data_5U1Y # _entry.id 5U1Y # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.389 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5U1Y pdb_00005u1y 10.2210/pdb5u1y/pdb WWPDB D_1000225175 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-01-04 2 'Structure model' 1 1 2017-09-20 3 'Structure model' 1 2 2019-12-18 4 'Structure model' 1 3 2020-07-29 5 'Structure model' 1 4 2024-04-03 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 4 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 2 'Structure model' 'Refinement description' 3 3 'Structure model' 'Author supporting evidence' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Structure summary' 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Database references' 9 5 'Structure model' 'Refinement description' 10 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 2 'Structure model' software 3 3 'Structure model' pdbx_audit_support 4 4 'Structure model' chem_comp 5 4 'Structure model' entity 6 4 'Structure model' pdbx_chem_comp_identifier 7 4 'Structure model' pdbx_entity_nonpoly 8 4 'Structure model' struct_conn 9 4 'Structure model' struct_site 10 4 'Structure model' struct_site_gen 11 5 'Structure model' chem_comp 12 5 'Structure model' chem_comp_atom 13 5 'Structure model' chem_comp_bond 14 5 'Structure model' database_2 15 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 3 'Structure model' '_pdbx_audit_support.funding_organization' 3 4 'Structure model' '_chem_comp.name' 4 4 'Structure model' '_chem_comp.type' 5 4 'Structure model' '_entity.pdbx_description' 6 4 'Structure model' '_pdbx_entity_nonpoly.name' 7 4 'Structure model' '_struct_conn.pdbx_role' 8 5 'Structure model' '_chem_comp.pdbx_synonyms' 9 5 'Structure model' '_database_2.pdbx_DOI' 10 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5U1Y _pdbx_database_status.recvd_initial_deposition_date 2016-11-29 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 5U1L PDB . unspecified 5U1U PDB . unspecified 5U1V PDB . unspecified 5U1W PDB . unspecified 5U1X PDB . unspecified 5U2H PDB . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Karasawa, A.' 1 'Kawate, T.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Elife _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2050-084X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 5 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structural basis for subtype-specific inhibition of the P2X7 receptor.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.7554/eLife.22153 _citation.pdbx_database_id_PubMed 27935479 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Karasawa, A.' 1 ? primary 'Kawate, T.' 2 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'P2X purinoceptor' 38716.234 1 ? ? ? 'Both the N- and C-termini are disordered and the electron density was not well-defined.' 2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208 3 ? ? ? ? 3 non-polymer syn 'N~2~-(3,4-difluorophenyl)-N-{2-methyl-5-[(piperazin-1-yl)methyl]phenyl}glycinamide' 374.428 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSTNYGTIKWIFHALVFSYISFALISDKRYQKKEPLISSVHTKVKGIAEVKAEILENGMKKMVSGVFDTADYTFPLQGN SFFVMTNFIKTEGQQQGLCPDFPTARTICSSDRGCKKGRMDPQSKGIQTGRCVVYKERLKTCEVSAWCPIEEVKDAPRPA LLNSAENFTVLIKNNIDFPGHNYTTRNILPGVNITCTFHKTQNPQCPIFRLGDIFQETGDSFSDVAIQGGIMGIEIYWDC NLDGWFHHCRPKYSFRRLDDKTTSESLYPGYNFRYAKYYKENNVEKRTLIKVFGIRFDILVFGTGGKFNVIQLAVYIGSV ISYFGLATVFIDILINTYSASS ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSTNYGTIKWIFHALVFSYISFALISDKRYQKKEPLISSVHTKVKGIAEVKAEILENGMKKMVSGVFDTADYTFPLQGN SFFVMTNFIKTEGQQQGLCPDFPTARTICSSDRGCKKGRMDPQSKGIQTGRCVVYKERLKTCEVSAWCPIEEVKDAPRPA LLNSAENFTVLIKNNIDFPGHNYTTRNILPGVNITCTFHKTQNPQCPIFRLGDIFQETGDSFSDVAIQGGIMGIEIYWDC NLDGWFHHCRPKYSFRRLDDKTTSESLYPGYNFRYAKYYKENNVEKRTLIKVFGIRFDILVFGTGGKFNVIQLAVYIGSV ISYFGLATVFIDILINTYSASS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 3 'N~2~-(3,4-difluorophenyl)-N-{2-methyl-5-[(piperazin-1-yl)methyl]phenyl}glycinamide' 7RS # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 THR n 1 5 ASN n 1 6 TYR n 1 7 GLY n 1 8 THR n 1 9 ILE n 1 10 LYS n 1 11 TRP n 1 12 ILE n 1 13 PHE n 1 14 HIS n 1 15 ALA n 1 16 LEU n 1 17 VAL n 1 18 PHE n 1 19 SER n 1 20 TYR n 1 21 ILE n 1 22 SER n 1 23 PHE n 1 24 ALA n 1 25 LEU n 1 26 ILE n 1 27 SER n 1 28 ASP n 1 29 LYS n 1 30 ARG n 1 31 TYR n 1 32 GLN n 1 33 LYS n 1 34 LYS n 1 35 GLU n 1 36 PRO n 1 37 LEU n 1 38 ILE n 1 39 SER n 1 40 SER n 1 41 VAL n 1 42 HIS n 1 43 THR n 1 44 LYS n 1 45 VAL n 1 46 LYS n 1 47 GLY n 1 48 ILE n 1 49 ALA n 1 50 GLU n 1 51 VAL n 1 52 LYS n 1 53 ALA n 1 54 GLU n 1 55 ILE n 1 56 LEU n 1 57 GLU n 1 58 ASN n 1 59 GLY n 1 60 MET n 1 61 LYS n 1 62 LYS n 1 63 MET n 1 64 VAL n 1 65 SER n 1 66 GLY n 1 67 VAL n 1 68 PHE n 1 69 ASP n 1 70 THR n 1 71 ALA n 1 72 ASP n 1 73 TYR n 1 74 THR n 1 75 PHE n 1 76 PRO n 1 77 LEU n 1 78 GLN n 1 79 GLY n 1 80 ASN n 1 81 SER n 1 82 PHE n 1 83 PHE n 1 84 VAL n 1 85 MET n 1 86 THR n 1 87 ASN n 1 88 PHE n 1 89 ILE n 1 90 LYS n 1 91 THR n 1 92 GLU n 1 93 GLY n 1 94 GLN n 1 95 GLN n 1 96 GLN n 1 97 GLY n 1 98 LEU n 1 99 CYS n 1 100 PRO n 1 101 ASP n 1 102 PHE n 1 103 PRO n 1 104 THR n 1 105 ALA n 1 106 ARG n 1 107 THR n 1 108 ILE n 1 109 CYS n 1 110 SER n 1 111 SER n 1 112 ASP n 1 113 ARG n 1 114 GLY n 1 115 CYS n 1 116 LYS n 1 117 LYS n 1 118 GLY n 1 119 ARG n 1 120 MET n 1 121 ASP n 1 122 PRO n 1 123 GLN n 1 124 SER n 1 125 LYS n 1 126 GLY n 1 127 ILE n 1 128 GLN n 1 129 THR n 1 130 GLY n 1 131 ARG n 1 132 CYS n 1 133 VAL n 1 134 VAL n 1 135 TYR n 1 136 LYS n 1 137 GLU n 1 138 ARG n 1 139 LEU n 1 140 LYS n 1 141 THR n 1 142 CYS n 1 143 GLU n 1 144 VAL n 1 145 SER n 1 146 ALA n 1 147 TRP n 1 148 CYS n 1 149 PRO n 1 150 ILE n 1 151 GLU n 1 152 GLU n 1 153 VAL n 1 154 LYS n 1 155 ASP n 1 156 ALA n 1 157 PRO n 1 158 ARG n 1 159 PRO n 1 160 ALA n 1 161 LEU n 1 162 LEU n 1 163 ASN n 1 164 SER n 1 165 ALA n 1 166 GLU n 1 167 ASN n 1 168 PHE n 1 169 THR n 1 170 VAL n 1 171 LEU n 1 172 ILE n 1 173 LYS n 1 174 ASN n 1 175 ASN n 1 176 ILE n 1 177 ASP n 1 178 PHE n 1 179 PRO n 1 180 GLY n 1 181 HIS n 1 182 ASN n 1 183 TYR n 1 184 THR n 1 185 THR n 1 186 ARG n 1 187 ASN n 1 188 ILE n 1 189 LEU n 1 190 PRO n 1 191 GLY n 1 192 VAL n 1 193 ASN n 1 194 ILE n 1 195 THR n 1 196 CYS n 1 197 THR n 1 198 PHE n 1 199 HIS n 1 200 LYS n 1 201 THR n 1 202 GLN n 1 203 ASN n 1 204 PRO n 1 205 GLN n 1 206 CYS n 1 207 PRO n 1 208 ILE n 1 209 PHE n 1 210 ARG n 1 211 LEU n 1 212 GLY n 1 213 ASP n 1 214 ILE n 1 215 PHE n 1 216 GLN n 1 217 GLU n 1 218 THR n 1 219 GLY n 1 220 ASP n 1 221 SER n 1 222 PHE n 1 223 SER n 1 224 ASP n 1 225 VAL n 1 226 ALA n 1 227 ILE n 1 228 GLN n 1 229 GLY n 1 230 GLY n 1 231 ILE n 1 232 MET n 1 233 GLY n 1 234 ILE n 1 235 GLU n 1 236 ILE n 1 237 TYR n 1 238 TRP n 1 239 ASP n 1 240 CYS n 1 241 ASN n 1 242 LEU n 1 243 ASP n 1 244 GLY n 1 245 TRP n 1 246 PHE n 1 247 HIS n 1 248 HIS n 1 249 CYS n 1 250 ARG n 1 251 PRO n 1 252 LYS n 1 253 TYR n 1 254 SER n 1 255 PHE n 1 256 ARG n 1 257 ARG n 1 258 LEU n 1 259 ASP n 1 260 ASP n 1 261 LYS n 1 262 THR n 1 263 THR n 1 264 SER n 1 265 GLU n 1 266 SER n 1 267 LEU n 1 268 TYR n 1 269 PRO n 1 270 GLY n 1 271 TYR n 1 272 ASN n 1 273 PHE n 1 274 ARG n 1 275 TYR n 1 276 ALA n 1 277 LYS n 1 278 TYR n 1 279 TYR n 1 280 LYS n 1 281 GLU n 1 282 ASN n 1 283 ASN n 1 284 VAL n 1 285 GLU n 1 286 LYS n 1 287 ARG n 1 288 THR n 1 289 LEU n 1 290 ILE n 1 291 LYS n 1 292 VAL n 1 293 PHE n 1 294 GLY n 1 295 ILE n 1 296 ARG n 1 297 PHE n 1 298 ASP n 1 299 ILE n 1 300 LEU n 1 301 VAL n 1 302 PHE n 1 303 GLY n 1 304 THR n 1 305 GLY n 1 306 GLY n 1 307 LYS n 1 308 PHE n 1 309 ASN n 1 310 VAL n 1 311 ILE n 1 312 GLN n 1 313 LEU n 1 314 ALA n 1 315 VAL n 1 316 TYR n 1 317 ILE n 1 318 GLY n 1 319 SER n 1 320 VAL n 1 321 ILE n 1 322 SER n 1 323 TYR n 1 324 PHE n 1 325 GLY n 1 326 LEU n 1 327 ALA n 1 328 THR n 1 329 VAL n 1 330 PHE n 1 331 ILE n 1 332 ASP n 1 333 ILE n 1 334 LEU n 1 335 ILE n 1 336 ASN n 1 337 THR n 1 338 TYR n 1 339 SER n 1 340 ALA n 1 341 SER n 1 342 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 342 _entity_src_gen.gene_src_common_name 'Giant panda' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene P2RX7 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Ailuropoda melanoleuca' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9646 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 7RS non-polymer . 'N~2~-(3,4-difluorophenyl)-N-{2-methyl-5-[(piperazin-1-yl)methyl]phenyl}glycinamide' 'antagonist GW791343' 'C20 H24 F2 N4 O' 374.428 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE ; 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 21 ? ? ? A . n A 1 2 SER 2 22 ? ? ? A . n A 1 3 SER 3 23 ? ? ? A . n A 1 4 THR 4 24 ? ? ? A . n A 1 5 ASN 5 25 ? ? ? A . n A 1 6 TYR 6 26 ? ? ? A . n A 1 7 GLY 7 27 ? ? ? A . n A 1 8 THR 8 28 ? ? ? A . n A 1 9 ILE 9 29 ? ? ? A . n A 1 10 LYS 10 30 ? ? ? A . n A 1 11 TRP 11 31 ? ? ? A . n A 1 12 ILE 12 32 ? ? ? A . n A 1 13 PHE 13 33 ? ? ? A . n A 1 14 HIS 14 34 34 HIS HIS A . n A 1 15 ALA 15 35 35 ALA ALA A . n A 1 16 LEU 16 36 36 LEU LEU A . n A 1 17 VAL 17 37 37 VAL VAL A . n A 1 18 PHE 18 38 38 PHE PHE A . n A 1 19 SER 19 39 39 SER SER A . n A 1 20 TYR 20 40 40 TYR TYR A . n A 1 21 ILE 21 41 41 ILE ILE A . n A 1 22 SER 22 42 42 SER SER A . n A 1 23 PHE 23 43 43 PHE PHE A . n A 1 24 ALA 24 44 44 ALA ALA A . n A 1 25 LEU 25 45 45 LEU LEU A . n A 1 26 ILE 26 46 46 ILE ILE A . n A 1 27 SER 27 47 47 SER SER A . n A 1 28 ASP 28 48 48 ASP ASP A . n A 1 29 LYS 29 49 49 LYS LYS A . n A 1 30 ARG 30 50 50 ARG ARG A . n A 1 31 TYR 31 51 51 TYR TYR A . n A 1 32 GLN 32 52 52 GLN GLN A . n A 1 33 LYS 33 53 53 LYS LYS A . n A 1 34 LYS 34 54 54 LYS LYS A . n A 1 35 GLU 35 55 55 GLU GLU A . n A 1 36 PRO 36 56 56 PRO PRO A . n A 1 37 LEU 37 57 57 LEU LEU A . n A 1 38 ILE 38 58 58 ILE ILE A . n A 1 39 SER 39 59 59 SER SER A . n A 1 40 SER 40 60 60 SER SER A . n A 1 41 VAL 41 61 61 VAL VAL A . n A 1 42 HIS 42 62 62 HIS HIS A . n A 1 43 THR 43 63 63 THR THR A . n A 1 44 LYS 44 64 64 LYS LYS A . n A 1 45 VAL 45 65 65 VAL VAL A . n A 1 46 LYS 46 66 66 LYS LYS A . n A 1 47 GLY 47 67 67 GLY GLY A . n A 1 48 ILE 48 68 68 ILE ILE A . n A 1 49 ALA 49 69 69 ALA ALA A . n A 1 50 GLU 50 70 70 GLU GLU A . n A 1 51 VAL 51 71 71 VAL VAL A . n A 1 52 LYS 52 72 72 LYS LYS A . n A 1 53 ALA 53 73 73 ALA ALA A . n A 1 54 GLU 54 74 74 GLU GLU A . n A 1 55 ILE 55 75 75 ILE ILE A . n A 1 56 LEU 56 76 76 LEU LEU A . n A 1 57 GLU 57 77 77 GLU GLU A . n A 1 58 ASN 58 78 78 ASN ASN A . n A 1 59 GLY 59 79 79 GLY GLY A . n A 1 60 MET 60 80 80 MET MET A . n A 1 61 LYS 61 81 81 LYS LYS A . n A 1 62 LYS 62 82 82 LYS LYS A . n A 1 63 MET 63 83 83 MET MET A . n A 1 64 VAL 64 84 84 VAL VAL A . n A 1 65 SER 65 85 85 SER SER A . n A 1 66 GLY 66 86 86 GLY GLY A . n A 1 67 VAL 67 87 87 VAL VAL A . n A 1 68 PHE 68 88 88 PHE PHE A . n A 1 69 ASP 69 89 89 ASP ASP A . n A 1 70 THR 70 90 90 THR THR A . n A 1 71 ALA 71 91 91 ALA ALA A . n A 1 72 ASP 72 92 92 ASP ASP A . n A 1 73 TYR 73 93 93 TYR TYR A . n A 1 74 THR 74 94 94 THR THR A . n A 1 75 PHE 75 95 95 PHE PHE A . n A 1 76 PRO 76 96 96 PRO PRO A . n A 1 77 LEU 77 97 97 LEU LEU A . n A 1 78 GLN 78 98 98 GLN GLN A . n A 1 79 GLY 79 99 99 GLY GLY A . n A 1 80 ASN 80 100 100 ASN ASN A . n A 1 81 SER 81 101 101 SER SER A . n A 1 82 PHE 82 102 102 PHE PHE A . n A 1 83 PHE 83 103 103 PHE PHE A . n A 1 84 VAL 84 104 104 VAL VAL A . n A 1 85 MET 85 105 105 MET MET A . n A 1 86 THR 86 106 106 THR THR A . n A 1 87 ASN 87 107 107 ASN ASN A . n A 1 88 PHE 88 108 108 PHE PHE A . n A 1 89 ILE 89 109 109 ILE ILE A . n A 1 90 LYS 90 110 110 LYS LYS A . n A 1 91 THR 91 111 111 THR THR A . n A 1 92 GLU 92 112 112 GLU GLU A . n A 1 93 GLY 93 113 113 GLY GLY A . n A 1 94 GLN 94 114 114 GLN GLN A . n A 1 95 GLN 95 115 115 GLN GLN A . n A 1 96 GLN 96 116 116 GLN GLN A . n A 1 97 GLY 97 117 117 GLY GLY A . n A 1 98 LEU 98 118 118 LEU LEU A . n A 1 99 CYS 99 119 119 CYS CYS A . n A 1 100 PRO 100 120 120 PRO PRO A . n A 1 101 ASP 101 121 121 ASP ASP A . n A 1 102 PHE 102 122 122 PHE PHE A . n A 1 103 PRO 103 123 123 PRO PRO A . n A 1 104 THR 104 124 124 THR THR A . n A 1 105 ALA 105 125 125 ALA ALA A . n A 1 106 ARG 106 126 126 ARG ARG A . n A 1 107 THR 107 127 127 THR THR A . n A 1 108 ILE 108 128 128 ILE ILE A . n A 1 109 CYS 109 129 129 CYS CYS A . n A 1 110 SER 110 130 130 SER SER A . n A 1 111 SER 111 131 131 SER SER A . n A 1 112 ASP 112 132 132 ASP ASP A . n A 1 113 ARG 113 133 133 ARG ARG A . n A 1 114 GLY 114 134 134 GLY GLY A . n A 1 115 CYS 115 135 135 CYS CYS A . n A 1 116 LYS 116 136 136 LYS LYS A . n A 1 117 LYS 117 137 137 LYS LYS A . n A 1 118 GLY 118 138 138 GLY GLY A . n A 1 119 ARG 119 139 139 ARG ARG A . n A 1 120 MET 120 140 140 MET MET A . n A 1 121 ASP 121 141 141 ASP ASP A . n A 1 122 PRO 122 142 142 PRO PRO A . n A 1 123 GLN 123 143 143 GLN GLN A . n A 1 124 SER 124 144 144 SER SER A . n A 1 125 LYS 125 145 145 LYS LYS A . n A 1 126 GLY 126 146 146 GLY GLY A . n A 1 127 ILE 127 147 147 ILE ILE A . n A 1 128 GLN 128 148 148 GLN GLN A . n A 1 129 THR 129 149 149 THR THR A . n A 1 130 GLY 130 150 150 GLY GLY A . n A 1 131 ARG 131 151 151 ARG ARG A . n A 1 132 CYS 132 152 152 CYS CYS A . n A 1 133 VAL 133 153 153 VAL VAL A . n A 1 134 VAL 134 154 154 VAL VAL A . n A 1 135 TYR 135 155 155 TYR TYR A . n A 1 136 LYS 136 156 156 LYS LYS A . n A 1 137 GLU 137 157 157 GLU GLU A . n A 1 138 ARG 138 158 158 ARG ARG A . n A 1 139 LEU 139 159 159 LEU LEU A . n A 1 140 LYS 140 160 160 LYS LYS A . n A 1 141 THR 141 161 161 THR THR A . n A 1 142 CYS 142 162 162 CYS CYS A . n A 1 143 GLU 143 163 163 GLU GLU A . n A 1 144 VAL 144 164 164 VAL VAL A . n A 1 145 SER 145 165 165 SER SER A . n A 1 146 ALA 146 166 166 ALA ALA A . n A 1 147 TRP 147 167 167 TRP TRP A . n A 1 148 CYS 148 168 168 CYS CYS A . n A 1 149 PRO 149 169 169 PRO PRO A . n A 1 150 ILE 150 170 170 ILE ILE A . n A 1 151 GLU 151 171 171 GLU GLU A . n A 1 152 GLU 152 172 172 GLU GLU A . n A 1 153 VAL 153 173 173 VAL VAL A . n A 1 154 LYS 154 174 174 LYS LYS A . n A 1 155 ASP 155 175 175 ASP ASP A . n A 1 156 ALA 156 176 176 ALA ALA A . n A 1 157 PRO 157 177 177 PRO PRO A . n A 1 158 ARG 158 178 178 ARG ARG A . n A 1 159 PRO 159 179 179 PRO PRO A . n A 1 160 ALA 160 180 180 ALA ALA A . n A 1 161 LEU 161 181 181 LEU LEU A . n A 1 162 LEU 162 182 182 LEU LEU A . n A 1 163 ASN 163 183 183 ASN ASN A . n A 1 164 SER 164 184 184 SER SER A . n A 1 165 ALA 165 185 185 ALA ALA A . n A 1 166 GLU 166 186 186 GLU GLU A . n A 1 167 ASN 167 187 187 ASN ASN A . n A 1 168 PHE 168 188 188 PHE PHE A . n A 1 169 THR 169 189 189 THR THR A . n A 1 170 VAL 170 190 190 VAL VAL A . n A 1 171 LEU 171 191 191 LEU LEU A . n A 1 172 ILE 172 192 192 ILE ILE A . n A 1 173 LYS 173 193 193 LYS LYS A . n A 1 174 ASN 174 194 194 ASN ASN A . n A 1 175 ASN 175 195 195 ASN ASN A . n A 1 176 ILE 176 196 196 ILE ILE A . n A 1 177 ASP 177 197 197 ASP ASP A . n A 1 178 PHE 178 198 198 PHE PHE A . n A 1 179 PRO 179 199 199 PRO PRO A . n A 1 180 GLY 180 200 200 GLY GLY A . n A 1 181 HIS 181 201 201 HIS HIS A . n A 1 182 ASN 182 202 202 ASN ASN A . n A 1 183 TYR 183 203 203 TYR TYR A . n A 1 184 THR 184 204 204 THR THR A . n A 1 185 THR 185 205 205 THR THR A . n A 1 186 ARG 186 206 206 ARG ARG A . n A 1 187 ASN 187 207 207 ASN ASN A . n A 1 188 ILE 188 208 208 ILE ILE A . n A 1 189 LEU 189 209 209 LEU LEU A . n A 1 190 PRO 190 210 210 PRO PRO A . n A 1 191 GLY 191 211 211 GLY GLY A . n A 1 192 VAL 192 212 212 VAL VAL A . n A 1 193 ASN 193 213 213 ASN ASN A . n A 1 194 ILE 194 214 214 ILE ILE A . n A 1 195 THR 195 215 215 THR THR A . n A 1 196 CYS 196 216 216 CYS CYS A . n A 1 197 THR 197 217 217 THR THR A . n A 1 198 PHE 198 218 218 PHE PHE A . n A 1 199 HIS 199 219 219 HIS HIS A . n A 1 200 LYS 200 220 220 LYS LYS A . n A 1 201 THR 201 221 221 THR THR A . n A 1 202 GLN 202 222 222 GLN GLN A . n A 1 203 ASN 203 223 223 ASN ASN A . n A 1 204 PRO 204 224 224 PRO PRO A . n A 1 205 GLN 205 225 225 GLN GLN A . n A 1 206 CYS 206 226 226 CYS CYS A . n A 1 207 PRO 207 227 227 PRO PRO A . n A 1 208 ILE 208 228 228 ILE ILE A . n A 1 209 PHE 209 229 229 PHE PHE A . n A 1 210 ARG 210 230 230 ARG ARG A . n A 1 211 LEU 211 231 231 LEU LEU A . n A 1 212 GLY 212 232 232 GLY GLY A . n A 1 213 ASP 213 233 233 ASP ASP A . n A 1 214 ILE 214 234 234 ILE ILE A . n A 1 215 PHE 215 235 235 PHE PHE A . n A 1 216 GLN 216 236 236 GLN GLN A . n A 1 217 GLU 217 237 237 GLU GLU A . n A 1 218 THR 218 238 238 THR THR A . n A 1 219 GLY 219 239 239 GLY GLY A . n A 1 220 ASP 220 240 240 ASP ASP A . n A 1 221 SER 221 241 241 SER SER A . n A 1 222 PHE 222 242 242 PHE PHE A . n A 1 223 SER 223 243 243 SER SER A . n A 1 224 ASP 224 244 244 ASP ASP A . n A 1 225 VAL 225 245 245 VAL VAL A . n A 1 226 ALA 226 246 246 ALA ALA A . n A 1 227 ILE 227 247 247 ILE ILE A . n A 1 228 GLN 228 248 248 GLN GLN A . n A 1 229 GLY 229 249 249 GLY GLY A . n A 1 230 GLY 230 250 250 GLY GLY A . n A 1 231 ILE 231 251 251 ILE ILE A . n A 1 232 MET 232 252 252 MET MET A . n A 1 233 GLY 233 253 253 GLY GLY A . n A 1 234 ILE 234 254 254 ILE ILE A . n A 1 235 GLU 235 255 255 GLU GLU A . n A 1 236 ILE 236 256 256 ILE ILE A . n A 1 237 TYR 237 257 257 TYR TYR A . n A 1 238 TRP 238 258 258 TRP TRP A . n A 1 239 ASP 239 259 259 ASP ASP A . n A 1 240 CYS 240 260 260 CYS CYS A . n A 1 241 ASN 241 261 261 ASN ASN A . n A 1 242 LEU 242 262 262 LEU LEU A . n A 1 243 ASP 243 263 263 ASP ASP A . n A 1 244 GLY 244 264 264 GLY GLY A . n A 1 245 TRP 245 265 265 TRP TRP A . n A 1 246 PHE 246 266 266 PHE PHE A . n A 1 247 HIS 247 267 267 HIS HIS A . n A 1 248 HIS 248 268 268 HIS HIS A . n A 1 249 CYS 249 269 269 CYS CYS A . n A 1 250 ARG 250 270 270 ARG ARG A . n A 1 251 PRO 251 271 271 PRO PRO A . n A 1 252 LYS 252 272 272 LYS LYS A . n A 1 253 TYR 253 273 273 TYR TYR A . n A 1 254 SER 254 274 274 SER SER A . n A 1 255 PHE 255 275 275 PHE PHE A . n A 1 256 ARG 256 276 276 ARG ARG A . n A 1 257 ARG 257 277 277 ARG ARG A . n A 1 258 LEU 258 278 278 LEU LEU A . n A 1 259 ASP 259 279 279 ASP ASP A . n A 1 260 ASP 260 280 280 ASP ASP A . n A 1 261 LYS 261 281 281 LYS LYS A . n A 1 262 THR 262 282 282 THR THR A . n A 1 263 THR 263 283 283 THR THR A . n A 1 264 SER 264 284 284 SER SER A . n A 1 265 GLU 265 285 285 GLU GLU A . n A 1 266 SER 266 286 286 SER SER A . n A 1 267 LEU 267 287 287 LEU LEU A . n A 1 268 TYR 268 288 288 TYR TYR A . n A 1 269 PRO 269 289 289 PRO PRO A . n A 1 270 GLY 270 290 290 GLY GLY A . n A 1 271 TYR 271 291 291 TYR TYR A . n A 1 272 ASN 272 292 292 ASN ASN A . n A 1 273 PHE 273 293 293 PHE PHE A . n A 1 274 ARG 274 294 294 ARG ARG A . n A 1 275 TYR 275 295 295 TYR TYR A . n A 1 276 ALA 276 296 296 ALA ALA A . n A 1 277 LYS 277 297 297 LYS LYS A . n A 1 278 TYR 278 298 298 TYR TYR A . n A 1 279 TYR 279 299 299 TYR TYR A . n A 1 280 LYS 280 300 300 LYS LYS A . n A 1 281 GLU 281 301 301 GLU GLU A . n A 1 282 ASN 282 302 302 ASN ASN A . n A 1 283 ASN 283 303 303 ASN ASN A . n A 1 284 VAL 284 304 304 VAL VAL A . n A 1 285 GLU 285 305 305 GLU GLU A . n A 1 286 LYS 286 306 306 LYS LYS A . n A 1 287 ARG 287 307 307 ARG ARG A . n A 1 288 THR 288 308 308 THR THR A . n A 1 289 LEU 289 309 309 LEU LEU A . n A 1 290 ILE 290 310 310 ILE ILE A . n A 1 291 LYS 291 311 311 LYS LYS A . n A 1 292 VAL 292 312 312 VAL VAL A . n A 1 293 PHE 293 313 313 PHE PHE A . n A 1 294 GLY 294 314 314 GLY GLY A . n A 1 295 ILE 295 315 315 ILE ILE A . n A 1 296 ARG 296 316 316 ARG ARG A . n A 1 297 PHE 297 317 317 PHE PHE A . n A 1 298 ASP 298 318 318 ASP ASP A . n A 1 299 ILE 299 319 319 ILE ILE A . n A 1 300 LEU 300 320 320 LEU LEU A . n A 1 301 VAL 301 321 321 VAL VAL A . n A 1 302 PHE 302 322 322 PHE PHE A . n A 1 303 GLY 303 323 323 GLY GLY A . n A 1 304 THR 304 324 324 THR THR A . n A 1 305 GLY 305 325 325 GLY GLY A . n A 1 306 GLY 306 326 326 GLY GLY A . n A 1 307 LYS 307 327 327 LYS LYS A . n A 1 308 PHE 308 328 328 PHE PHE A . n A 1 309 ASN 309 329 329 ASN ASN A . n A 1 310 VAL 310 330 330 VAL VAL A . n A 1 311 ILE 311 331 331 ILE ILE A . n A 1 312 GLN 312 332 332 GLN GLN A . n A 1 313 LEU 313 333 333 LEU LEU A . n A 1 314 ALA 314 334 334 ALA ALA A . n A 1 315 VAL 315 335 335 VAL VAL A . n A 1 316 TYR 316 336 336 TYR TYR A . n A 1 317 ILE 317 337 337 ILE ILE A . n A 1 318 GLY 318 338 338 GLY GLY A . n A 1 319 SER 319 339 339 SER SER A . n A 1 320 VAL 320 340 340 VAL VAL A . n A 1 321 ILE 321 341 341 ILE ILE A . n A 1 322 SER 322 342 342 SER SER A . n A 1 323 TYR 323 343 343 TYR TYR A . n A 1 324 PHE 324 344 344 PHE PHE A . n A 1 325 GLY 325 345 345 GLY GLY A . n A 1 326 LEU 326 346 346 LEU LEU A . n A 1 327 ALA 327 347 347 ALA ALA A . n A 1 328 THR 328 348 348 THR THR A . n A 1 329 VAL 329 349 349 VAL VAL A . n A 1 330 PHE 330 350 350 PHE PHE A . n A 1 331 ILE 331 351 ? ? ? A . n A 1 332 ASP 332 352 ? ? ? A . n A 1 333 ILE 333 353 ? ? ? A . n A 1 334 LEU 334 354 ? ? ? A . n A 1 335 ILE 335 355 ? ? ? A . n A 1 336 ASN 336 356 ? ? ? A . n A 1 337 THR 337 357 ? ? ? A . n A 1 338 TYR 338 358 ? ? ? A . n A 1 339 SER 339 359 ? ? ? A . n A 1 340 ALA 340 360 ? ? ? A . n A 1 341 SER 341 361 ? ? ? A . n A 1 342 SER 342 362 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NAG 1 401 9187 NAG NAG A . C 2 NAG 1 402 9213 NAG NAG A . D 2 NAG 1 403 9202 NAG NAG A . E 3 7RS 1 404 1 7RS LIG A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LEU 36 ? CG ? A LEU 16 CG 2 1 Y 1 A LEU 36 ? CD1 ? A LEU 16 CD1 3 1 Y 1 A LEU 36 ? CD2 ? A LEU 16 CD2 4 1 Y 1 A TYR 40 ? CG ? A TYR 20 CG 5 1 Y 1 A TYR 40 ? CD1 ? A TYR 20 CD1 6 1 Y 1 A TYR 40 ? CD2 ? A TYR 20 CD2 7 1 Y 1 A TYR 40 ? CE1 ? A TYR 20 CE1 8 1 Y 1 A TYR 40 ? CE2 ? A TYR 20 CE2 9 1 Y 1 A TYR 40 ? CZ ? A TYR 20 CZ 10 1 Y 1 A TYR 40 ? OH ? A TYR 20 OH 11 1 Y 1 A ILE 46 ? CG1 ? A ILE 26 CG1 12 1 Y 1 A ILE 46 ? CG2 ? A ILE 26 CG2 13 1 Y 1 A ILE 46 ? CD1 ? A ILE 26 CD1 14 1 Y 1 A LYS 49 ? CG ? A LYS 29 CG 15 1 Y 1 A LYS 49 ? CD ? A LYS 29 CD 16 1 Y 1 A LYS 49 ? CE ? A LYS 29 CE 17 1 Y 1 A LYS 49 ? NZ ? A LYS 29 NZ 18 1 Y 1 A LYS 53 ? CG ? A LYS 33 CG 19 1 Y 1 A LYS 53 ? CD ? A LYS 33 CD 20 1 Y 1 A LYS 53 ? CE ? A LYS 33 CE 21 1 Y 1 A LYS 53 ? NZ ? A LYS 33 NZ 22 1 Y 1 A LYS 54 ? CG ? A LYS 34 CG 23 1 Y 1 A LYS 54 ? CD ? A LYS 34 CD 24 1 Y 1 A LYS 54 ? CE ? A LYS 34 CE 25 1 Y 1 A LYS 54 ? NZ ? A LYS 34 NZ 26 1 Y 1 A LYS 64 ? CG ? A LYS 44 CG 27 1 Y 1 A LYS 64 ? CD ? A LYS 44 CD 28 1 Y 1 A LYS 64 ? CE ? A LYS 44 CE 29 1 Y 1 A LYS 64 ? NZ ? A LYS 44 NZ 30 1 Y 1 A LYS 66 ? CG ? A LYS 46 CG 31 1 Y 1 A LYS 66 ? CD ? A LYS 46 CD 32 1 Y 1 A LYS 66 ? CE ? A LYS 46 CE 33 1 Y 1 A LYS 66 ? NZ ? A LYS 46 NZ 34 1 Y 1 A LYS 72 ? CG ? A LYS 52 CG 35 1 Y 1 A LYS 72 ? CD ? A LYS 52 CD 36 1 Y 1 A LYS 72 ? CE ? A LYS 52 CE 37 1 Y 1 A LYS 72 ? NZ ? A LYS 52 NZ 38 1 Y 1 A LEU 76 ? CG ? A LEU 56 CG 39 1 Y 1 A LEU 76 ? CD1 ? A LEU 56 CD1 40 1 Y 1 A LEU 76 ? CD2 ? A LEU 56 CD2 41 1 Y 1 A MET 80 ? CG ? A MET 60 CG 42 1 Y 1 A MET 80 ? SD ? A MET 60 SD 43 1 Y 1 A MET 80 ? CE ? A MET 60 CE 44 1 Y 1 A LYS 81 ? CG ? A LYS 61 CG 45 1 Y 1 A LYS 81 ? CD ? A LYS 61 CD 46 1 Y 1 A LYS 81 ? CE ? A LYS 61 CE 47 1 Y 1 A LYS 81 ? NZ ? A LYS 61 NZ 48 1 Y 1 A LYS 82 ? CG ? A LYS 62 CG 49 1 Y 1 A LYS 82 ? CD ? A LYS 62 CD 50 1 Y 1 A LYS 82 ? CE ? A LYS 62 CE 51 1 Y 1 A LYS 82 ? NZ ? A LYS 62 NZ 52 1 Y 1 A ARG 126 ? CG ? A ARG 106 CG 53 1 Y 1 A ARG 126 ? CD ? A ARG 106 CD 54 1 Y 1 A ARG 126 ? NE ? A ARG 106 NE 55 1 Y 1 A ARG 126 ? CZ ? A ARG 106 CZ 56 1 Y 1 A ARG 126 ? NH1 ? A ARG 106 NH1 57 1 Y 1 A ARG 126 ? NH2 ? A ARG 106 NH2 58 1 Y 1 A ARG 133 ? CG ? A ARG 113 CG 59 1 Y 1 A ARG 133 ? CD ? A ARG 113 CD 60 1 Y 1 A ARG 133 ? NE ? A ARG 113 NE 61 1 Y 1 A ARG 133 ? CZ ? A ARG 113 CZ 62 1 Y 1 A ARG 133 ? NH1 ? A ARG 113 NH1 63 1 Y 1 A ARG 133 ? NH2 ? A ARG 113 NH2 64 1 Y 1 A LYS 136 ? CG ? A LYS 116 CG 65 1 Y 1 A LYS 136 ? CD ? A LYS 116 CD 66 1 Y 1 A LYS 136 ? CE ? A LYS 116 CE 67 1 Y 1 A LYS 136 ? NZ ? A LYS 116 NZ 68 1 Y 1 A LYS 137 ? CG ? A LYS 117 CG 69 1 Y 1 A LYS 137 ? CD ? A LYS 117 CD 70 1 Y 1 A LYS 137 ? CE ? A LYS 117 CE 71 1 Y 1 A LYS 137 ? NZ ? A LYS 117 NZ 72 1 Y 1 A ARG 139 ? CG ? A ARG 119 CG 73 1 Y 1 A ARG 139 ? CD ? A ARG 119 CD 74 1 Y 1 A ARG 139 ? NE ? A ARG 119 NE 75 1 Y 1 A ARG 139 ? CZ ? A ARG 119 CZ 76 1 Y 1 A ARG 139 ? NH1 ? A ARG 119 NH1 77 1 Y 1 A ARG 139 ? NH2 ? A ARG 119 NH2 78 1 Y 1 A ASP 141 ? CG ? A ASP 121 CG 79 1 Y 1 A ASP 141 ? OD1 ? A ASP 121 OD1 80 1 Y 1 A ASP 141 ? OD2 ? A ASP 121 OD2 81 1 Y 1 A GLN 143 ? CG ? A GLN 123 CG 82 1 Y 1 A GLN 143 ? CD ? A GLN 123 CD 83 1 Y 1 A GLN 143 ? OE1 ? A GLN 123 OE1 84 1 Y 1 A GLN 143 ? NE2 ? A GLN 123 NE2 85 1 Y 1 A LYS 156 ? CG ? A LYS 136 CG 86 1 Y 1 A LYS 156 ? CD ? A LYS 136 CD 87 1 Y 1 A LYS 156 ? CE ? A LYS 136 CE 88 1 Y 1 A LYS 156 ? NZ ? A LYS 136 NZ 89 1 Y 1 A ARG 178 ? CG ? A ARG 158 CG 90 1 Y 1 A ARG 178 ? CD ? A ARG 158 CD 91 1 Y 1 A ARG 178 ? NE ? A ARG 158 NE 92 1 Y 1 A ARG 178 ? CZ ? A ARG 158 CZ 93 1 Y 1 A ARG 178 ? NH1 ? A ARG 158 NH1 94 1 Y 1 A ARG 178 ? NH2 ? A ARG 158 NH2 95 1 Y 1 A LYS 193 ? CG ? A LYS 173 CG 96 1 Y 1 A LYS 193 ? CD ? A LYS 173 CD 97 1 Y 1 A LYS 193 ? CE ? A LYS 173 CE 98 1 Y 1 A LYS 193 ? NZ ? A LYS 173 NZ 99 1 Y 1 A LEU 209 ? CG ? A LEU 189 CG 100 1 Y 1 A LEU 209 ? CD1 ? A LEU 189 CD1 101 1 Y 1 A LEU 209 ? CD2 ? A LEU 189 CD2 102 1 Y 1 A ILE 214 ? CG1 ? A ILE 194 CG1 103 1 Y 1 A ILE 214 ? CG2 ? A ILE 194 CG2 104 1 Y 1 A ILE 214 ? CD1 ? A ILE 194 CD1 105 1 Y 1 A LYS 220 ? CG ? A LYS 200 CG 106 1 Y 1 A LYS 220 ? CD ? A LYS 200 CD 107 1 Y 1 A LYS 220 ? CE ? A LYS 200 CE 108 1 Y 1 A LYS 220 ? NZ ? A LYS 200 NZ 109 1 Y 1 A GLN 222 ? CG ? A GLN 202 CG 110 1 Y 1 A GLN 222 ? CD ? A GLN 202 CD 111 1 Y 1 A GLN 222 ? OE1 ? A GLN 202 OE1 112 1 Y 1 A GLN 222 ? NE2 ? A GLN 202 NE2 113 1 Y 1 A GLN 248 ? CG ? A GLN 228 CG 114 1 Y 1 A GLN 248 ? CD ? A GLN 228 CD 115 1 Y 1 A GLN 248 ? OE1 ? A GLN 228 OE1 116 1 Y 1 A GLN 248 ? NE2 ? A GLN 228 NE2 117 1 Y 1 A ASP 259 ? CG ? A ASP 239 CG 118 1 Y 1 A ASP 259 ? OD1 ? A ASP 239 OD1 119 1 Y 1 A ASP 259 ? OD2 ? A ASP 239 OD2 120 1 Y 1 A LEU 262 ? CG ? A LEU 242 CG 121 1 Y 1 A LEU 262 ? CD1 ? A LEU 242 CD1 122 1 Y 1 A LEU 262 ? CD2 ? A LEU 242 CD2 123 1 Y 1 A TRP 265 ? CG ? A TRP 245 CG 124 1 Y 1 A TRP 265 ? CD1 ? A TRP 245 CD1 125 1 Y 1 A TRP 265 ? CD2 ? A TRP 245 CD2 126 1 Y 1 A TRP 265 ? NE1 ? A TRP 245 NE1 127 1 Y 1 A TRP 265 ? CE2 ? A TRP 245 CE2 128 1 Y 1 A TRP 265 ? CE3 ? A TRP 245 CE3 129 1 Y 1 A TRP 265 ? CZ2 ? A TRP 245 CZ2 130 1 Y 1 A TRP 265 ? CZ3 ? A TRP 245 CZ3 131 1 Y 1 A TRP 265 ? CH2 ? A TRP 245 CH2 132 1 Y 1 A PHE 266 ? CG ? A PHE 246 CG 133 1 Y 1 A PHE 266 ? CD1 ? A PHE 246 CD1 134 1 Y 1 A PHE 266 ? CD2 ? A PHE 246 CD2 135 1 Y 1 A PHE 266 ? CE1 ? A PHE 246 CE1 136 1 Y 1 A PHE 266 ? CE2 ? A PHE 246 CE2 137 1 Y 1 A PHE 266 ? CZ ? A PHE 246 CZ 138 1 Y 1 A HIS 267 ? CG ? A HIS 247 CG 139 1 Y 1 A HIS 267 ? ND1 ? A HIS 247 ND1 140 1 Y 1 A HIS 267 ? CD2 ? A HIS 247 CD2 141 1 Y 1 A HIS 267 ? CE1 ? A HIS 247 CE1 142 1 Y 1 A HIS 267 ? NE2 ? A HIS 247 NE2 143 1 Y 1 A HIS 268 ? CG ? A HIS 248 CG 144 1 Y 1 A HIS 268 ? ND1 ? A HIS 248 ND1 145 1 Y 1 A HIS 268 ? CD2 ? A HIS 248 CD2 146 1 Y 1 A HIS 268 ? CE1 ? A HIS 248 CE1 147 1 Y 1 A HIS 268 ? NE2 ? A HIS 248 NE2 148 1 Y 1 A ARG 270 ? CG ? A ARG 250 CG 149 1 Y 1 A ARG 270 ? CD ? A ARG 250 CD 150 1 Y 1 A ARG 270 ? NE ? A ARG 250 NE 151 1 Y 1 A ARG 270 ? CZ ? A ARG 250 CZ 152 1 Y 1 A ARG 270 ? NH1 ? A ARG 250 NH1 153 1 Y 1 A ARG 270 ? NH2 ? A ARG 250 NH2 154 1 Y 1 A LYS 272 ? CG ? A LYS 252 CG 155 1 Y 1 A LYS 272 ? CD ? A LYS 252 CD 156 1 Y 1 A LYS 272 ? CE ? A LYS 252 CE 157 1 Y 1 A LYS 272 ? NZ ? A LYS 252 NZ 158 1 Y 1 A ASP 280 ? CG ? A ASP 260 CG 159 1 Y 1 A ASP 280 ? OD1 ? A ASP 260 OD1 160 1 Y 1 A ASP 280 ? OD2 ? A ASP 260 OD2 161 1 Y 1 A LYS 281 ? CG ? A LYS 261 CG 162 1 Y 1 A LYS 281 ? CD ? A LYS 261 CD 163 1 Y 1 A LYS 281 ? CE ? A LYS 261 CE 164 1 Y 1 A LYS 281 ? NZ ? A LYS 261 NZ 165 1 Y 1 A THR 283 ? OG1 ? A THR 263 OG1 166 1 Y 1 A THR 283 ? CG2 ? A THR 263 CG2 167 1 Y 1 A GLU 285 ? CG ? A GLU 265 CG 168 1 Y 1 A GLU 285 ? CD ? A GLU 265 CD 169 1 Y 1 A GLU 285 ? OE1 ? A GLU 265 OE1 170 1 Y 1 A GLU 285 ? OE2 ? A GLU 265 OE2 171 1 Y 1 A LEU 287 ? CG ? A LEU 267 CG 172 1 Y 1 A LEU 287 ? CD1 ? A LEU 267 CD1 173 1 Y 1 A LEU 287 ? CD2 ? A LEU 267 CD2 174 1 Y 1 A TYR 288 ? CG ? A TYR 268 CG 175 1 Y 1 A TYR 288 ? CD1 ? A TYR 268 CD1 176 1 Y 1 A TYR 288 ? CD2 ? A TYR 268 CD2 177 1 Y 1 A TYR 288 ? CE1 ? A TYR 268 CE1 178 1 Y 1 A TYR 288 ? CE2 ? A TYR 268 CE2 179 1 Y 1 A TYR 288 ? CZ ? A TYR 268 CZ 180 1 Y 1 A TYR 288 ? OH ? A TYR 268 OH 181 1 Y 1 A LYS 297 ? CG ? A LYS 277 CG 182 1 Y 1 A LYS 297 ? CD ? A LYS 277 CD 183 1 Y 1 A LYS 297 ? CE ? A LYS 277 CE 184 1 Y 1 A LYS 297 ? NZ ? A LYS 277 NZ 185 1 Y 1 A LYS 300 ? CG ? A LYS 280 CG 186 1 Y 1 A LYS 300 ? CD ? A LYS 280 CD 187 1 Y 1 A LYS 300 ? CE ? A LYS 280 CE 188 1 Y 1 A LYS 300 ? NZ ? A LYS 280 NZ 189 1 Y 1 A ASN 303 ? CG ? A ASN 283 CG 190 1 Y 1 A ASN 303 ? OD1 ? A ASN 283 OD1 191 1 Y 1 A ASN 303 ? ND2 ? A ASN 283 ND2 192 1 Y 1 A LYS 327 ? CG ? A LYS 307 CG 193 1 Y 1 A LYS 327 ? CD ? A LYS 307 CD 194 1 Y 1 A LYS 327 ? CE ? A LYS 307 CE 195 1 Y 1 A LYS 327 ? NZ ? A LYS 307 NZ 196 1 Y 1 A PHE 328 ? CG ? A PHE 308 CG 197 1 Y 1 A PHE 328 ? CD1 ? A PHE 308 CD1 198 1 Y 1 A PHE 328 ? CD2 ? A PHE 308 CD2 199 1 Y 1 A PHE 328 ? CE1 ? A PHE 308 CE1 200 1 Y 1 A PHE 328 ? CE2 ? A PHE 308 CE2 201 1 Y 1 A PHE 328 ? CZ ? A PHE 308 CZ 202 1 Y 1 A VAL 330 ? CG1 ? A VAL 310 CG1 203 1 Y 1 A VAL 330 ? CG2 ? A VAL 310 CG2 204 1 Y 1 A VAL 335 ? CG1 ? A VAL 315 CG1 205 1 Y 1 A VAL 335 ? CG2 ? A VAL 315 CG2 206 1 Y 1 A LEU 346 ? CG ? A LEU 326 CG 207 1 Y 1 A LEU 346 ? CD1 ? A LEU 326 CD1 208 1 Y 1 A LEU 346 ? CD2 ? A LEU 326 CD2 209 1 Y 1 A THR 348 ? OG1 ? A THR 328 OG1 210 1 Y 1 A THR 348 ? CG2 ? A THR 328 CG2 211 1 Y 1 A VAL 349 ? CG1 ? A VAL 329 CG1 212 1 Y 1 A VAL 349 ? CG2 ? A VAL 329 CG2 213 1 Y 1 A PHE 350 ? CG ? A PHE 330 CG 214 1 Y 1 A PHE 350 ? CD1 ? A PHE 330 CD1 215 1 Y 1 A PHE 350 ? CD2 ? A PHE 330 CD2 216 1 Y 1 A PHE 350 ? CE1 ? A PHE 330 CE1 217 1 Y 1 A PHE 350 ? CE2 ? A PHE 330 CE2 218 1 Y 1 A PHE 350 ? CZ ? A PHE 330 CZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.5.1 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.10_2155 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20 4 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5U1Y _cell.details ? _cell.formula_units_Z ? _cell.length_a 169.704 _cell.length_a_esd ? _cell.length_b 169.704 _cell.length_b_esd ? _cell.length_c 169.704 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5U1Y _symmetry.cell_setting ? _symmetry.Int_Tables_number 199 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 21 3' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5U1Y _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 5.25 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 76.57 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;100 mM HEPES or Tris (pH 6.0-7.5), 100 mM NaCl, 4% ethylene glycol, 15% glycerol, 27-32% PEG-400 or 31-36% PEG-300, 0.1 mg/mL lipid mixture (60% POPE, 20% POPG, and 20% cholesterol), and 1 mM GW791343 ; _exptl_crystal_grow.pdbx_pH_range 6.0-7.5 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-06-24 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9782 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'CHESS BEAMLINE F1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9782 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline F1 _diffrn_source.pdbx_synchrotron_site CHESS # _reflns.B_iso_Wilson_estimate 126.340 _reflns.entry_id 5U1Y _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.300 _reflns.d_resolution_low 48.990 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12394 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.100 _reflns.pdbx_Rmerge_I_obs 0.124 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.400 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.131 _reflns.pdbx_Rpim_I_all 0.042 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 124999 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 3.300 3.560 ? ? ? ? ? ? ? 99.800 ? ? ? ? 1.339 ? ? ? ? ? ? ? ? 10.200 ? ? ? ? ? ? ? 1 1 0.690 ? 8.730 48.990 ? ? ? ? ? ? ? 99.400 ? ? ? ? 0.074 ? ? ? ? ? ? ? ? 9.500 ? ? ? ? ? ? ? 2 1 0.997 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 216.410 _refine.B_iso_mean 119.0048 _refine.B_iso_min 65.820 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5U1Y _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.3000 _refine.ls_d_res_low 48.9890 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12384 _refine.ls_number_reflns_R_free 1292 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8700 _refine.ls_percent_reflns_R_free 10.4300 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2428 _refine.ls_R_factor_R_free 0.2710 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2395 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'A740003 bound P2X7' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.0900 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.5800 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 3.3000 _refine_hist.d_res_low 48.9890 _refine_hist.pdbx_number_atoms_ligand 69 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2382 _refine_hist.pdbx_number_residues_total 317 _refine_hist.pdbx_B_iso_mean_ligand 137.36 _refine_hist.pdbx_number_atoms_protein 2313 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.004 ? 2445 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.672 ? 3344 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.049 ? 380 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 438 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 12.123 ? 1424 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.3004 3.4325 1361 . 151 1210 99.0000 . . . 0.4085 . 0.3586 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 3.4325 3.5886 1357 . 132 1225 100.0000 . . . 0.3291 . 0.3133 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 3.5886 3.7778 1371 . 136 1235 100.0000 . . . 0.3682 . 0.2789 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 3.7778 4.0144 1349 . 132 1217 100.0000 . . . 0.2923 . 0.2619 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 4.0144 4.3241 1373 . 155 1218 100.0000 . . . 0.3271 . 0.2446 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 4.3241 4.7590 1370 . 130 1240 100.0000 . . . 0.2019 . 0.1836 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 4.7590 5.4468 1379 . 155 1224 100.0000 . . . 0.2340 . 0.2035 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 5.4468 6.8594 1387 . 147 1240 100.0000 . . . 0.2534 . 0.2350 . . . . . . 9 . . . 'X-RAY DIFFRACTION' 6.8594 48.9947 1437 . 154 1283 100.0000 . . . 0.2679 . 0.2446 . . . . . . 9 . . . # _struct.entry_id 5U1Y _struct.title 'Crystal structure of the ATP-gated P2X7 ion channel bound to allosteric antagonist GW791343' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5U1Y _struct_keywords.text 'membrane protein: ATP-gated ion channel: allosteric antagonist bound: closed state, MEMBRANE PROTEIN' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code G1M6C4_AILME _struct_ref.pdbx_db_accession G1M6C4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;STNYGTIKWIFHVLVFSYISFALISDKRYQKKEPLISSVHTKVKGIAEVKAEILENGMKKMVSGVFDTADYTFPLQGNSF FVMTNFIKTEGQQQGLCPDFPTRRTICSSDRGCKKGRMDPQSKGIQTGRCVVYKERLKTCEVSAWCPIEEVEDAPRPALL NSAENFTVLIKNNIDFPGHNYTTRNILPGVNITCTFHKTQNPQCPIFRLGDIFQETGDNFSDVAIQGGIMGIEIYWDCNL DGWFHHCRPKYSFRRLDDKTTNESLYPGYNFRYAKYYKENNVEKRTLIKVFGIRFDILVFGTGGKFNVIQLAVYIGSVIS YFGLATVFIDILINTY ; _struct_ref.pdbx_align_begin 24 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5U1Y _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 338 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession G1M6C4 _struct_ref_seq.db_align_beg 24 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 359 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 23 _struct_ref_seq.pdbx_auth_seq_align_end 358 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5U1Y GLY A 1 ? UNP G1M6C4 ? ? 'expression tag' 21 1 1 5U1Y SER A 2 ? UNP G1M6C4 ? ? 'expression tag' 22 2 1 5U1Y ALA A 15 ? UNP G1M6C4 VAL 36 'engineered mutation' 35 3 1 5U1Y ALA A 105 ? UNP G1M6C4 ARG 126 'engineered mutation' 125 4 1 5U1Y LYS A 154 ? UNP G1M6C4 GLU 175 'engineered mutation' 174 5 1 5U1Y SER A 221 ? UNP G1M6C4 ASN 242 'engineered mutation' 241 6 1 5U1Y SER A 264 ? UNP G1M6C4 ASN 285 'engineered mutation' 284 7 1 5U1Y SER A 339 ? UNP G1M6C4 ? ? 'expression tag' 359 8 1 5U1Y ALA A 340 ? UNP G1M6C4 ? ? 'expression tag' 360 9 1 5U1Y SER A 341 ? UNP G1M6C4 ? ? 'expression tag' 361 10 1 5U1Y SER A 342 ? UNP G1M6C4 ? ? 'expression tag' 362 11 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 12200 ? 1 MORE -15 ? 1 'SSA (A^2)' 44090 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 3 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 14 ? LYS A 29 ? HIS A 34 LYS A 49 1 ? 16 HELX_P HELX_P2 AA2 ASP A 69 ? THR A 74 ? ASP A 89 THR A 94 1 ? 6 HELX_P HELX_P3 AA3 LEU A 162 ? ASN A 167 ? LEU A 182 ASN A 187 5 ? 6 HELX_P HELX_P4 AA4 LEU A 211 ? THR A 218 ? LEU A 231 THR A 238 1 ? 8 HELX_P HELX_P5 AA5 SER A 221 ? GLY A 229 ? SER A 241 GLY A 249 1 ? 9 HELX_P HELX_P6 AA6 SER A 264 ? TYR A 268 ? SER A 284 TYR A 288 5 ? 5 HELX_P HELX_P7 AA7 ASN A 309 ? PHE A 330 ? ASN A 329 PHE A 350 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 99 SG ? ? ? 1_555 A CYS 148 SG ? ? A CYS 119 A CYS 168 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf2 disulf ? ? A CYS 109 SG ? ? ? 1_555 A CYS 132 SG ? ? A CYS 129 A CYS 152 1_555 ? ? ? ? ? ? ? 2.026 ? ? disulf3 disulf ? ? A CYS 115 SG ? ? ? 1_555 A CYS 142 SG ? ? A CYS 135 A CYS 162 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf4 disulf ? ? A CYS 196 SG ? ? ? 1_555 A CYS 206 SG ? ? A CYS 216 A CYS 226 1_555 ? ? ? ? ? ? ? 2.035 ? ? disulf5 disulf ? ? A CYS 240 SG ? ? ? 1_555 A CYS 249 SG ? ? A CYS 260 A CYS 269 1_555 ? ? ? ? ? ? ? 2.032 ? ? covale1 covale one ? A ASN 167 ND2 ? ? ? 1_555 B NAG . C1 ? ? A ASN 187 A NAG 401 1_555 ? ? ? ? ? ? ? 1.440 ? N-Glycosylation covale2 covale one ? A ASN 182 ND2 ? ? ? 1_555 D NAG . C1 ? ? A ASN 202 A NAG 403 1_555 ? ? ? ? ? ? ? 1.441 ? N-Glycosylation covale3 covale one ? A ASN 193 ND2 ? ? ? 1_555 C NAG . C1 ? ? A ASN 213 A NAG 402 1_555 ? ? ? ? ? ? ? 1.440 ? N-Glycosylation # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id CYS _struct_mon_prot_cis.label_seq_id 148 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id CYS _struct_mon_prot_cis.auth_seq_id 168 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 149 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 169 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -3.88 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 6 ? AA3 ? 3 ? AA4 ? 3 ? AA5 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA5 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 32 ? PRO A 36 ? GLN A 52 PRO A 56 AA1 2 VAL A 284 ? PHE A 308 ? VAL A 304 PHE A 328 AA1 3 GLY A 230 ? ASN A 241 ? GLY A 250 ASN A 261 AA1 4 PRO A 251 ? ARG A 257 ? PRO A 271 ARG A 277 AA2 1 LYS A 117 ? MET A 120 ? LYS A 137 MET A 140 AA2 2 ILE A 127 ? LYS A 136 ? ILE A 147 LYS A 156 AA2 3 LEU A 139 ? CYS A 148 ? LEU A 159 CYS A 168 AA2 4 SER A 81 ? PRO A 100 ? SER A 101 PRO A 120 AA2 5 VAL A 284 ? PHE A 308 ? VAL A 304 PHE A 328 AA2 6 ASN A 272 ? GLU A 281 ? ASN A 292 GLU A 301 AA3 1 ILE A 38 ? LYS A 46 ? ILE A 58 LYS A 66 AA3 2 THR A 169 ? PHE A 178 ? THR A 189 PHE A 198 AA3 3 TYR A 183 ? ARG A 186 ? TYR A 203 ARG A 206 AA4 1 ILE A 38 ? LYS A 46 ? ILE A 58 LYS A 66 AA4 2 THR A 169 ? PHE A 178 ? THR A 189 PHE A 198 AA4 3 ILE A 208 ? ARG A 210 ? ILE A 228 ARG A 230 AA5 1 ALA A 49 ? GLU A 57 ? ALA A 69 GLU A 77 AA5 2 MET A 60 ? PHE A 68 ? MET A 80 PHE A 88 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LYS A 33 ? N LYS A 53 O LYS A 307 ? O LYS A 327 AA1 2 3 O LEU A 300 ? O LEU A 320 N ILE A 234 ? N ILE A 254 AA1 3 4 N GLU A 235 ? N GLU A 255 O SER A 254 ? O SER A 274 AA2 1 2 N ARG A 119 ? N ARG A 139 O GLN A 128 ? O GLN A 148 AA2 2 3 N ILE A 127 ? N ILE A 147 O SER A 145 ? O SER A 165 AA2 3 4 O CYS A 148 ? O CYS A 168 N GLN A 95 ? N GLN A 115 AA2 4 5 N PHE A 82 ? N PHE A 102 O PHE A 297 ? O PHE A 317 AA2 5 6 O LYS A 286 ? O LYS A 306 N TYR A 279 ? N TYR A 299 AA3 1 2 N HIS A 42 ? N HIS A 62 O LYS A 173 ? O LYS A 193 AA3 2 3 N ILE A 176 ? N ILE A 196 O THR A 185 ? O THR A 205 AA4 1 2 N HIS A 42 ? N HIS A 62 O LYS A 173 ? O LYS A 193 AA4 2 3 N VAL A 170 ? N VAL A 190 O PHE A 209 ? O PHE A 229 AA5 1 2 N VAL A 51 ? N VAL A 71 O GLY A 66 ? O GLY A 86 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE1 A GLU 171 ? ? NZ A LYS 311 ? ? 2.13 2 1 OD1 A ASN 207 ? ? OH A TYR 273 ? ? 2.17 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 OG A SER 342 ? ? 1_555 OG A SER 342 ? ? 5_555 2.09 2 1 NH2 A ARG 158 ? ? 1_555 OD1 A ASP 175 ? ? 16_554 2.16 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 157 ? ? 63.41 -127.41 2 1 ALA A 166 ? ? -169.18 -163.40 3 1 LEU A 182 ? ? -93.77 48.93 4 1 TRP A 265 ? ? -61.88 -72.46 5 1 CYS A 269 ? ? -165.75 74.95 # _phasing.method MR # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 21 ? A GLY 1 2 1 Y 1 A SER 22 ? A SER 2 3 1 Y 1 A SER 23 ? A SER 3 4 1 Y 1 A THR 24 ? A THR 4 5 1 Y 1 A ASN 25 ? A ASN 5 6 1 Y 1 A TYR 26 ? A TYR 6 7 1 Y 1 A GLY 27 ? A GLY 7 8 1 Y 1 A THR 28 ? A THR 8 9 1 Y 1 A ILE 29 ? A ILE 9 10 1 Y 1 A LYS 30 ? A LYS 10 11 1 Y 1 A TRP 31 ? A TRP 11 12 1 Y 1 A ILE 32 ? A ILE 12 13 1 Y 1 A PHE 33 ? A PHE 13 14 1 Y 1 A ILE 351 ? A ILE 331 15 1 Y 1 A ASP 352 ? A ASP 332 16 1 Y 1 A ILE 353 ? A ILE 333 17 1 Y 1 A LEU 354 ? A LEU 334 18 1 Y 1 A ILE 355 ? A ILE 335 19 1 Y 1 A ASN 356 ? A ASN 336 20 1 Y 1 A THR 357 ? A THR 337 21 1 Y 1 A TYR 358 ? A TYR 338 22 1 Y 1 A SER 359 ? A SER 339 23 1 Y 1 A ALA 360 ? A ALA 340 24 1 Y 1 A SER 361 ? A SER 341 25 1 Y 1 A SER 362 ? A SER 342 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 7RS C10 C N N 1 7RS N12 N N N 2 7RS C13 C N N 3 7RS C20 C Y N 4 7RS C21 C Y N 5 7RS C22 C Y N 6 7RS C24 C Y N 7 7RS C01 C N N 8 7RS C02 C Y N 9 7RS C03 C Y N 10 7RS C04 C Y N 11 7RS C05 C Y N 12 7RS C06 C Y N 13 7RS C07 C Y N 14 7RS C08 C N N 15 7RS N09 N N N 16 7RS C11 C N N 17 7RS C14 C N N 18 7RS N15 N N N 19 7RS C16 C N N 20 7RS O17 O N N 21 7RS C18 C N N 22 7RS N19 N N N 23 7RS C23 C Y N 24 7RS C25 C Y N 25 7RS F26 F N N 26 7RS F27 F N N 27 7RS H1 H N N 28 7RS H2 H N N 29 7RS H3 H N N 30 7RS H5 H N N 31 7RS H6 H N N 32 7RS H7 H N N 33 7RS H8 H N N 34 7RS H9 H N N 35 7RS H10 H N N 36 7RS H11 H N N 37 7RS H12 H N N 38 7RS H13 H N N 39 7RS H14 H N N 40 7RS H15 H N N 41 7RS H16 H N N 42 7RS H18 H N N 43 7RS H19 H N N 44 7RS H20 H N N 45 7RS H21 H N N 46 7RS H22 H N N 47 7RS H23 H N N 48 7RS H24 H N N 49 7RS H25 H N N 50 7RS H26 H N N 51 ALA N N N N 52 ALA CA C N S 53 ALA C C N N 54 ALA O O N N 55 ALA CB C N N 56 ALA OXT O N N 57 ALA H H N N 58 ALA H2 H N N 59 ALA HA H N N 60 ALA HB1 H N N 61 ALA HB2 H N N 62 ALA HB3 H N N 63 ALA HXT H N N 64 ARG N N N N 65 ARG CA C N S 66 ARG C C N N 67 ARG O O N N 68 ARG CB C N N 69 ARG CG C N N 70 ARG CD C N N 71 ARG NE N N N 72 ARG CZ C N N 73 ARG NH1 N N N 74 ARG NH2 N N N 75 ARG OXT O N N 76 ARG H H N N 77 ARG H2 H N N 78 ARG HA H N N 79 ARG HB2 H N N 80 ARG HB3 H N N 81 ARG HG2 H N N 82 ARG HG3 H N N 83 ARG HD2 H N N 84 ARG HD3 H N N 85 ARG HE H N N 86 ARG HH11 H N N 87 ARG HH12 H N N 88 ARG HH21 H N N 89 ARG HH22 H N N 90 ARG HXT H N N 91 ASN N N N N 92 ASN CA C N S 93 ASN C C N N 94 ASN O O N N 95 ASN CB C N N 96 ASN CG C N N 97 ASN OD1 O N N 98 ASN ND2 N N N 99 ASN OXT O N N 100 ASN H H N N 101 ASN H2 H N N 102 ASN HA H N N 103 ASN HB2 H N N 104 ASN HB3 H N N 105 ASN HD21 H N N 106 ASN HD22 H N N 107 ASN HXT H N N 108 ASP N N N N 109 ASP CA C N S 110 ASP C C N N 111 ASP O O N N 112 ASP CB C N N 113 ASP CG C N N 114 ASP OD1 O N N 115 ASP OD2 O N N 116 ASP OXT O N N 117 ASP H H N N 118 ASP H2 H N N 119 ASP HA H N N 120 ASP HB2 H N N 121 ASP HB3 H N N 122 ASP HD2 H N N 123 ASP HXT H N N 124 CYS N N N N 125 CYS CA C N R 126 CYS C C N N 127 CYS O O N N 128 CYS CB C N N 129 CYS SG S N N 130 CYS OXT O N N 131 CYS H H N N 132 CYS H2 H N N 133 CYS HA H N N 134 CYS HB2 H N N 135 CYS HB3 H N N 136 CYS HG H N N 137 CYS HXT H N N 138 GLN N N N N 139 GLN CA C N S 140 GLN C C N N 141 GLN O O N N 142 GLN CB C N N 143 GLN CG C N N 144 GLN CD C N N 145 GLN OE1 O N N 146 GLN NE2 N N N 147 GLN OXT O N N 148 GLN H H N N 149 GLN H2 H N N 150 GLN HA H N N 151 GLN HB2 H N N 152 GLN HB3 H N N 153 GLN HG2 H N N 154 GLN HG3 H N N 155 GLN HE21 H N N 156 GLN HE22 H N N 157 GLN HXT H N N 158 GLU N N N N 159 GLU CA C N S 160 GLU C C N N 161 GLU O O N N 162 GLU CB C N N 163 GLU CG C N N 164 GLU CD C N N 165 GLU OE1 O N N 166 GLU OE2 O N N 167 GLU OXT O N N 168 GLU H H N N 169 GLU H2 H N N 170 GLU HA H N N 171 GLU HB2 H N N 172 GLU HB3 H N N 173 GLU HG2 H N N 174 GLU HG3 H N N 175 GLU HE2 H N N 176 GLU HXT H N N 177 GLY N N N N 178 GLY CA C N N 179 GLY C C N N 180 GLY O O N N 181 GLY OXT O N N 182 GLY H H N N 183 GLY H2 H N N 184 GLY HA2 H N N 185 GLY HA3 H N N 186 GLY HXT H N N 187 HIS N N N N 188 HIS CA C N S 189 HIS C C N N 190 HIS O O N N 191 HIS CB C N N 192 HIS CG C Y N 193 HIS ND1 N Y N 194 HIS CD2 C Y N 195 HIS CE1 C Y N 196 HIS NE2 N Y N 197 HIS OXT O N N 198 HIS H H N N 199 HIS H2 H N N 200 HIS HA H N N 201 HIS HB2 H N N 202 HIS HB3 H N N 203 HIS HD1 H N N 204 HIS HD2 H N N 205 HIS HE1 H N N 206 HIS HE2 H N N 207 HIS HXT H N N 208 ILE N N N N 209 ILE CA C N S 210 ILE C C N N 211 ILE O O N N 212 ILE CB C N S 213 ILE CG1 C N N 214 ILE CG2 C N N 215 ILE CD1 C N N 216 ILE OXT O N N 217 ILE H H N N 218 ILE H2 H N N 219 ILE HA H N N 220 ILE HB H N N 221 ILE HG12 H N N 222 ILE HG13 H N N 223 ILE HG21 H N N 224 ILE HG22 H N N 225 ILE HG23 H N N 226 ILE HD11 H N N 227 ILE HD12 H N N 228 ILE HD13 H N N 229 ILE HXT H N N 230 LEU N N N N 231 LEU CA C N S 232 LEU C C N N 233 LEU O O N N 234 LEU CB C N N 235 LEU CG C N N 236 LEU CD1 C N N 237 LEU CD2 C N N 238 LEU OXT O N N 239 LEU H H N N 240 LEU H2 H N N 241 LEU HA H N N 242 LEU HB2 H N N 243 LEU HB3 H N N 244 LEU HG H N N 245 LEU HD11 H N N 246 LEU HD12 H N N 247 LEU HD13 H N N 248 LEU HD21 H N N 249 LEU HD22 H N N 250 LEU HD23 H N N 251 LEU HXT H N N 252 LYS N N N N 253 LYS CA C N S 254 LYS C C N N 255 LYS O O N N 256 LYS CB C N N 257 LYS CG C N N 258 LYS CD C N N 259 LYS CE C N N 260 LYS NZ N N N 261 LYS OXT O N N 262 LYS H H N N 263 LYS H2 H N N 264 LYS HA H N N 265 LYS HB2 H N N 266 LYS HB3 H N N 267 LYS HG2 H N N 268 LYS HG3 H N N 269 LYS HD2 H N N 270 LYS HD3 H N N 271 LYS HE2 H N N 272 LYS HE3 H N N 273 LYS HZ1 H N N 274 LYS HZ2 H N N 275 LYS HZ3 H N N 276 LYS HXT H N N 277 MET N N N N 278 MET CA C N S 279 MET C C N N 280 MET O O N N 281 MET CB C N N 282 MET CG C N N 283 MET SD S N N 284 MET CE C N N 285 MET OXT O N N 286 MET H H N N 287 MET H2 H N N 288 MET HA H N N 289 MET HB2 H N N 290 MET HB3 H N N 291 MET HG2 H N N 292 MET HG3 H N N 293 MET HE1 H N N 294 MET HE2 H N N 295 MET HE3 H N N 296 MET HXT H N N 297 NAG C1 C N R 298 NAG C2 C N R 299 NAG C3 C N R 300 NAG C4 C N S 301 NAG C5 C N R 302 NAG C6 C N N 303 NAG C7 C N N 304 NAG C8 C N N 305 NAG N2 N N N 306 NAG O1 O N N 307 NAG O3 O N N 308 NAG O4 O N N 309 NAG O5 O N N 310 NAG O6 O N N 311 NAG O7 O N N 312 NAG H1 H N N 313 NAG H2 H N N 314 NAG H3 H N N 315 NAG H4 H N N 316 NAG H5 H N N 317 NAG H61 H N N 318 NAG H62 H N N 319 NAG H81 H N N 320 NAG H82 H N N 321 NAG H83 H N N 322 NAG HN2 H N N 323 NAG HO1 H N N 324 NAG HO3 H N N 325 NAG HO4 H N N 326 NAG HO6 H N N 327 PHE N N N N 328 PHE CA C N S 329 PHE C C N N 330 PHE O O N N 331 PHE CB C N N 332 PHE CG C Y N 333 PHE CD1 C Y N 334 PHE CD2 C Y N 335 PHE CE1 C Y N 336 PHE CE2 C Y N 337 PHE CZ C Y N 338 PHE OXT O N N 339 PHE H H N N 340 PHE H2 H N N 341 PHE HA H N N 342 PHE HB2 H N N 343 PHE HB3 H N N 344 PHE HD1 H N N 345 PHE HD2 H N N 346 PHE HE1 H N N 347 PHE HE2 H N N 348 PHE HZ H N N 349 PHE HXT H N N 350 PRO N N N N 351 PRO CA C N S 352 PRO C C N N 353 PRO O O N N 354 PRO CB C N N 355 PRO CG C N N 356 PRO CD C N N 357 PRO OXT O N N 358 PRO H H N N 359 PRO HA H N N 360 PRO HB2 H N N 361 PRO HB3 H N N 362 PRO HG2 H N N 363 PRO HG3 H N N 364 PRO HD2 H N N 365 PRO HD3 H N N 366 PRO HXT H N N 367 SER N N N N 368 SER CA C N S 369 SER C C N N 370 SER O O N N 371 SER CB C N N 372 SER OG O N N 373 SER OXT O N N 374 SER H H N N 375 SER H2 H N N 376 SER HA H N N 377 SER HB2 H N N 378 SER HB3 H N N 379 SER HG H N N 380 SER HXT H N N 381 THR N N N N 382 THR CA C N S 383 THR C C N N 384 THR O O N N 385 THR CB C N R 386 THR OG1 O N N 387 THR CG2 C N N 388 THR OXT O N N 389 THR H H N N 390 THR H2 H N N 391 THR HA H N N 392 THR HB H N N 393 THR HG1 H N N 394 THR HG21 H N N 395 THR HG22 H N N 396 THR HG23 H N N 397 THR HXT H N N 398 TRP N N N N 399 TRP CA C N S 400 TRP C C N N 401 TRP O O N N 402 TRP CB C N N 403 TRP CG C Y N 404 TRP CD1 C Y N 405 TRP CD2 C Y N 406 TRP NE1 N Y N 407 TRP CE2 C Y N 408 TRP CE3 C Y N 409 TRP CZ2 C Y N 410 TRP CZ3 C Y N 411 TRP CH2 C Y N 412 TRP OXT O N N 413 TRP H H N N 414 TRP H2 H N N 415 TRP HA H N N 416 TRP HB2 H N N 417 TRP HB3 H N N 418 TRP HD1 H N N 419 TRP HE1 H N N 420 TRP HE3 H N N 421 TRP HZ2 H N N 422 TRP HZ3 H N N 423 TRP HH2 H N N 424 TRP HXT H N N 425 TYR N N N N 426 TYR CA C N S 427 TYR C C N N 428 TYR O O N N 429 TYR CB C N N 430 TYR CG C Y N 431 TYR CD1 C Y N 432 TYR CD2 C Y N 433 TYR CE1 C Y N 434 TYR CE2 C Y N 435 TYR CZ C Y N 436 TYR OH O N N 437 TYR OXT O N N 438 TYR H H N N 439 TYR H2 H N N 440 TYR HA H N N 441 TYR HB2 H N N 442 TYR HB3 H N N 443 TYR HD1 H N N 444 TYR HD2 H N N 445 TYR HE1 H N N 446 TYR HE2 H N N 447 TYR HH H N N 448 TYR HXT H N N 449 VAL N N N N 450 VAL CA C N S 451 VAL C C N N 452 VAL O O N N 453 VAL CB C N N 454 VAL CG1 C N N 455 VAL CG2 C N N 456 VAL OXT O N N 457 VAL H H N N 458 VAL H2 H N N 459 VAL HA H N N 460 VAL HB H N N 461 VAL HG11 H N N 462 VAL HG12 H N N 463 VAL HG13 H N N 464 VAL HG21 H N N 465 VAL HG22 H N N 466 VAL HG23 H N N 467 VAL HXT H N N 468 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 7RS N12 C13 sing N N 1 7RS N12 C11 sing N N 2 7RS C13 C14 sing N N 3 7RS C11 C10 sing N N 4 7RS C14 N09 sing N N 5 7RS C10 N09 sing N N 6 7RS N09 C08 sing N N 7 7RS C08 C05 sing N N 8 7RS C05 C04 doub Y N 9 7RS C05 C06 sing Y N 10 7RS C04 C03 sing Y N 11 7RS C06 C07 doub Y N 12 7RS C03 N15 sing N N 13 7RS C03 C02 doub Y N 14 7RS N15 C16 sing N N 15 7RS C07 C02 sing Y N 16 7RS C02 C01 sing N N 17 7RS C16 O17 doub N N 18 7RS C16 C18 sing N N 19 7RS C18 N19 sing N N 20 7RS N19 C20 sing N N 21 7RS C21 C20 doub Y N 22 7RS C21 C22 sing Y N 23 7RS C20 C25 sing Y N 24 7RS C22 F27 sing N N 25 7RS C22 C23 doub Y N 26 7RS C25 C24 doub Y N 27 7RS C23 C24 sing Y N 28 7RS C23 F26 sing N N 29 7RS C10 H1 sing N N 30 7RS C10 H2 sing N N 31 7RS N12 H3 sing N N 32 7RS C13 H5 sing N N 33 7RS C13 H6 sing N N 34 7RS C21 H7 sing N N 35 7RS C24 H8 sing N N 36 7RS C01 H9 sing N N 37 7RS C01 H10 sing N N 38 7RS C01 H11 sing N N 39 7RS C04 H12 sing N N 40 7RS C06 H13 sing N N 41 7RS C07 H14 sing N N 42 7RS C08 H15 sing N N 43 7RS C08 H16 sing N N 44 7RS C11 H18 sing N N 45 7RS C11 H19 sing N N 46 7RS C14 H20 sing N N 47 7RS C14 H21 sing N N 48 7RS N15 H22 sing N N 49 7RS C18 H23 sing N N 50 7RS C18 H24 sing N N 51 7RS N19 H25 sing N N 52 7RS C25 H26 sing N N 53 ALA N CA sing N N 54 ALA N H sing N N 55 ALA N H2 sing N N 56 ALA CA C sing N N 57 ALA CA CB sing N N 58 ALA CA HA sing N N 59 ALA C O doub N N 60 ALA C OXT sing N N 61 ALA CB HB1 sing N N 62 ALA CB HB2 sing N N 63 ALA CB HB3 sing N N 64 ALA OXT HXT sing N N 65 ARG N CA sing N N 66 ARG N H sing N N 67 ARG N H2 sing N N 68 ARG CA C sing N N 69 ARG CA CB sing N N 70 ARG CA HA sing N N 71 ARG C O doub N N 72 ARG C OXT sing N N 73 ARG CB CG sing N N 74 ARG CB HB2 sing N N 75 ARG CB HB3 sing N N 76 ARG CG CD sing N N 77 ARG CG HG2 sing N N 78 ARG CG HG3 sing N N 79 ARG CD NE sing N N 80 ARG CD HD2 sing N N 81 ARG CD HD3 sing N N 82 ARG NE CZ sing N N 83 ARG NE HE sing N N 84 ARG CZ NH1 sing N N 85 ARG CZ NH2 doub N N 86 ARG NH1 HH11 sing N N 87 ARG NH1 HH12 sing N N 88 ARG NH2 HH21 sing N N 89 ARG NH2 HH22 sing N N 90 ARG OXT HXT sing N N 91 ASN N CA sing N N 92 ASN N H sing N N 93 ASN N H2 sing N N 94 ASN CA C sing N N 95 ASN CA CB sing N N 96 ASN CA HA sing N N 97 ASN C O doub N N 98 ASN C OXT sing N N 99 ASN CB CG sing N N 100 ASN CB HB2 sing N N 101 ASN CB HB3 sing N N 102 ASN CG OD1 doub N N 103 ASN CG ND2 sing N N 104 ASN ND2 HD21 sing N N 105 ASN ND2 HD22 sing N N 106 ASN OXT HXT sing N N 107 ASP N CA sing N N 108 ASP N H sing N N 109 ASP N H2 sing N N 110 ASP CA C sing N N 111 ASP CA CB sing N N 112 ASP CA HA sing N N 113 ASP C O doub N N 114 ASP C OXT sing N N 115 ASP CB CG sing N N 116 ASP CB HB2 sing N N 117 ASP CB HB3 sing N N 118 ASP CG OD1 doub N N 119 ASP CG OD2 sing N N 120 ASP OD2 HD2 sing N N 121 ASP OXT HXT sing N N 122 CYS N CA sing N N 123 CYS N H sing N N 124 CYS N H2 sing N N 125 CYS CA C sing N N 126 CYS CA CB sing N N 127 CYS CA HA sing N N 128 CYS C O doub N N 129 CYS C OXT sing N N 130 CYS CB SG sing N N 131 CYS CB HB2 sing N N 132 CYS CB HB3 sing N N 133 CYS SG HG sing N N 134 CYS OXT HXT sing N N 135 GLN N CA sing N N 136 GLN N H sing N N 137 GLN N H2 sing N N 138 GLN CA C sing N N 139 GLN CA CB sing N N 140 GLN CA HA sing N N 141 GLN C O doub N N 142 GLN C OXT sing N N 143 GLN CB CG sing N N 144 GLN CB HB2 sing N N 145 GLN CB HB3 sing N N 146 GLN CG CD sing N N 147 GLN CG HG2 sing N N 148 GLN CG HG3 sing N N 149 GLN CD OE1 doub N N 150 GLN CD NE2 sing N N 151 GLN NE2 HE21 sing N N 152 GLN NE2 HE22 sing N N 153 GLN OXT HXT sing N N 154 GLU N CA sing N N 155 GLU N H sing N N 156 GLU N H2 sing N N 157 GLU CA C sing N N 158 GLU CA CB sing N N 159 GLU CA HA sing N N 160 GLU C O doub N N 161 GLU C OXT sing N N 162 GLU CB CG sing N N 163 GLU CB HB2 sing N N 164 GLU CB HB3 sing N N 165 GLU CG CD sing N N 166 GLU CG HG2 sing N N 167 GLU CG HG3 sing N N 168 GLU CD OE1 doub N N 169 GLU CD OE2 sing N N 170 GLU OE2 HE2 sing N N 171 GLU OXT HXT sing N N 172 GLY N CA sing N N 173 GLY N H sing N N 174 GLY N H2 sing N N 175 GLY CA C sing N N 176 GLY CA HA2 sing N N 177 GLY CA HA3 sing N N 178 GLY C O doub N N 179 GLY C OXT sing N N 180 GLY OXT HXT sing N N 181 HIS N CA sing N N 182 HIS N H sing N N 183 HIS N H2 sing N N 184 HIS CA C sing N N 185 HIS CA CB sing N N 186 HIS CA HA sing N N 187 HIS C O doub N N 188 HIS C OXT sing N N 189 HIS CB CG sing N N 190 HIS CB HB2 sing N N 191 HIS CB HB3 sing N N 192 HIS CG ND1 sing Y N 193 HIS CG CD2 doub Y N 194 HIS ND1 CE1 doub Y N 195 HIS ND1 HD1 sing N N 196 HIS CD2 NE2 sing Y N 197 HIS CD2 HD2 sing N N 198 HIS CE1 NE2 sing Y N 199 HIS CE1 HE1 sing N N 200 HIS NE2 HE2 sing N N 201 HIS OXT HXT sing N N 202 ILE N CA sing N N 203 ILE N H sing N N 204 ILE N H2 sing N N 205 ILE CA C sing N N 206 ILE CA CB sing N N 207 ILE CA HA sing N N 208 ILE C O doub N N 209 ILE C OXT sing N N 210 ILE CB CG1 sing N N 211 ILE CB CG2 sing N N 212 ILE CB HB sing N N 213 ILE CG1 CD1 sing N N 214 ILE CG1 HG12 sing N N 215 ILE CG1 HG13 sing N N 216 ILE CG2 HG21 sing N N 217 ILE CG2 HG22 sing N N 218 ILE CG2 HG23 sing N N 219 ILE CD1 HD11 sing N N 220 ILE CD1 HD12 sing N N 221 ILE CD1 HD13 sing N N 222 ILE OXT HXT sing N N 223 LEU N CA sing N N 224 LEU N H sing N N 225 LEU N H2 sing N N 226 LEU CA C sing N N 227 LEU CA CB sing N N 228 LEU CA HA sing N N 229 LEU C O doub N N 230 LEU C OXT sing N N 231 LEU CB CG sing N N 232 LEU CB HB2 sing N N 233 LEU CB HB3 sing N N 234 LEU CG CD1 sing N N 235 LEU CG CD2 sing N N 236 LEU CG HG sing N N 237 LEU CD1 HD11 sing N N 238 LEU CD1 HD12 sing N N 239 LEU CD1 HD13 sing N N 240 LEU CD2 HD21 sing N N 241 LEU CD2 HD22 sing N N 242 LEU CD2 HD23 sing N N 243 LEU OXT HXT sing N N 244 LYS N CA sing N N 245 LYS N H sing N N 246 LYS N H2 sing N N 247 LYS CA C sing N N 248 LYS CA CB sing N N 249 LYS CA HA sing N N 250 LYS C O doub N N 251 LYS C OXT sing N N 252 LYS CB CG sing N N 253 LYS CB HB2 sing N N 254 LYS CB HB3 sing N N 255 LYS CG CD sing N N 256 LYS CG HG2 sing N N 257 LYS CG HG3 sing N N 258 LYS CD CE sing N N 259 LYS CD HD2 sing N N 260 LYS CD HD3 sing N N 261 LYS CE NZ sing N N 262 LYS CE HE2 sing N N 263 LYS CE HE3 sing N N 264 LYS NZ HZ1 sing N N 265 LYS NZ HZ2 sing N N 266 LYS NZ HZ3 sing N N 267 LYS OXT HXT sing N N 268 MET N CA sing N N 269 MET N H sing N N 270 MET N H2 sing N N 271 MET CA C sing N N 272 MET CA CB sing N N 273 MET CA HA sing N N 274 MET C O doub N N 275 MET C OXT sing N N 276 MET CB CG sing N N 277 MET CB HB2 sing N N 278 MET CB HB3 sing N N 279 MET CG SD sing N N 280 MET CG HG2 sing N N 281 MET CG HG3 sing N N 282 MET SD CE sing N N 283 MET CE HE1 sing N N 284 MET CE HE2 sing N N 285 MET CE HE3 sing N N 286 MET OXT HXT sing N N 287 NAG C1 C2 sing N N 288 NAG C1 O1 sing N N 289 NAG C1 O5 sing N N 290 NAG C1 H1 sing N N 291 NAG C2 C3 sing N N 292 NAG C2 N2 sing N N 293 NAG C2 H2 sing N N 294 NAG C3 C4 sing N N 295 NAG C3 O3 sing N N 296 NAG C3 H3 sing N N 297 NAG C4 C5 sing N N 298 NAG C4 O4 sing N N 299 NAG C4 H4 sing N N 300 NAG C5 C6 sing N N 301 NAG C5 O5 sing N N 302 NAG C5 H5 sing N N 303 NAG C6 O6 sing N N 304 NAG C6 H61 sing N N 305 NAG C6 H62 sing N N 306 NAG C7 C8 sing N N 307 NAG C7 N2 sing N N 308 NAG C7 O7 doub N N 309 NAG C8 H81 sing N N 310 NAG C8 H82 sing N N 311 NAG C8 H83 sing N N 312 NAG N2 HN2 sing N N 313 NAG O1 HO1 sing N N 314 NAG O3 HO3 sing N N 315 NAG O4 HO4 sing N N 316 NAG O6 HO6 sing N N 317 PHE N CA sing N N 318 PHE N H sing N N 319 PHE N H2 sing N N 320 PHE CA C sing N N 321 PHE CA CB sing N N 322 PHE CA HA sing N N 323 PHE C O doub N N 324 PHE C OXT sing N N 325 PHE CB CG sing N N 326 PHE CB HB2 sing N N 327 PHE CB HB3 sing N N 328 PHE CG CD1 doub Y N 329 PHE CG CD2 sing Y N 330 PHE CD1 CE1 sing Y N 331 PHE CD1 HD1 sing N N 332 PHE CD2 CE2 doub Y N 333 PHE CD2 HD2 sing N N 334 PHE CE1 CZ doub Y N 335 PHE CE1 HE1 sing N N 336 PHE CE2 CZ sing Y N 337 PHE CE2 HE2 sing N N 338 PHE CZ HZ sing N N 339 PHE OXT HXT sing N N 340 PRO N CA sing N N 341 PRO N CD sing N N 342 PRO N H sing N N 343 PRO CA C sing N N 344 PRO CA CB sing N N 345 PRO CA HA sing N N 346 PRO C O doub N N 347 PRO C OXT sing N N 348 PRO CB CG sing N N 349 PRO CB HB2 sing N N 350 PRO CB HB3 sing N N 351 PRO CG CD sing N N 352 PRO CG HG2 sing N N 353 PRO CG HG3 sing N N 354 PRO CD HD2 sing N N 355 PRO CD HD3 sing N N 356 PRO OXT HXT sing N N 357 SER N CA sing N N 358 SER N H sing N N 359 SER N H2 sing N N 360 SER CA C sing N N 361 SER CA CB sing N N 362 SER CA HA sing N N 363 SER C O doub N N 364 SER C OXT sing N N 365 SER CB OG sing N N 366 SER CB HB2 sing N N 367 SER CB HB3 sing N N 368 SER OG HG sing N N 369 SER OXT HXT sing N N 370 THR N CA sing N N 371 THR N H sing N N 372 THR N H2 sing N N 373 THR CA C sing N N 374 THR CA CB sing N N 375 THR CA HA sing N N 376 THR C O doub N N 377 THR C OXT sing N N 378 THR CB OG1 sing N N 379 THR CB CG2 sing N N 380 THR CB HB sing N N 381 THR OG1 HG1 sing N N 382 THR CG2 HG21 sing N N 383 THR CG2 HG22 sing N N 384 THR CG2 HG23 sing N N 385 THR OXT HXT sing N N 386 TRP N CA sing N N 387 TRP N H sing N N 388 TRP N H2 sing N N 389 TRP CA C sing N N 390 TRP CA CB sing N N 391 TRP CA HA sing N N 392 TRP C O doub N N 393 TRP C OXT sing N N 394 TRP CB CG sing N N 395 TRP CB HB2 sing N N 396 TRP CB HB3 sing N N 397 TRP CG CD1 doub Y N 398 TRP CG CD2 sing Y N 399 TRP CD1 NE1 sing Y N 400 TRP CD1 HD1 sing N N 401 TRP CD2 CE2 doub Y N 402 TRP CD2 CE3 sing Y N 403 TRP NE1 CE2 sing Y N 404 TRP NE1 HE1 sing N N 405 TRP CE2 CZ2 sing Y N 406 TRP CE3 CZ3 doub Y N 407 TRP CE3 HE3 sing N N 408 TRP CZ2 CH2 doub Y N 409 TRP CZ2 HZ2 sing N N 410 TRP CZ3 CH2 sing Y N 411 TRP CZ3 HZ3 sing N N 412 TRP CH2 HH2 sing N N 413 TRP OXT HXT sing N N 414 TYR N CA sing N N 415 TYR N H sing N N 416 TYR N H2 sing N N 417 TYR CA C sing N N 418 TYR CA CB sing N N 419 TYR CA HA sing N N 420 TYR C O doub N N 421 TYR C OXT sing N N 422 TYR CB CG sing N N 423 TYR CB HB2 sing N N 424 TYR CB HB3 sing N N 425 TYR CG CD1 doub Y N 426 TYR CG CD2 sing Y N 427 TYR CD1 CE1 sing Y N 428 TYR CD1 HD1 sing N N 429 TYR CD2 CE2 doub Y N 430 TYR CD2 HD2 sing N N 431 TYR CE1 CZ doub Y N 432 TYR CE1 HE1 sing N N 433 TYR CE2 CZ sing Y N 434 TYR CE2 HE2 sing N N 435 TYR CZ OH sing N N 436 TYR OH HH sing N N 437 TYR OXT HXT sing N N 438 VAL N CA sing N N 439 VAL N H sing N N 440 VAL N H2 sing N N 441 VAL CA C sing N N 442 VAL CA CB sing N N 443 VAL CA HA sing N N 444 VAL C O doub N N 445 VAL C OXT sing N N 446 VAL CB CG1 sing N N 447 VAL CB CG2 sing N N 448 VAL CB HB sing N N 449 VAL CG1 HG11 sing N N 450 VAL CG1 HG12 sing N N 451 VAL CG1 HG13 sing N N 452 VAL CG2 HG21 sing N N 453 VAL CG2 HG22 sing N N 454 VAL CG2 HG23 sing N N 455 VAL OXT HXT sing N N 456 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM114379 1 'National Institutes of Health/National Institute of Neurological Disorders and Stroke (NIH/NINDS)' 'United States' NS072869 2 # _pdbx_initial_refinement_model.accession_code 5U1U _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.details 'A740003 bound P2X7' # _atom_sites.entry_id 5U1Y _atom_sites.fract_transf_matrix[1][1] 0.005893 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.005893 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005893 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C F N O S # loop_