data_5TY4 # _entry.id 5TY4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5TY4 pdb_00005ty4 10.2210/pdb5ty4/pdb WWPDB D_1000224688 ? ? EMDB EMD-8472 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-04-26 2 'Structure model' 1 1 2017-08-09 3 'Structure model' 1 2 2018-07-18 4 'Structure model' 1 3 2018-08-22 5 'Structure model' 1 4 2023-10-04 6 'Structure model' 1 5 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' 8 5 'Structure model' 'Refinement description' 9 6 'Structure model' 'Data collection' 10 6 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' diffrn_detector 2 2 'Structure model' pdbx_related_exp_data_set 3 3 'Structure model' em_software 4 4 'Structure model' pdbx_related_exp_data_set 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' database_2 8 5 'Structure model' pdbx_initial_refinement_model 9 6 'Structure model' em_admin 10 6 'Structure model' pdbx_entry_details 11 6 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_diffrn_detector.type' 2 2 'Structure model' '_pdbx_related_exp_data_set.data_reference' 3 3 'Structure model' '_em_software.name' 4 4 'Structure model' '_pdbx_related_exp_data_set.data_reference' 5 5 'Structure model' '_database_2.pdbx_DOI' 6 5 'Structure model' '_database_2.pdbx_database_accession' 7 6 'Structure model' '_em_admin.last_update' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5TY4 _pdbx_database_status.recvd_initial_deposition_date 2016-11-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type EMDB . EMD-8216 'other EM volume' EMDB . EMD-8217 'other EM volume' EMDB . EMD-8218 'other EM volume' EMDB . EMD-8219 'other EM volume' EMDB . EMD-8220 'other EM volume' EMDB . EMD-8221 'other EM volume' EMDB . EMD-8222 'other EM volume' PDB . 5K7N unspecified PDB . 5K7O unspecified PDB . 5K7P unspecified PDB . 5K7Q unspecified PDB . 5K7R unspecified PDB . 5K7S unspecified PDB . 5K7T unspecified EMDB 'MicroED structure of a complex between monomeric TGF-b and its receptor, TbRII, at 2.9 A resolution' EMD-8472 'associated EM volume' # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Weiss, S.C.' 1 'de la Cruz, M.J.' 2 'Hattne, J.' 3 'Shi, D.' 4 'Reyes, F.E.' 5 'Callero, G.' 6 'Gonen, T.' 7 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat. Methods' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1548-7105 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 14 _citation.language ? _citation.page_first 399 _citation.page_last 402 _citation.title 'Atomic-resolution structures from fragmented protein crystals with the cryoEM method MicroED.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/nmeth.4178 _citation.pdbx_database_id_PubMed 28192420 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'de la Cruz, M.J.' 1 ? primary 'Hattne, J.' 2 ? primary 'Shi, D.' 3 ? primary 'Seidler, P.' 4 ? primary 'Rodriguez, J.' 5 ? primary 'Reyes, F.E.' 6 ? primary 'Sawaya, M.R.' 7 ? primary 'Cascio, D.' 8 ? primary 'Weiss, S.C.' 9 ? primary 'Kim, S.K.' 10 ? primary 'Hinck, C.S.' 11 ? primary 'Hinck, A.P.' 12 ? primary 'Calero, G.' 13 ? primary 'Eisenberg, D.' 14 ? primary 'Gonen, T.' 15 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'TGF-beta receptor type-2' 11788.519 1 2.7.11.30 ? ? ? 2 polymer man mmTGF-b2-7m 11076.813 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'TGFR-2, TGF-beta type II receptor, Transforming growth factor-beta receptor type II, TbetaR-II' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;FPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPTCIMKEK KKPGETFFMCSCSSDECNDNIIF ; ;FPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPTCIMKEK KKPGETFFMCSCSSDECNDNIIF ; A ? 2 'polypeptide(L)' no no ;CCLRPLYIDFRKDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTIVYYVGR KPKVEQLSNMIVKSCKC ; ;CCLRPLYIDFRKDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTIVYYVGR KPKVEQLSNMIVKSCKC ; B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PHE n 1 2 PRO n 1 3 GLN n 1 4 LEU n 1 5 CYS n 1 6 LYS n 1 7 PHE n 1 8 CYS n 1 9 ASP n 1 10 VAL n 1 11 ARG n 1 12 PHE n 1 13 SER n 1 14 THR n 1 15 CYS n 1 16 ASP n 1 17 ASN n 1 18 GLN n 1 19 LYS n 1 20 SER n 1 21 CYS n 1 22 MET n 1 23 SER n 1 24 ASN n 1 25 CYS n 1 26 SER n 1 27 ILE n 1 28 THR n 1 29 SER n 1 30 ILE n 1 31 CYS n 1 32 GLU n 1 33 LYS n 1 34 PRO n 1 35 GLN n 1 36 GLU n 1 37 VAL n 1 38 CYS n 1 39 VAL n 1 40 ALA n 1 41 VAL n 1 42 TRP n 1 43 ARG n 1 44 LYS n 1 45 ASN n 1 46 ASP n 1 47 GLU n 1 48 ASN n 1 49 ILE n 1 50 THR n 1 51 LEU n 1 52 GLU n 1 53 THR n 1 54 VAL n 1 55 CYS n 1 56 HIS n 1 57 ASP n 1 58 PRO n 1 59 LYS n 1 60 LEU n 1 61 PRO n 1 62 TYR n 1 63 HIS n 1 64 ASP n 1 65 PHE n 1 66 ILE n 1 67 LEU n 1 68 GLU n 1 69 ASP n 1 70 ALA n 1 71 ALA n 1 72 SER n 1 73 PRO n 1 74 THR n 1 75 CYS n 1 76 ILE n 1 77 MET n 1 78 LYS n 1 79 GLU n 1 80 LYS n 1 81 LYS n 1 82 LYS n 1 83 PRO n 1 84 GLY n 1 85 GLU n 1 86 THR n 1 87 PHE n 1 88 PHE n 1 89 MET n 1 90 CYS n 1 91 SER n 1 92 CYS n 1 93 SER n 1 94 SER n 1 95 ASP n 1 96 GLU n 1 97 CYS n 1 98 ASN n 1 99 ASP n 1 100 ASN n 1 101 ILE n 1 102 ILE n 1 103 PHE n 2 1 CYS n 2 2 CYS n 2 3 LEU n 2 4 ARG n 2 5 PRO n 2 6 LEU n 2 7 TYR n 2 8 ILE n 2 9 ASP n 2 10 PHE n 2 11 ARG n 2 12 LYS n 2 13 ASP n 2 14 LEU n 2 15 GLY n 2 16 TRP n 2 17 LYS n 2 18 TRP n 2 19 ILE n 2 20 HIS n 2 21 GLU n 2 22 PRO n 2 23 LYS n 2 24 GLY n 2 25 TYR n 2 26 ASN n 2 27 ALA n 2 28 ASN n 2 29 PHE n 2 30 CYS n 2 31 ALA n 2 32 GLY n 2 33 ALA n 2 34 CYS n 2 35 PRO n 2 36 TYR n 2 37 LEU n 2 38 TRP n 2 39 SER n 2 40 SER n 2 41 ASP n 2 42 THR n 2 43 GLN n 2 44 HIS n 2 45 SER n 2 46 ARG n 2 47 VAL n 2 48 LEU n 2 49 SER n 2 50 LEU n 2 51 TYR n 2 52 ASN n 2 53 THR n 2 54 ILE n 2 55 ASN n 2 56 PRO n 2 57 GLU n 2 58 ALA n 2 59 SER n 2 60 ALA n 2 61 SER n 2 62 PRO n 2 63 CYS n 2 64 CYS n 2 65 VAL n 2 66 SER n 2 67 GLN n 2 68 ASP n 2 69 LEU n 2 70 GLU n 2 71 PRO n 2 72 LEU n 2 73 THR n 2 74 ILE n 2 75 VAL n 2 76 TYR n 2 77 TYR n 2 78 VAL n 2 79 GLY n 2 80 ARG n 2 81 LYS n 2 82 PRO n 2 83 LYS n 2 84 VAL n 2 85 GLU n 2 86 GLN n 2 87 LEU n 2 88 SER n 2 89 ASN n 2 90 MET n 2 91 ILE n 2 92 VAL n 2 93 LYS n 2 94 SER n 2 95 CYS n 2 96 LYS n 2 97 CYS n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 103 Human ? TGFBR2 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 97 Human ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PHE 1 47 47 PHE PHE A . n A 1 2 PRO 2 48 48 PRO PRO A . n A 1 3 GLN 3 49 49 GLN GLN A . n A 1 4 LEU 4 50 50 LEU LEU A . n A 1 5 CYS 5 51 51 CYS CYS A . n A 1 6 LYS 6 52 52 LYS LYS A . n A 1 7 PHE 7 53 53 PHE PHE A . n A 1 8 CYS 8 54 54 CYS CYS A . n A 1 9 ASP 9 55 55 ASP ASP A . n A 1 10 VAL 10 56 56 VAL VAL A . n A 1 11 ARG 11 57 57 ARG ARG A . n A 1 12 PHE 12 58 58 PHE PHE A . n A 1 13 SER 13 59 59 SER SER A . n A 1 14 THR 14 60 60 THR THR A . n A 1 15 CYS 15 61 61 CYS CYS A . n A 1 16 ASP 16 62 62 ASP ASP A . n A 1 17 ASN 17 63 63 ASN ASN A . n A 1 18 GLN 18 64 64 GLN GLN A . n A 1 19 LYS 19 65 65 LYS LYS A . n A 1 20 SER 20 66 66 SER SER A . n A 1 21 CYS 21 67 67 CYS CYS A . n A 1 22 MET 22 68 68 MET MET A . n A 1 23 SER 23 69 69 SER SER A . n A 1 24 ASN 24 70 70 ASN ASN A . n A 1 25 CYS 25 71 71 CYS CYS A . n A 1 26 SER 26 72 72 SER SER A . n A 1 27 ILE 27 73 73 ILE ILE A . n A 1 28 THR 28 74 74 THR THR A . n A 1 29 SER 29 75 75 SER SER A . n A 1 30 ILE 30 76 76 ILE ILE A . n A 1 31 CYS 31 77 77 CYS CYS A . n A 1 32 GLU 32 78 78 GLU GLU A . n A 1 33 LYS 33 79 79 LYS LYS A . n A 1 34 PRO 34 80 80 PRO PRO A . n A 1 35 GLN 35 81 81 GLN GLN A . n A 1 36 GLU 36 82 82 GLU GLU A . n A 1 37 VAL 37 83 83 VAL VAL A . n A 1 38 CYS 38 84 84 CYS CYS A . n A 1 39 VAL 39 85 85 VAL VAL A . n A 1 40 ALA 40 86 86 ALA ALA A . n A 1 41 VAL 41 87 87 VAL VAL A . n A 1 42 TRP 42 88 88 TRP TRP A . n A 1 43 ARG 43 89 89 ARG ARG A . n A 1 44 LYS 44 90 90 LYS LYS A . n A 1 45 ASN 45 91 91 ASN ASN A . n A 1 46 ASP 46 92 ? ? ? A . n A 1 47 GLU 47 93 ? ? ? A . n A 1 48 ASN 48 94 94 ASN ASN A . n A 1 49 ILE 49 95 95 ILE ILE A . n A 1 50 THR 50 96 96 THR THR A . n A 1 51 LEU 51 97 97 LEU LEU A . n A 1 52 GLU 52 98 98 GLU GLU A . n A 1 53 THR 53 99 99 THR THR A . n A 1 54 VAL 54 100 100 VAL VAL A . n A 1 55 CYS 55 101 101 CYS CYS A . n A 1 56 HIS 56 102 102 HIS HIS A . n A 1 57 ASP 57 103 103 ASP ASP A . n A 1 58 PRO 58 104 104 PRO PRO A . n A 1 59 LYS 59 105 105 LYS LYS A . n A 1 60 LEU 60 106 106 LEU LEU A . n A 1 61 PRO 61 107 107 PRO PRO A . n A 1 62 TYR 62 108 108 TYR TYR A . n A 1 63 HIS 63 109 109 HIS HIS A . n A 1 64 ASP 64 110 110 ASP ASP A . n A 1 65 PHE 65 111 111 PHE PHE A . n A 1 66 ILE 66 112 112 ILE ILE A . n A 1 67 LEU 67 113 113 LEU LEU A . n A 1 68 GLU 68 114 114 GLU GLU A . n A 1 69 ASP 69 115 115 ASP ASP A . n A 1 70 ALA 70 116 116 ALA ALA A . n A 1 71 ALA 71 117 117 ALA ALA A . n A 1 72 SER 72 118 118 SER SER A . n A 1 73 PRO 73 119 119 PRO PRO A . n A 1 74 THR 74 120 120 THR THR A . n A 1 75 CYS 75 121 121 CYS CYS A . n A 1 76 ILE 76 122 122 ILE ILE A . n A 1 77 MET 77 123 123 MET MET A . n A 1 78 LYS 78 124 124 LYS LYS A . n A 1 79 GLU 79 125 125 GLU GLU A . n A 1 80 LYS 80 126 126 LYS LYS A . n A 1 81 LYS 81 127 127 LYS LYS A . n A 1 82 LYS 82 128 128 LYS LYS A . n A 1 83 PRO 83 129 129 PRO PRO A . n A 1 84 GLY 84 130 130 GLY GLY A . n A 1 85 GLU 85 131 131 GLU GLU A . n A 1 86 THR 86 132 132 THR THR A . n A 1 87 PHE 87 133 133 PHE PHE A . n A 1 88 PHE 88 134 134 PHE PHE A . n A 1 89 MET 89 135 135 MET MET A . n A 1 90 CYS 90 136 136 CYS CYS A . n A 1 91 SER 91 137 137 SER SER A . n A 1 92 CYS 92 138 138 CYS CYS A . n A 1 93 SER 93 139 139 SER SER A . n A 1 94 SER 94 140 140 SER SER A . n A 1 95 ASP 95 141 141 ASP ASP A . n A 1 96 GLU 96 142 142 GLU GLU A . n A 1 97 CYS 97 143 143 CYS CYS A . n A 1 98 ASN 98 144 144 ASN ASN A . n A 1 99 ASP 99 145 145 ASP ASP A . n A 1 100 ASN 100 146 146 ASN ASN A . n A 1 101 ILE 101 147 147 ILE ILE A . n A 1 102 ILE 102 148 148 ILE ILE A . n A 1 103 PHE 103 149 149 PHE PHE A . n B 2 1 CYS 1 315 315 CYS CYS B . n B 2 2 CYS 2 316 316 CYS CYS B . n B 2 3 LEU 3 317 317 LEU LEU B . n B 2 4 ARG 4 318 318 ARG ARG B . n B 2 5 PRO 5 319 319 PRO PRO B . n B 2 6 LEU 6 320 320 LEU LEU B . n B 2 7 TYR 7 321 321 TYR TYR B . n B 2 8 ILE 8 322 322 ILE ILE B . n B 2 9 ASP 9 323 323 ASP ASP B . n B 2 10 PHE 10 324 324 PHE PHE B . n B 2 11 ARG 11 325 325 ARG ARG B . n B 2 12 LYS 12 326 326 LYS LYS B . n B 2 13 ASP 13 327 327 ASP ASP B . n B 2 14 LEU 14 328 328 LEU LEU B . n B 2 15 GLY 15 329 329 GLY GLY B . n B 2 16 TRP 16 330 330 TRP TRP B . n B 2 17 LYS 17 331 331 LYS LYS B . n B 2 18 TRP 18 332 332 TRP TRP B . n B 2 19 ILE 19 333 333 ILE ILE B . n B 2 20 HIS 20 334 334 HIS HIS B . n B 2 21 GLU 21 335 335 GLU GLU B . n B 2 22 PRO 22 336 336 PRO PRO B . n B 2 23 LYS 23 337 337 LYS LYS B . n B 2 24 GLY 24 338 338 GLY GLY B . n B 2 25 TYR 25 339 339 TYR TYR B . n B 2 26 ASN 26 340 340 ASN ASN B . n B 2 27 ALA 27 341 341 ALA ALA B . n B 2 28 ASN 28 342 342 ASN ASN B . n B 2 29 PHE 29 343 343 PHE PHE B . n B 2 30 CYS 30 344 344 CYS CYS B . n B 2 31 ALA 31 345 ? ? ? B . n B 2 32 GLY 32 346 ? ? ? B . n B 2 33 ALA 33 347 ? ? ? B . n B 2 34 CYS 34 348 ? ? ? B . n B 2 35 PRO 35 349 ? ? ? B . n B 2 36 TYR 36 350 ? ? ? B . n B 2 37 LEU 37 351 ? ? ? B . n B 2 38 TRP 38 352 ? ? ? B . n B 2 39 SER 39 353 ? ? ? B . n B 2 40 SER 40 354 ? ? ? B . n B 2 41 ASP 41 355 ? ? ? B . n B 2 42 THR 42 356 ? ? ? B . n B 2 43 GLN 43 357 ? ? ? B . n B 2 44 HIS 44 358 ? ? ? B . n B 2 45 SER 45 359 ? ? ? B . n B 2 46 ARG 46 360 ? ? ? B . n B 2 47 VAL 47 361 ? ? ? B . n B 2 48 LEU 48 362 ? ? ? B . n B 2 49 SER 49 363 ? ? ? B . n B 2 50 LEU 50 364 ? ? ? B . n B 2 51 TYR 51 365 ? ? ? B . n B 2 52 ASN 52 366 ? ? ? B . n B 2 53 THR 53 367 ? ? ? B . n B 2 54 ILE 54 368 ? ? ? B . n B 2 55 ASN 55 369 ? ? ? B . n B 2 56 PRO 56 370 ? ? ? B . n B 2 57 GLU 57 371 ? ? ? B . n B 2 58 ALA 58 372 ? ? ? B . n B 2 59 SER 59 373 ? ? ? B . n B 2 60 ALA 60 374 ? ? ? B . n B 2 61 SER 61 375 ? ? ? B . n B 2 62 PRO 62 376 ? ? ? B . n B 2 63 CYS 63 377 377 CYS ALA B . n B 2 64 CYS 64 378 378 CYS CYS B . n B 2 65 VAL 65 379 379 VAL VAL B . n B 2 66 SER 66 380 380 SER SER B . n B 2 67 GLN 67 381 381 GLN GLN B . n B 2 68 ASP 68 382 382 ASP ASP B . n B 2 69 LEU 69 383 383 LEU LEU B . n B 2 70 GLU 70 384 384 GLU GLU B . n B 2 71 PRO 71 385 385 PRO PRO B . n B 2 72 LEU 72 386 386 LEU LEU B . n B 2 73 THR 73 387 387 THR THR B . n B 2 74 ILE 74 388 388 ILE ILE B . n B 2 75 VAL 75 389 389 VAL VAL B . n B 2 76 TYR 76 390 390 TYR TYR B . n B 2 77 TYR 77 391 391 TYR TYR B . n B 2 78 VAL 78 392 392 VAL VAL B . n B 2 79 GLY 79 393 393 GLY GLY B . n B 2 80 ARG 80 394 394 ARG ARG B . n B 2 81 LYS 81 395 395 LYS LYS B . n B 2 82 PRO 82 396 396 PRO PRO B . n B 2 83 LYS 83 397 397 LYS LYS B . n B 2 84 VAL 84 398 398 VAL VAL B . n B 2 85 GLU 85 399 399 GLU GLU B . n B 2 86 GLN 86 400 400 GLN GLN B . n B 2 87 LEU 87 401 401 LEU LEU B . n B 2 88 SER 88 402 402 SER SER B . n B 2 89 ASN 89 403 403 ASN ASN B . n B 2 90 MET 90 404 404 MET MET B . n B 2 91 ILE 91 405 405 ILE ILE B . n B 2 92 VAL 92 406 406 VAL VAL B . n B 2 93 LYS 93 407 407 LYS LYS B . n B 2 94 SER 94 408 408 SER SER B . n B 2 95 CYS 95 409 409 CYS CYS B . n B 2 96 LYS 96 410 410 LYS LYS B . n B 2 97 CYS 97 411 411 CYS CYS B . n # _pdbx_unobs_or_zero_occ_atoms.id 1 _pdbx_unobs_or_zero_occ_atoms.PDB_model_num 1 _pdbx_unobs_or_zero_occ_atoms.polymer_flag Y _pdbx_unobs_or_zero_occ_atoms.occupancy_flag 1 _pdbx_unobs_or_zero_occ_atoms.auth_asym_id B _pdbx_unobs_or_zero_occ_atoms.auth_comp_id CYS _pdbx_unobs_or_zero_occ_atoms.auth_seq_id 377 _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code ? _pdbx_unobs_or_zero_occ_atoms.auth_atom_id SG _pdbx_unobs_or_zero_occ_atoms.label_alt_id ? _pdbx_unobs_or_zero_occ_atoms.label_asym_id B _pdbx_unobs_or_zero_occ_atoms.label_comp_id CYS _pdbx_unobs_or_zero_occ_atoms.label_seq_id 63 _pdbx_unobs_or_zero_occ_atoms.label_atom_id SG # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.10 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? 7.1.0 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.5.27 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.6.0 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5TY4 _cell.details ? _cell.formula_units_Z ? _cell.length_a 41.530 _cell.length_a_esd ? _cell.length_b 71.330 _cell.length_b_esd ? _cell.length_c 79.508 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5TY4 _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5TY4 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'ELECTRON CRYSTALLOGRAPHY' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.58 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 52.24 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.5 ul 20 mg/mL protein + 0.25 ul mother liquor + 0.2 ul seed stock in 100 mM HEPES/NaOH pH 7.5, 45% MPD' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 293 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CMOS _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'TVIPS TEMCAM-F416' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-05-04 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type electron # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.0250793397 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ELECTRON MICROSCOPE' _diffrn_source.target ? _diffrn_source.type OTHER _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.0250793397 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate 64.0 _reflns.entry_id 5TY4 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.9 _reflns.d_resolution_low 26.64 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 3884 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 71.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.8 _reflns.pdbx_Rmerge_I_obs 0.293 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.293 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 3.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.951 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.90 _reflns_shell.d_res_low 3.07 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.8 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 71.3 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 2.024 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.9 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.255 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5TY4 _refine.pdbx_refine_id 'ELECTRON CRYSTALLOGRAPHY' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.900 _refine.ls_d_res_low 26.640 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 3848 _refine.ls_number_reflns_R_free 290 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 68.82 _refine.ls_percent_reflns_R_free 7.54 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2948 _refine.ls_R_factor_R_free 0.3280 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2919 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PDB entry 1KTZ' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.99 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.40 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'ELECTRON CRYSTALLOGRAPHY' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1327 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1327 _refine_hist.d_res_high 2.900 _refine_hist.d_res_low 26.640 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'ELECTRON CRYSTALLOGRAPHY' ? 0.012 ? 1366 ? f_bond_d ? ? 'ELECTRON CRYSTALLOGRAPHY' ? 1.573 ? 1847 ? f_angle_d ? ? 'ELECTRON CRYSTALLOGRAPHY' ? 19.181 ? 864 ? f_dihedral_angle_d ? ? 'ELECTRON CRYSTALLOGRAPHY' ? 0.067 ? 200 ? f_chiral_restr ? ? 'ELECTRON CRYSTALLOGRAPHY' ? 0.009 ? 231 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'ELECTRON CRYSTALLOGRAPHY' 2.9001 3.6523 . . 136 1748 69.00 . . . 0.3687 . 0.3611 . . . . . . . . . . 'ELECTRON CRYSTALLOGRAPHY' 3.6523 26.640 . . 154 1810 69.00 . . . 0.3133 . 0.2639 . . . . . . . . . . # _struct.entry_id 5TY4 _struct.title 'MicroED structure of a complex between monomeric TGF-b and its receptor, TbRII, at 2.9 A resolution' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5TY4 _struct_keywords.text TRANSFERASE _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP TGFR2_HUMAN P37173 P37173-2 1 ;FPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEK KKPGETFFMCSCSSDECNDNIIF ; 72 2 PDB 5TY4 5TY4 ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5TY4 A 1 ? 103 ? P37173 72 ? 174 ? 47 149 2 2 5TY4 B 1 ? 97 ? 5TY4 315 ? 411 ? 315 411 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 5TY4 _struct_ref_seq_dif.mon_id THR _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 74 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P37173 _struct_ref_seq_dif.db_mon_id LYS _struct_ref_seq_dif.pdbx_seq_db_seq_num 145 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 120 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 860 ? 1 MORE -2 ? 1 'SSA (A^2)' 10010 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id GLU _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 96 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 98 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLU _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 142 _struct_conf.end_auth_comp_id ASN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 144 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 5 SG ? ? ? 1_555 A CYS 38 SG ? ? A CYS 51 A CYS 84 1_555 ? ? ? ? ? ? ? 2.010 ? ? disulf2 disulf ? ? A CYS 5 SG ? ? ? 1_555 A CYS 92 SG ? ? A CYS 51 A CYS 138 1_555 ? ? ? ? ? ? ? 2.066 ? ? disulf3 disulf ? ? A CYS 5 SG ? ? ? 1_555 A CYS 97 SG ? ? A CYS 51 A CYS 143 1_555 ? ? ? ? ? ? ? 1.802 ? ? disulf4 disulf ? ? A CYS 8 SG ? ? ? 1_555 A CYS 25 SG ? ? A CYS 54 A CYS 71 1_555 ? ? ? ? ? ? ? 2.028 ? ? disulf5 disulf ? ? A CYS 15 SG ? ? ? 1_555 A CYS 21 SG ? ? A CYS 61 A CYS 67 1_555 ? ? ? ? ? ? ? 2.039 ? ? disulf6 disulf ? ? A CYS 31 SG ? ? ? 1_555 A CYS 55 SG ? ? A CYS 77 A CYS 101 1_555 ? ? ? ? ? ? ? 2.028 ? ? disulf7 disulf ? ? A CYS 38 SG ? ? ? 1_555 A CYS 92 SG ? ? A CYS 84 A CYS 138 1_555 ? ? ? ? ? ? ? 2.033 ? ? disulf8 disulf ? ? A CYS 75 SG ? ? ? 1_555 A CYS 90 SG ? ? A CYS 121 A CYS 136 1_555 ? ? ? ? ? ? ? 2.033 ? ? disulf9 disulf ? ? A CYS 92 SG ? ? ? 1_555 A CYS 97 SG ? ? A CYS 138 A CYS 143 1_555 ? ? ? ? ? ? ? 2.040 ? ? disulf10 disulf ? ? B CYS 1 SG ? ? ? 1_555 B CYS 64 SG ? ? B CYS 315 B CYS 378 1_555 ? ? ? ? ? ? ? 2.028 ? ? disulf11 disulf ? ? B CYS 30 SG ? ? ? 1_555 B CYS 95 SG ? ? B CYS 344 B CYS 409 1_555 ? ? ? ? ? ? ? 2.065 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 5 ? CYS A 38 ? CYS A 51 ? 1_555 CYS A 84 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 5 ? CYS A 92 ? CYS A 51 ? 1_555 CYS A 138 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 5 ? CYS A 97 ? CYS A 51 ? 1_555 CYS A 143 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 8 ? CYS A 25 ? CYS A 54 ? 1_555 CYS A 71 ? 1_555 SG SG . . . None 'Disulfide bridge' 5 CYS A 15 ? CYS A 21 ? CYS A 61 ? 1_555 CYS A 67 ? 1_555 SG SG . . . None 'Disulfide bridge' 6 CYS A 31 ? CYS A 55 ? CYS A 77 ? 1_555 CYS A 101 ? 1_555 SG SG . . . None 'Disulfide bridge' 7 CYS A 38 ? CYS A 92 ? CYS A 84 ? 1_555 CYS A 138 ? 1_555 SG SG . . . None 'Disulfide bridge' 8 CYS A 75 ? CYS A 90 ? CYS A 121 ? 1_555 CYS A 136 ? 1_555 SG SG . . . None 'Disulfide bridge' 9 CYS A 92 ? CYS A 97 ? CYS A 138 ? 1_555 CYS A 143 ? 1_555 SG SG . . . None 'Disulfide bridge' 10 CYS B 1 ? CYS B 64 ? CYS B 315 ? 1_555 CYS B 378 ? 1_555 SG SG . . . None 'Disulfide bridge' 11 CYS B 30 ? CYS B 95 ? CYS B 344 ? 1_555 CYS B 409 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 21 _struct_mon_prot_cis.label_asym_id B _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 335 _struct_mon_prot_cis.auth_asym_id B _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 22 _struct_mon_prot_cis.pdbx_label_asym_id_2 B _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 336 _struct_mon_prot_cis.pdbx_auth_asym_id_2 B _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 2.14 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 2 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ASP A 9 ? PHE A 12 ? ASP A 55 PHE A 58 AA1 2 THR A 50 ? HIS A 56 ? THR A 96 HIS A 102 AA1 3 VAL A 37 ? ARG A 43 ? VAL A 83 ARG A 89 AA1 4 PHE A 88 ? CYS A 92 ? PHE A 134 CYS A 138 AA1 5 LYS A 78 ? GLU A 79 ? LYS A 124 GLU A 125 AA2 1 SER A 20 ? MET A 22 ? SER A 66 MET A 68 AA2 2 ASN A 100 ? ILE A 102 ? ASN A 146 ILE A 148 AA3 1 VAL B 65 ? SER B 66 ? VAL B 379 SER B 380 AA3 2 CYS B 95 ? LYS B 96 ? CYS B 409 LYS B 410 AA4 1 LEU B 69 ? TYR B 77 ? LEU B 383 TYR B 391 AA4 2 PRO B 82 ? VAL B 92 ? PRO B 396 VAL B 406 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 11 ? N ARG A 57 O LEU A 51 ? O LEU A 97 AA1 2 3 O HIS A 56 ? O HIS A 102 N VAL A 37 ? N VAL A 83 AA1 3 4 N CYS A 38 ? N CYS A 84 O CYS A 92 ? O CYS A 138 AA1 4 5 O MET A 89 ? O MET A 135 N LYS A 78 ? N LYS A 124 AA2 1 2 N CYS A 21 ? N CYS A 67 O ILE A 101 ? O ILE A 147 AA3 1 2 N VAL B 65 ? N VAL B 379 O LYS B 96 ? O LYS B 410 AA4 1 2 N LEU B 72 ? N LEU B 386 O LEU B 87 ? O LEU B 401 # _pdbx_entry_details.entry_id 5TY4 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 SG A CYS 84 ? ? SG A CYS 143 ? ? 1.09 2 1 NE2 A GLN 49 ? ? O A SER 139 ? ? 2.16 3 1 O A LEU 50 ? ? N A GLU 142 ? ? 2.19 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CB _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 CYS _pdbx_validate_rmsd_bond.auth_seq_id_1 51 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 SG _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 CYS _pdbx_validate_rmsd_bond.auth_seq_id_2 51 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.948 _pdbx_validate_rmsd_bond.bond_target_value 1.818 _pdbx_validate_rmsd_bond.bond_deviation 0.130 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.017 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A CYS 84 ? ? CB A CYS 84 ? ? SG A CYS 84 ? ? 121.97 114.20 7.77 1.10 N 2 1 CA B CYS 409 ? ? CB B CYS 409 ? ? SG B CYS 409 ? ? 121.45 114.20 7.25 1.10 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 55 ? ? 61.21 -152.26 2 1 ASP A 62 ? ? -148.27 -113.88 3 1 ASP A 115 ? ? -92.31 35.31 4 1 CYS A 143 ? ? -20.18 -73.40 5 1 ASN A 144 ? ? -79.52 30.65 6 1 PHE B 324 ? ? -22.81 -55.97 7 1 ASP B 327 ? ? -125.92 -65.99 8 1 ASN B 342 ? ? 84.68 157.59 9 1 GLN B 381 ? ? -93.02 -61.39 10 1 LYS B 407 ? ? -131.54 -85.11 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 LEU _pdbx_validate_peptide_omega.auth_asym_id_1 B _pdbx_validate_peptide_omega.auth_seq_id_1 317 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 ARG _pdbx_validate_peptide_omega.auth_asym_id_2 B _pdbx_validate_peptide_omega.auth_seq_id_2 318 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -139.38 # _em_3d_fitting.entry_id 5TY4 _em_3d_fitting.id 1 _em_3d_fitting.details ? _em_3d_fitting.overall_b_value ? _em_3d_fitting.ref_protocol OTHER _em_3d_fitting.ref_space RECIPROCAL _em_3d_fitting.target_criteria ? _em_3d_fitting.method ? # _em_3d_reconstruction.entry_id 5TY4 _em_3d_reconstruction.id 1 _em_3d_reconstruction.algorithm ? _em_3d_reconstruction.details ? _em_3d_reconstruction.refinement_type ? _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.num_class_averages ? _em_3d_reconstruction.num_particles ? _em_3d_reconstruction.resolution 2.90 _em_3d_reconstruction.resolution_method 'DIFFRACTION PATTERN/LAYERLINES' _em_3d_reconstruction.symmetry_type '3D CRYSTAL' _em_3d_reconstruction.method ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.magnification_calibration ? # _em_buffer.id 1 _em_buffer.details ? _em_buffer.pH 7.5 _em_buffer.specimen_id 1 _em_buffer.name ? # _em_entity_assembly.id 1 _em_entity_assembly.parent_id 0 _em_entity_assembly.details ? _em_entity_assembly.name 'Complex between monomeric TGF-b and its receptor, TbRII' _em_entity_assembly.source NATURAL _em_entity_assembly.type COMPLEX _em_entity_assembly.entity_id_list '1, 2' _em_entity_assembly.synonym ? _em_entity_assembly.oligomeric_details ? # _em_image_scans.entry_id 5TY4 _em_image_scans.id 1 _em_image_scans.dimension_height 2048 _em_image_scans.dimension_width 2048 _em_image_scans.frames_per_image ? _em_image_scans.image_recording_id 1 _em_image_scans.sampling_size 0.0311999992 _em_image_scans.scanner_model ? _em_image_scans.used_frames_per_image ? _em_image_scans.citation_id ? _em_image_scans.number_digital_images ? _em_image_scans.od_range ? _em_image_scans.quant_bit_size ? _em_image_scans.details ? # _em_imaging.id 1 _em_imaging.entry_id 5TY4 _em_imaging.accelerating_voltage 200 _em_imaging.alignment_procedure ? _em_imaging.c2_aperture_diameter ? _em_imaging.calibrated_defocus_max ? _em_imaging.calibrated_defocus_min ? _em_imaging.calibrated_magnification ? _em_imaging.cryogen NITROGEN _em_imaging.details ? _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.illumination_mode 'FLOOD BEAM' _em_imaging.microscope_model 'FEI TECNAI F20' _em_imaging.mode DIFFRACTION _em_imaging.nominal_cs ? _em_imaging.nominal_defocus_max ? _em_imaging.nominal_defocus_min ? _em_imaging.nominal_magnification ? _em_imaging.recording_temperature_maximum ? _em_imaging.recording_temperature_minimum ? _em_imaging.residual_tilt ? _em_imaging.specimen_holder_model ? _em_imaging.specimen_id 1 _em_imaging.citation_id ? _em_imaging.date ? _em_imaging.temperature ? _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.astigmatism ? _em_imaging.detector_distance ? _em_imaging.electron_beam_tilt_params ? _em_imaging.specimen_holder_type ? # _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.chamber_temperature ? _em_vitrification.cryogen_name ETHANE _em_vitrification.details ? _em_vitrification.humidity ? _em_vitrification.instrument ? _em_vitrification.entry_id 5TY4 _em_vitrification.citation_id ? _em_vitrification.method ? _em_vitrification.temp ? _em_vitrification.time_resolved_state ? # _em_experiment.entry_id 5TY4 _em_experiment.id 1 _em_experiment.aggregation_state '3D ARRAY' _em_experiment.reconstruction_method CRYSTALLOGRAPHY _em_experiment.entity_assembly_id 1 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASP 92 ? A ASP 46 2 1 Y 1 A GLU 93 ? A GLU 47 3 1 Y 1 B ALA 345 ? B ALA 31 4 1 Y 1 B GLY 346 ? B GLY 32 5 1 Y 1 B ALA 347 ? B ALA 33 6 1 Y 1 B CYS 348 ? B CYS 34 7 1 Y 1 B PRO 349 ? B PRO 35 8 1 Y 1 B TYR 350 ? B TYR 36 9 1 Y 1 B LEU 351 ? B LEU 37 10 1 Y 1 B TRP 352 ? B TRP 38 11 1 Y 1 B SER 353 ? B SER 39 12 1 Y 1 B SER 354 ? B SER 40 13 1 Y 1 B ASP 355 ? B ASP 41 14 1 Y 1 B THR 356 ? B THR 42 15 1 Y 1 B GLN 357 ? B GLN 43 16 1 Y 1 B HIS 358 ? B HIS 44 17 1 Y 1 B SER 359 ? B SER 45 18 1 Y 1 B ARG 360 ? B ARG 46 19 1 Y 1 B VAL 361 ? B VAL 47 20 1 Y 1 B LEU 362 ? B LEU 48 21 1 Y 1 B SER 363 ? B SER 49 22 1 Y 1 B LEU 364 ? B LEU 50 23 1 Y 1 B TYR 365 ? B TYR 51 24 1 Y 1 B ASN 366 ? B ASN 52 25 1 Y 1 B THR 367 ? B THR 53 26 1 Y 1 B ILE 368 ? B ILE 54 27 1 Y 1 B ASN 369 ? B ASN 55 28 1 Y 1 B PRO 370 ? B PRO 56 29 1 Y 1 B GLU 371 ? B GLU 57 30 1 Y 1 B ALA 372 ? B ALA 58 31 1 Y 1 B SER 373 ? B SER 59 32 1 Y 1 B ALA 374 ? B ALA 60 33 1 Y 1 B SER 375 ? B SER 61 34 1 Y 1 B PRO 376 ? B PRO 62 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _em_3d_crystal_entity.id 1 _em_3d_crystal_entity.image_processing_id 1 _em_3d_crystal_entity.angle_alpha 90 _em_3d_crystal_entity.angle_beta 90 _em_3d_crystal_entity.angle_gamma 90 _em_3d_crystal_entity.length_a 41.5298 _em_3d_crystal_entity.length_b 71.3297 _em_3d_crystal_entity.length_c 79.5082 _em_3d_crystal_entity.space_group_name 'P 21 21 21' _em_3d_crystal_entity.space_group_num 19 # _em_admin.entry_id 5TY4 _em_admin.current_status REL _em_admin.deposition_date 2016-11-18 _em_admin.deposition_site RCSB _em_admin.last_update 2024-11-06 _em_admin.map_release_date 2016-06-22 _em_admin.title 'MicroED structure of a complex between monomeric TGF-b and its receptor, TbRII, at 2.9 A resolution' # _em_buffer_component.buffer_id 1 _em_buffer_component.id 1 _em_buffer_component.concentration 100 _em_buffer_component.concentration_units mM _em_buffer_component.formula ? _em_buffer_component.name HEPES # _em_ctf_correction.id 1 _em_ctf_correction.em_image_processing_id 1 _em_ctf_correction.type NONE _em_ctf_correction.details ? # _em_diffraction.id 1 _em_diffraction.camera_length 2000 _em_diffraction.imaging_id 1 _em_diffraction.tilt_angle_list ? # _em_diffraction_shell.id 1 _em_diffraction_shell.em_diffraction_stats_id 1 _em_diffraction_shell.fourier_space_coverage 69.1 _em_diffraction_shell.high_resolution 2.90 _em_diffraction_shell.low_resolution 3.65 _em_diffraction_shell.multiplicity 3.9 _em_diffraction_shell.num_structure_factors 1884 _em_diffraction_shell.phase_residual 46.4 # _em_diffraction_stats.id 1 _em_diffraction_stats.details ? _em_diffraction_stats.image_processing_id 1 _em_diffraction_stats.fourier_space_coverage 71.9 _em_diffraction_stats.high_resolution 2.90 _em_diffraction_stats.num_intensities_measured 14911 _em_diffraction_stats.num_structure_factors 3884 _em_diffraction_stats.overall_phase_error 30.99 _em_diffraction_stats.overall_phase_residual 43.53 _em_diffraction_stats.phase_error_rejection_criteria 0 _em_diffraction_stats.r_merge 0.293 _em_diffraction_stats.r_sym 0.293 # _em_entity_assembly_molwt.entity_assembly_id 1 _em_entity_assembly_molwt.id 1 _em_entity_assembly_molwt.experimental_flag NO _em_entity_assembly_molwt.units MEGADALTONS _em_entity_assembly_molwt.value 0.019072 # _em_entity_assembly_naturalsource.id 1 _em_entity_assembly_naturalsource.entity_assembly_id 1 _em_entity_assembly_naturalsource.cell ? _em_entity_assembly_naturalsource.cellular_location ? _em_entity_assembly_naturalsource.ncbi_tax_id 9606 _em_entity_assembly_naturalsource.organ ? _em_entity_assembly_naturalsource.organelle ? _em_entity_assembly_naturalsource.organism 'Homo sapiens' _em_entity_assembly_naturalsource.strain ? _em_entity_assembly_naturalsource.tissue ? # _em_image_processing.id 1 _em_image_processing.image_recording_id 1 _em_image_processing.details ? # _em_image_recording.id 1 _em_image_recording.imaging_id 1 _em_image_recording.avg_electron_dose_per_image 0.004 _em_image_recording.average_exposure_time 4.1 _em_image_recording.details ? _em_image_recording.detector_mode ? _em_image_recording.film_or_detector_model 'TVIPS TEMCAM-F416 (4k x 4k)' _em_image_recording.num_diffraction_images 353 _em_image_recording.num_grids_imaged 2 _em_image_recording.num_real_images 353 # loop_ _em_software.id _em_software.category _em_software.details _em_software.name _em_software.version _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id 1 'IMAGE ACQUISITION' ? EM-Menu 4.0.9.75 ? ? 1 2 MASKING ? ? ? ? ? ? 3 'CTF CORRECTION' ? ? ? 1 ? ? 4 'LAYERLINE INDEXING' ? ? ? ? ? ? 5 'DIFFRACTION INDEXING' ? iMosflm/MOSFLM 7.2.1 ? ? ? 6 'MODEL FITTING' ? Phaser 2.6.0 ? 1 ? 7 OTHER phasing MOLREP 11.4.05 ? ? ? 8 'MODEL REFINEMENT' ? PHENIX 1.10 ? 1 ? 9 'MOLECULAR REPLACEMENT' ? Phaser 2.6.0 1 ? ? 10 'LATTICE DISTORTION CORRECTION' ? ? ? 1 ? ? 11 'SYMMETRY DETERMINATION' ? POINTLESS 1.10.26 1 ? ? 12 'CRYSTALLOGRAPHY MERGING' ? AIMLESS 0.5.27 1 ? ? 13 RECONSTRUCTION ? ? ? 1 ? ? # _em_specimen.id 1 _em_specimen.experiment_id 1 _em_specimen.concentration ? _em_specimen.details ? _em_specimen.embedding_applied NO _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1KTZ _pdbx_initial_refinement_model.details 'PDB entry 1KTZ' # _pdbx_related_exp_data_set.ordinal 1 _pdbx_related_exp_data_set.data_reference 10.15785/SBGRID/368 _pdbx_related_exp_data_set.metadata_reference ? _pdbx_related_exp_data_set.data_set_type 'diffraction image data' _pdbx_related_exp_data_set.details ? # _atom_sites.entry_id 5TY4 _atom_sites.fract_transf_matrix[1][1] 0.024079 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014019 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012577 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_