n A 1 269 ASN 269 268 268 ASN ASN A . n A 1 270 TYR 270 269 269 TYR TYR A . n A 1 271 PRO 271 270 270 PRO PRO A . n A 1 272 VAL 272 271 271 VAL VAL A . n A 1 273 GLU 273 272 272 GLU GLU A . n A 1 274 TRP 274 273 273 TRP TRP A . n A 1 275 GLN 275 274 274 GLN GLN A . n A 1 276 SER 276 275 275 SER SER A . n A 1 277 LYS 277 276 276 LYS LYS A . n A 1 278 ASN 278 277 277 ASN ASN A . n A 1 279 PRO 279 278 278 PRO PRO A . n A 1 280 PHE 280 279 279 PHE PHE A . n A 1 281 ILE 281 280 280 ILE ILE A . n A 1 282 HIS 282 281 281 HIS HIS A . n A 1 283 LEU 283 282 282 LEU LEU A . n A 1 284 ASP 284 283 283 ASP ASP A . n A 1 285 ASP 285 284 284 ASP ASP A . n A 1 286 ASP 286 285 285 ASP ASP A . n A 1 287 CYS 287 286 286 CYS CYS A . n A 1 288 VAL 288 287 287 VAL VAL A . n A 1 289 THR 289 288 288 THR THR A . n A 1 290 GLU 290 289 289 GLU GLU A . n A 1 291 LEU 291 290 290 LEU LEU A . n A 1 292 SER 292 291 291 SER SER A . n A 1 293 VAL 293 292 292 VAL VAL A . n A 1 294 HIS 294 293 293 HIS HIS A . n A 1 295 HIS 295 294 294 HIS HIS A . n A 1 296 ARG 296 295 295 ARG ARG A . n A 1 297 ASN 297 296 296 ASN ASN A . n A 1 298 ASN 298 297 297 ASN ASN A . n A 1 299 ARG 299 298 298 ARG ARG A . n A 1 300 GLN 300 299 299 GLN GLN A . n A 1 301 THR 301 300 300 THR THR A . n A 1 302 MET 302 301 301 MET MET A . n A 1 303 GLU 303 302 302 GLU GLU A . n A 1 304 ASP 304 303 303 ASP ASP A . n A 1 305 LEU 305 304 304 LEU LEU A . n A 1 306 ILE 306 305 305 ILE ILE A . n A 1 307 SER 307 306 306 SER SER A . n A 1 308 LEU 308 307 307 LEU LEU A . n A 1 309 TRP 309 308 308 TRP TRP A . n A 1 310 GLN 310 309 309 GLN GLN A . n A 1 311 TYR 311 310 310 TYR TYR A . n A 1 312 ASP 312 311 311 ASP ASP A . n A 1 313 HIS 313 312 312 HIS HIS A . n A 1 314 LEU 314 313 313 LEU LEU A . n A 1 315 THR 315 314 314 THR THR A . n A 1 316 ALA 316 315 315 ALA ALA A . n A 1 317 THR 317 316 316 THR THR A . n A 1 318 TYR 318 317 317 TYR TYR A . n A 1 319 LEU 319 318 318 LEU LEU A . n A 1 320 LEU 320 319 319 LEU LEU A . n A 1 321 LEU 321 320 320 LEU LEU A . n A 1 322 LEU 322 321 321 LEU LEU A . n A 1 323 ALA 323 322 322 ALA ALA A . n A 1 324 LYS 324 323 323 LYS LYS A . n A 1 325 LYS 325 324 324 LYS LYS A . n A 1 326 ALA 326 325 325 ALA ALA A . n A 1 327 ARG 327 326 326 ARG ARG A . n A 1 328 GLY 328 327 327 GLY GLY A . n A 1 329 LYS 329 328 328 LYS LYS A . n A 1 330 PRO 330 329 329 PRO PRO A . n A 1 331 VAL 331 330 330 VAL VAL A . n A 1 332 ARG 332 331 331 ARG ARG A . n A 1 333 LEU 333 332 332 LEU LEU A . n A 1 334 ARG 334 333 333 ARG ARG A . n A 1 335 LEU 335 334 ? ? ? A . n A 1 336 SER 336 335 ? ? ? A . n A 1 337 SER 337 336 ? ? ? A . n A 1 338 PHE 338 337 ? ? ? A . n A 1 339 SER 339 338 ? ? ? A . n A 1 340 CYS 340 339 ? ? ? A . n A 1 341 GLY 341 340 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 H91 1 4000 4000 H91 H91 A . C 3 HOH 1 4101 12 HOH HOH A . C 3 HOH 2 4102 32 HOH HOH A . C 3 HOH 3 4103 16 HOH HOH A . C 3 HOH 4 4104 14 HOH HOH A . C 3 HOH 5 4105 15 HOH HOH A . C 3 HOH 6 4106 10 HOH HOH A . C 3 HOH 7 4107 20 HOH HOH A . C 3 HOH 8 4108 5 HOH HOH A . C 3 HOH 9 4109 36 HOH HOH A . C 3 HOH 10 4110 13 HOH HOH A . C 3 HOH 11 4111 23 HOH HOH A . C 3 HOH 12 4112 3 HOH HOH A . C 3 HOH 13 4113 30 HOH HOH A . C 3 HOH 14 4114 2 HOH HOH A . C 3 HOH 15 4115 29 HOH HOH A . C 3 HOH 16 4116 27 HOH HOH A . C 3 HOH 17 4117 9 HOH HOH A . C 3 HOH 18 4118 6 HOH HOH A . C 3 HOH 19 4119 35 HOH HOH A . C 3 HOH 20 4120 22 HOH HOH A . C 3 HOH 21 4121 25 HOH HOH A . C 3 HOH 22 4122 4 HOH HOH A . C 3 HOH 23 4123 19 HOH HOH A . C 3 HOH 24 4124 33 HOH HOH A . C 3 HOH 25 4125 21 HOH HOH A . C 3 HOH 26 4126 11 HOH HOH A . C 3 HOH 27 4127 7 HOH HOH A . C 3 HOH 28 4128 34 HOH HOH A . C 3 HOH 29 4129 8 HOH HOH A . C 3 HOH 30 4130 18 HOH HOH A . C 3 HOH 31 4131 1 HOH HOH A . C 3 HOH 32 4132 17 HOH HOH A . C 3 HOH 33 4133 28 HOH HOH A . C 3 HOH 34 4134 31 HOH HOH A . C 3 HOH 35 4135 26 HOH HOH A . C 3 HOH 36 4136 24 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-11-22 2 'Structure model' 1 1 2018-12-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined -14.4566 9.6058 5.7413 0.3942 0.4657 0.4300 -0.0674 0.0890 -0.1549 8.8665 7.3968 4.8570 -1.3911 -0.0282 0.1580 -0.0748 -0.1125 0.2431 -0.5701 0.7596 0.4722 0.2066 0.0357 -0.2234 'X-RAY DIFFRACTION' 2 ? refined -8.1988 7.3343 -6.2091 0.4441 0.3842 0.4582 -0.0198 -0.0362 0.0507 6.6182 0.6879 2.0140 0.6408 -2.2421 1.2604 -0.0438 -0.0760 0.1168 0.1969 0.5925 0.1915 -0.0516 0.0571 -0.1026 'X-RAY DIFFRACTION' 3 ? refined 3.0148 1.3410 -11.9788 0.4366 0.2913 0.3038 0.0376 0.0119 -0.0232 6.9050 3.2533 2.8460 0.3626 -1.8527 -0.3632 -0.3838 0.1885 0.1881 -0.2758 -0.1437 -0.0832 0.1738 0.3042 0.2294 'X-RAY DIFFRACTION' 4 ? refined -3.6579 10.3829 -23.9887 0.5828 0.5721 0.5318 0.0504 -0.0938 0.0831 4.6595 3.2662 6.1598 3.0971 -3.9115 -0.5917 -0.0932 0.3586 -0.2674 1.0849 0.2326 0.6200 -0.8309 -0.0624 -1.2307 'X-RAY DIFFRACTION' 5 ? refined 10.6411 6.4298 -24.0275 0.3635 0.3746 0.3065 -0.0017 0.0539 -0.0324 3.6701 4.5789 3.4016 -1.0133 -0.2082 -1.0117 -0.1953 0.1316 0.0561 0.4375 -0.0783 -0.3206 -0.3972 0.1067 0.0694 'X-RAY DIFFRACTION' 6 ? refined -10.6376 -13.0101 0.0735 0.8453 0.5144 0.7883 -0.1062 -0.0561 0.1192 4.5395 1.3081 7.9133 2.3559 -4.9830 -1.0985 0.3837 -0.3091 0.0657 -0.1353 -0.3012 0.0600 0.1744 0.5990 -0.4964 'X-RAY DIFFRACTION' 7 ? refined -14.7569 -9.0242 4.2600 0.5779 0.4345 0.5174 -0.1216 0.0008 0.0468 5.6778 7.1618 5.2170 1.8836 -0.0979 -2.9673 0.5078 -0.4105 -0.1104 -0.8127 -0.7919 -0.2063 -0.3183 0.6556 -0.5234 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 0 A 35 ;chain 'A' and (resid 0 through 35 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 36 A 105 ;chain 'A' and (resid 36 through 105 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 106 A 148 ;chain 'A' and (resid 106 through 148 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 149 A 186 ;chain 'A' and (resid 149 through 186 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 5 5 A 187 A 269 ;chain 'A' and (resid 187 through 269 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 6 6 A 270 A 297 ;chain 'A' and (resid 270 through 297 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 7 7 A 298 A 333 ;chain 'A' and (resid 298 through 333 ) ; ? ? ? ? ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 1 ? 'data processing' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ARG 251 ? ? O A HOH 4101 ? ? 1.99 2 1 O A ILE 98 ? ? O A GLN 101 ? ? 2.07 3 1 OE2 A GLU 142 ? ? O A HOH 4102 ? ? 2.12 4 1 O A HOH 4102 ? ? O A HOH 4134 ? ? 2.19 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A GLN 101 ? ? CA A GLN 101 ? ? C A GLN 101 ? ? 98.15 110.40 -12.25 2.00 N 2 1 N A GLN 101 ? ? CA A GLN 101 ? ? C A GLN 101 ? ? 93.12 111.00 -17.88 2.70 N 3 1 N A ASP 102 ? ? CA A ASP 102 ? ? CB A ASP 102 ? ? 92.53 110.60 -18.07 1.80 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 14 ? ? -104.98 -156.01 2 1 THR A 78 ? ? -108.91 -166.03 3 1 ASP A 102 ? ? -33.71 -35.44 4 1 ASP A 132 ? ? -151.95 39.99 5 1 ASP A 150 ? ? 60.99 71.93 6 1 PHE A 151 ? ? -90.97 39.33 7 1 ASP A 266 ? ? 73.46 -7.90 8 1 VAL A 292 ? ? -80.21 33.58 9 1 HIS A 293 ? ? -149.55 -3.56 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 6 ? CG ? A GLU 7 CG 2 1 Y 1 A GLU 6 ? CD ? A GLU 7 CD 3 1 Y 1 A GLU 6 ? OE1 ? A GLU 7 OE1 4 1 Y 1 A GLU 6 ? OE2 ? A GLU 7 OE2 5 1 Y 1 A GLU 12 ? CG ? A GLU 13 CG 6 1 Y 1 A GLU 12 ? CD ? A GLU 13 CD 7 1 Y 1 A GLU 12 ? OE1 ? A GLU 13 OE1 8 1 Y 1 A GLU 12 ? OE2 ? A GLU 13 OE2 9 1 Y 1 A HIS 14 ? CE1 ? A HIS 15 CE1 10 1 Y 1 A HIS 14 ? NE2 ? A HIS 15 NE2 11 1 Y 1 A THR 19 ? OG1 ? A THR 20 OG1 12 1 Y 1 A THR 19 ? CG2 ? A THR 20 CG2 13 1 Y 1 A PHE 22 ? CG ? A PHE 23 CG 14 1 Y 1 A PHE 22 ? CD1 ? A PHE 23 CD1 15 1 Y 1 A PHE 22 ? CD2 ? A PHE 23 CD2 16 1 Y 1 A PHE 22 ? CE1 ? A PHE 23 CE1 17 1 Y 1 A PHE 22 ? CE2 ? A PHE 23 CE2 18 1 Y 1 A PHE 22 ? CZ ? A PHE 23 CZ 19 1 Y 1 A ASP 50 ? CG ? A ASP 51 CG 20 1 Y 1 A ASP 50 ? OD1 ? A ASP 51 OD1 21 1 Y 1 A ASP 50 ? OD2 ? A ASP 51 OD2 22 1 Y 1 A GLU 59 ? CG ? A GLU 60 CG 23 1 Y 1 A GLU 59 ? CD ? A GLU 60 CD 24 1 Y 1 A GLU 59 ? OE1 ? A GLU 60 OE1 25 1 Y 1 A GLU 59 ? OE2 ? A GLU 60 OE2 26 1 Y 1 A LYS 183 ? CG ? A LYS 184 CG 27 1 Y 1 A LYS 183 ? CD ? A LYS 184 CD 28 1 Y 1 A LYS 183 ? CE ? A LYS 184 CE 29 1 Y 1 A LYS 183 ? NZ ? A LYS 184 NZ 30 1 Y 1 A SER 184 ? OG ? A SER 185 OG 31 1 Y 1 A LYS 230 ? CG ? A LYS 231 CG 32 1 Y 1 A LYS 230 ? CD ? A LYS 231 CD 33 1 Y 1 A LYS 230 ? CE ? A LYS 231 CE 34 1 Y 1 A LYS 230 ? NZ ? A LYS 231 NZ 35 1 Y 1 A LYS 255 ? CG ? A LYS 256 CG 36 1 Y 1 A LYS 255 ? CD ? A LYS 256 CD 37 1 Y 1 A LYS 255 ? CE ? A LYS 256 CE 38 1 Y 1 A LYS 255 ? NZ ? A LYS 256 NZ 39 1 Y 1 A SER 291 ? OG ? A SER 292 OG 40 1 Y 1 A VAL 292 ? CG1 ? A VAL 293 CG1 41 1 Y 1 A VAL 292 ? CG2 ? A VAL 293 CG2 42 1 Y 1 A ARG 295 ? CG ? A ARG 296 CG 43 1 Y 1 A ARG 295 ? CD ? A ARG 296 CD 44 1 Y 1 A ARG 295 ? NE ? A ARG 296 NE 45 1 Y 1 A ARG 295 ? CZ ? A ARG 296 CZ 46 1 Y 1 A ARG 295 ? NH1 ? A ARG 296 NH1 47 1 Y 1 A ARG 295 ? NH2 ? A ARG 296 NH2 48 1 Y 1 A ARG 326 ? CG ? A ARG 327 CG 49 1 Y 1 A ARG 326 ? CD ? A ARG 327 CD 50 1 Y 1 A ARG 326 ? NE ? A ARG 327 NE 51 1 Y 1 A ARG 326 ? CZ ? A ARG 327 CZ 52 1 Y 1 A ARG 326 ? NH1 ? A ARG 327 NH1 53 1 Y 1 A ARG 326 ? NH2 ? A ARG 327 NH2 54 1 Y 1 A LYS 328 ? CG ? A LYS 329 CG 55 1 Y 1 A LYS 328 ? CD ? A LYS 329 CD 56 1 Y 1 A LYS 328 ? CE ? A LYS 329 CE 57 1 Y 1 A LYS 328 ? NZ ? A LYS 329 NZ 58 1 Y 1 A ARG 331 ? CG ? A ARG 332 CG 59 1 Y 1 A ARG 331 ? CD ? A ARG 332 CD 60 1 Y 1 A ARG 331 ? NE ? A ARG 332 NE 61 1 Y 1 A ARG 331 ? CZ ? A ARG 332 CZ 62 1 Y 1 A ARG 331 ? NH1 ? A ARG 332 NH1 63 1 Y 1 A ARG 331 ? NH2 ? A ARG 332 NH2 64 1 Y 1 A ARG 333 ? CG ? A ARG 334 CG 65 1 Y 1 A ARG 333 ? CD ? A ARG 334 CD 66 1 Y 1 A ARG 333 ? NE ? A ARG 334 NE 67 1 Y 1 A ARG 333 ? CZ ? A ARG 334 CZ 68 1 Y 1 A ARG 333 ? NH1 ? A ARG 334 NH1 69 1 Y 1 A ARG 333 ? NH2 ? A ARG 334 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 155 ? A ALA 156 2 1 Y 1 A LYS 156 ? A LYS 157 3 1 Y 1 A PRO 157 ? A PRO 158 4 1 Y 1 A LYS 158 ? A LYS 159 5 1 Y 1 A GLY 159 ? A GLY 160 6 1 Y 1 A ASN 160 ? A ASN 161 7 1 Y 1 A LYS 161 ? A LYS 162 8 1 Y 1 A ASP 162 ? A ASP 163 9 1 Y 1 A TYR 163 ? A TYR 164 10 1 Y 1 A HIS 164 ? A HIS 165 11 1 Y 1 A LEU 165 ? A LEU 166 12 1 Y 1 A GLN 166 ? A GLN 167 13 1 Y 1 A THR 167 ? A THR 168 14 1 Y 1 A CYS 168 ? A CYS 169 15 1 Y 1 A CYS 169 ? A CYS 170 16 1 Y 1 A LEU 334 ? A LEU 335 17 1 Y 1 A SER 335 ? A SER 336 18 1 Y 1 A SER 336 ? A SER 337 19 1 Y 1 A PHE 337 ? A PHE 338 20 1 Y 1 A SER 338 ? A SER 339 21 1 Y 1 A CYS 339 ? A CYS 340 22 1 Y 1 A GLY 340 ? A GLY 341 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '9-(3,5-dichloro-4-hydroxyphenyl)-1-{trans-4-[(dimethylamino)methyl]cyclohexyl}-3,4-dihydropyrimido[5,4-c]quinolin-2(1H)-one' H91 3 water HOH #