data_5U49 # _entry.id 5U49 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5U49 pdb_00005u49 10.2210/pdb5u49/pdb WWPDB D_1000225281 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 5U48 PDB . unspecified 5U4A PDB . unspecified 5U4B PDB . unspecified 5U4C PDB . unspecified 5U4D PDB . unspecified 5U4E PDB . unspecified 5U4F PDB . unspecified 5U4G PDB . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5U49 _pdbx_database_status.recvd_initial_deposition_date 2016-12-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Windsor, I.W.' 1 ? 'Smith, T.P.' 2 ? 'Raines, R.T.' 3 ? 'Forest, K.T.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Med. Chem.' _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 1520-4804 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 60 _citation.language ? _citation.page_first 7820 _citation.page_last 7834 _citation.title 'Stilbene Boronic Acids Form a Covalent Bond with Human Transthyretin and Inhibit Its Aggregation.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.7b00952 _citation.pdbx_database_id_PubMed 28920684 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Smith, T.P.' 1 ? primary 'Windsor, I.W.' 2 ? primary 'Forest, K.T.' 3 ? primary 'Raines, R.T.' 4 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5U49 _cell.details ? _cell.formula_units_Z ? _cell.length_a 44.517 _cell.length_a_esd ? _cell.length_b 65.895 _cell.length_b_esd ? _cell.length_c 84.594 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5U49 _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Transthyretin 13908.557 1 ? ? ? ? 2 non-polymer syn '5-[(E)-2-(2-chloro-4-hydroxyphenyl)ethenyl]benzene-1,3-diol' 262.688 1 ? ? ? ? 3 water nat water 18.015 11 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ATTR,Prealbumin,TBPA # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYW KALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKE ; _entity_poly.pdbx_seq_one_letter_code_can ;MGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYW KALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 PRO n 1 4 THR n 1 5 GLY n 1 6 THR n 1 7 GLY n 1 8 GLU n 1 9 SER n 1 10 LYS n 1 11 CYS n 1 12 PRO n 1 13 LEU n 1 14 MET n 1 15 VAL n 1 16 LYS n 1 17 VAL n 1 18 LEU n 1 19 ASP n 1 20 ALA n 1 21 VAL n 1 22 ARG n 1 23 GLY n 1 24 SER n 1 25 PRO n 1 26 ALA n 1 27 ILE n 1 28 ASN n 1 29 VAL n 1 30 ALA n 1 31 VAL n 1 32 HIS n 1 33 VAL n 1 34 PHE n 1 35 ARG n 1 36 LYS n 1 37 ALA n 1 38 ALA n 1 39 ASP n 1 40 ASP n 1 41 THR n 1 42 TRP n 1 43 GLU n 1 44 PRO n 1 45 PHE n 1 46 ALA n 1 47 SER n 1 48 GLY n 1 49 LYS n 1 50 THR n 1 51 SER n 1 52 GLU n 1 53 SER n 1 54 GLY n 1 55 GLU n 1 56 LEU n 1 57 HIS n 1 58 GLY n 1 59 LEU n 1 60 THR n 1 61 THR n 1 62 GLU n 1 63 GLU n 1 64 GLU n 1 65 PHE n 1 66 VAL n 1 67 GLU n 1 68 GLY n 1 69 ILE n 1 70 TYR n 1 71 LYS n 1 72 VAL n 1 73 GLU n 1 74 ILE n 1 75 ASP n 1 76 THR n 1 77 LYS n 1 78 SER n 1 79 TYR n 1 80 TRP n 1 81 LYS n 1 82 ALA n 1 83 LEU n 1 84 GLY n 1 85 ILE n 1 86 SER n 1 87 PRO n 1 88 PHE n 1 89 HIS n 1 90 GLU n 1 91 HIS n 1 92 ALA n 1 93 GLU n 1 94 VAL n 1 95 VAL n 1 96 PHE n 1 97 THR n 1 98 ALA n 1 99 ASN n 1 100 ASP n 1 101 SER n 1 102 GLY n 1 103 PRO n 1 104 ARG n 1 105 ARG n 1 106 TYR n 1 107 THR n 1 108 ILE n 1 109 ALA n 1 110 ALA n 1 111 LEU n 1 112 LEU n 1 113 SER n 1 114 PRO n 1 115 TYR n 1 116 SER n 1 117 TYR n 1 118 SER n 1 119 THR n 1 120 THR n 1 121 ALA n 1 122 VAL n 1 123 VAL n 1 124 THR n 1 125 ASN n 1 126 PRO n 1 127 LYS n 1 128 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 128 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'TTR, PALB' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET32b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TTHY_HUMAN _struct_ref.pdbx_db_accession P02766 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWK ALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKE ; _struct_ref.pdbx_align_begin 21 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5U49 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 128 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02766 _struct_ref_seq.db_align_beg 21 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 147 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 127 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 5U49 _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P02766 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'initiating methionine' _struct_ref_seq_dif.pdbx_auth_seq_num 0 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 S2L non-polymer . '5-[(E)-2-(2-chloro-4-hydroxyphenyl)ethenyl]benzene-1,3-diol' ? 'C14 H11 Cl O3' 262.688 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5U49 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.23 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.85 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.3 M Sodium Citrate, 3.0% Glycerol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-04-13 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.239801 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-D' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.239801 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-D _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 38.3 _reflns.entry_id 5U49 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.22 _reflns.d_resolution_low 33.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5956 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.6 _reflns.pdbx_Rmerge_I_obs 0.364 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 19.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.220 2.290 ? ? ? ? ? ? 300 98.000 ? ? ? ? 1.537 ? ? ? ? ? ? ? ? 4.400 ? ? ? ? ? ? ? 1 1 0.101 ? 2.290 2.330 ? ? ? ? ? ? ? 99.300 ? ? ? ? 2.727 ? ? ? ? ? ? ? ? 4.700 ? ? ? ? ? ? ? 2 1 0.062 ? 2.330 2.380 ? ? ? ? ? ? ? 99.700 ? ? ? ? 2.887 ? ? ? ? ? ? ? ? 5.500 ? ? ? ? ? ? ? 3 1 0.261 ? 2.380 2.420 ? ? ? ? ? ? ? 100.000 ? ? ? ? 5.942 ? ? ? ? ? ? ? ? 6.100 ? ? ? ? ? ? ? 4 1 0.212 ? 2.420 2.480 ? ? ? ? ? ? ? 99.700 ? ? ? ? 4.559 ? ? ? ? ? ? ? ? 6.600 ? ? ? ? ? ? ? 5 1 0.320 ? 2.480 2.530 ? ? ? ? ? ? ? 100.000 ? ? ? ? 3.643 ? ? ? ? ? ? ? ? 6.800 ? ? ? ? ? ? ? 6 1 0.392 ? 2.530 2.600 ? ? ? ? ? ? ? 99.700 ? ? ? ? 2.517 ? ? ? ? ? ? ? ? 7.000 ? ? ? ? ? ? ? 7 1 0.369 ? 2.600 2.670 ? ? ? ? ? ? ? 100.000 ? ? ? ? 1.579 ? ? ? ? ? ? ? ? 6.800 ? ? ? ? ? ? ? 8 1 0.624 ? 2.670 2.750 ? ? ? ? ? ? ? 99.300 ? ? ? ? 1.232 ? ? ? ? ? ? ? ? 6.800 ? ? ? ? ? ? ? 9 1 0.262 ? 2.750 2.830 ? ? ? ? ? ? ? 99.700 ? ? ? ? 0.877 ? ? ? ? ? ? ? ? 6.600 ? ? ? ? ? ? ? 10 1 0.756 ? 2.830 2.940 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.655 ? ? ? ? ? ? ? ? 6.300 ? ? ? ? ? ? ? 11 1 0.798 ? 2.940 3.050 ? ? ? ? ? ? ? 99.000 ? ? ? ? 0.509 ? ? ? ? ? ? ? ? 5.800 ? ? ? ? ? ? ? 12 1 0.847 ? 3.050 3.190 ? ? ? ? ? ? ? 85.500 ? ? ? ? 0.378 ? ? ? ? ? ? ? ? 5.600 ? ? ? ? ? ? ? 13 1 0.909 ? 3.190 3.360 ? ? ? ? ? ? ? 95.100 ? ? ? ? 0.270 ? ? ? ? ? ? ? ? 6.500 ? ? ? ? ? ? ? 14 1 0.960 ? 3.360 3.570 ? ? ? ? ? ? ? 99.700 ? ? ? ? 0.261 ? ? ? ? ? ? ? ? 7.900 ? ? ? ? ? ? ? 15 1 0.973 ? 3.570 3.850 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.199 ? ? ? ? ? ? ? ? 7.900 ? ? ? ? ? ? ? 16 1 0.971 ? 3.850 4.230 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.174 ? ? ? ? ? ? ? ? 7.800 ? ? ? ? ? ? ? 17 1 0.981 ? 4.230 4.850 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.146 ? ? ? ? ? ? ? ? 7.600 ? ? ? ? ? ? ? 18 1 0.982 ? 4.850 6.100 ? ? ? ? ? ? ? 99.700 ? ? ? ? 0.140 ? ? ? ? ? ? ? ? 7.600 ? ? ? ? ? ? ? 19 1 0.985 ? 6.100 50.000 ? ? ? ? ? ? ? 98.800 ? ? ? ? 0.107 ? ? ? ? ? ? ? ? 6.900 ? ? ? ? ? ? ? 20 1 0.978 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 82.560 _refine.B_iso_mean 41.2 _refine.B_iso_min 22.910 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5U49 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.22 _refine.ls_d_res_low 33.0 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5919 _refine.ls_number_reflns_R_free 621 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.85 _refine.ls_percent_reflns_R_free 9.99 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.209 _refine.ls_R_factor_R_free 0.275 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.202 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model 'pdbid 2QGB' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details 'Random 10%' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 31.62 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.31 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.22 _refine_hist.d_res_low 33.0 _refine_hist.pdbx_number_atoms_ligand 18 _refine_hist.number_atoms_solvent 11 _refine_hist.number_atoms_total 925 _refine_hist.pdbx_number_residues_total 116 _refine_hist.pdbx_B_iso_mean_ligand 39.54 _refine_hist.pdbx_B_iso_mean_solvent 38.51 _refine_hist.pdbx_number_atoms_protein 896 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 939 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.044 ? 1282 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.039 ? 143 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 163 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 15.037 ? 325 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.2211 2.4446 1457 . 146 1311 93.0000 . . . 0.3184 0.0000 0.2488 . . . . . . 4 . . . 'X-RAY DIFFRACTION' 2.4446 2.7982 1562 . 156 1406 99.0000 . . . 0.3128 0.0000 0.2381 . . . . . . 4 . . . 'X-RAY DIFFRACTION' 2.7982 3.5248 1518 . 150 1368 95.0000 . . . 0.2739 0.0000 0.2097 . . . . . . 4 . . . 'X-RAY DIFFRACTION' 3.5248 32.9511 1682 . 169 1513 100.0000 . . . 0.2573 0.0000 0.1811 . . . . . . 4 . . . # _struct.entry_id 5U49 _struct.title 'Wild-type Transthyretin in complex with 5-[(1E)-2-(2-Chloro-4-hydroxyphenyl)ethenyl]-1,3-benzenediol' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5U49 _struct_keywords.text 'Boronic acids, Medicinal chemistry, stilbene, covalent ligand, TRANSPORT PROTEIN' _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 75 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ALA _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 82 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 74 _struct_conf.end_auth_comp_id ALA _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 81 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 4 ? AA3 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 24 ? PRO A 25 ? SER A 23 PRO A 24 AA1 2 LEU A 13 ? ASP A 19 ? LEU A 12 ASP A 18 AA1 3 GLU A 55 ? LEU A 56 ? GLU A 54 LEU A 55 AA2 1 SER A 24 ? PRO A 25 ? SER A 23 PRO A 24 AA2 2 LEU A 13 ? ASP A 19 ? LEU A 12 ASP A 18 AA2 3 ARG A 105 ? SER A 113 ? ARG A 104 SER A 112 AA2 4 SER A 116 ? THR A 124 ? SER A 115 THR A 123 AA3 1 TRP A 42 ? LYS A 49 ? TRP A 41 LYS A 48 AA3 2 ALA A 30 ? LYS A 36 ? ALA A 29 LYS A 35 AA3 3 GLY A 68 ? ILE A 74 ? GLY A 67 ILE A 73 AA3 4 ALA A 92 ? ALA A 98 ? ALA A 91 ALA A 97 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O SER A 24 ? O SER A 23 N ASP A 19 ? N ASP A 18 AA1 2 3 N VAL A 15 ? N VAL A 14 O LEU A 56 ? O LEU A 55 AA2 1 2 O SER A 24 ? O SER A 23 N ASP A 19 ? N ASP A 18 AA2 2 3 N LEU A 18 ? N LEU A 17 O ALA A 110 ? O ALA A 109 AA2 3 4 N SER A 113 ? N SER A 112 O SER A 116 ? O SER A 115 AA3 1 2 O ALA A 46 ? O ALA A 45 N VAL A 33 ? N VAL A 32 AA3 2 3 N HIS A 32 ? N HIS A 31 O GLU A 73 ? O GLU A 72 AA3 3 4 N ILE A 74 ? N ILE A 73 O ALA A 92 ? O ALA A 91 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id S2L _struct_site.pdbx_auth_seq_id 200 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 3 _struct_site.details 'binding site for residue S2L A 200' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 ALA A 109 ? ALA A 108 . ? 3_756 ? 2 AC1 3 SER A 118 ? SER A 117 . ? 3_756 ? 3 AC1 3 SER A 118 ? SER A 117 . ? 1_555 ? # _atom_sites.entry_id 5U49 _atom_sites.fract_transf_matrix[1][1] 0.022463 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015176 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011821 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CL N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 ? ? ? A . n A 1 2 GLY 2 1 ? ? ? A . n A 1 3 PRO 3 2 ? ? ? A . n A 1 4 THR 4 3 ? ? ? A . n A 1 5 GLY 5 4 ? ? ? A . n A 1 6 THR 6 5 ? ? ? A . n A 1 7 GLY 7 6 ? ? ? A . n A 1 8 GLU 8 7 ? ? ? A . n A 1 9 SER 9 8 ? ? ? A . n A 1 10 LYS 10 9 ? ? ? A . n A 1 11 CYS 11 10 10 CYS CYS A . n A 1 12 PRO 12 11 11 PRO PRO A . n A 1 13 LEU 13 12 12 LEU LEU A . n A 1 14 MET 14 13 13 MET MET A . n A 1 15 VAL 15 14 14 VAL VAL A . n A 1 16 LYS 16 15 15 LYS LYS A . n A 1 17 VAL 17 16 16 VAL VAL A . n A 1 18 LEU 18 17 17 LEU LEU A . n A 1 19 ASP 19 18 18 ASP ASP A . n A 1 20 ALA 20 19 19 ALA ALA A . n A 1 21 VAL 21 20 20 VAL VAL A . n A 1 22 ARG 22 21 21 ARG ARG A . n A 1 23 GLY 23 22 22 GLY GLY A . n A 1 24 SER 24 23 23 SER SER A . n A 1 25 PRO 25 24 24 PRO PRO A . n A 1 26 ALA 26 25 25 ALA ALA A . n A 1 27 ILE 27 26 26 ILE ILE A . n A 1 28 ASN 28 27 27 ASN ASN A . n A 1 29 VAL 29 28 28 VAL VAL A . n A 1 30 ALA 30 29 29 ALA ALA A . n A 1 31 VAL 31 30 30 VAL VAL A . n A 1 32 HIS 32 31 31 HIS HIS A . n A 1 33 VAL 33 32 32 VAL VAL A . n A 1 34 PHE 34 33 33 PHE PHE A . n A 1 35 ARG 35 34 34 ARG ARG A . n A 1 36 LYS 36 35 35 LYS LYS A . n A 1 37 ALA 37 36 36 ALA ALA A . n A 1 38 ALA 38 37 37 ALA ALA A . n A 1 39 ASP 39 38 38 ASP ASP A . n A 1 40 ASP 40 39 39 ASP ASP A . n A 1 41 THR 41 40 40 THR THR A . n A 1 42 TRP 42 41 41 TRP TRP A . n A 1 43 GLU 43 42 42 GLU GLU A . n A 1 44 PRO 44 43 43 PRO PRO A . n A 1 45 PHE 45 44 44 PHE PHE A . n A 1 46 ALA 46 45 45 ALA ALA A . n A 1 47 SER 47 46 46 SER SER A . n A 1 48 GLY 48 47 47 GLY GLY A . n A 1 49 LYS 49 48 48 LYS LYS A . n A 1 50 THR 50 49 49 THR THR A . n A 1 51 SER 51 50 50 SER SER A . n A 1 52 GLU 52 51 51 GLU GLU A . n A 1 53 SER 53 52 52 SER SER A . n A 1 54 GLY 54 53 53 GLY GLY A . n A 1 55 GLU 55 54 54 GLU GLU A . n A 1 56 LEU 56 55 55 LEU LEU A . n A 1 57 HIS 57 56 56 HIS HIS A . n A 1 58 GLY 58 57 57 GLY GLY A . n A 1 59 LEU 59 58 58 LEU LEU A . n A 1 60 THR 60 59 59 THR THR A . n A 1 61 THR 61 60 60 THR THR A . n A 1 62 GLU 62 61 61 GLU GLU A . n A 1 63 GLU 63 62 62 GLU GLU A . n A 1 64 GLU 64 63 63 GLU GLU A . n A 1 65 PHE 65 64 64 PHE PHE A . n A 1 66 VAL 66 65 65 VAL VAL A . n A 1 67 GLU 67 66 66 GLU GLU A . n A 1 68 GLY 68 67 67 GLY GLY A . n A 1 69 ILE 69 68 68 ILE ILE A . n A 1 70 TYR 70 69 69 TYR TYR A . n A 1 71 LYS 71 70 70 LYS LYS A . n A 1 72 VAL 72 71 71 VAL VAL A . n A 1 73 GLU 73 72 72 GLU GLU A . n A 1 74 ILE 74 73 73 ILE ILE A . n A 1 75 ASP 75 74 74 ASP ASP A . n A 1 76 THR 76 75 75 THR THR A . n A 1 77 LYS 77 76 76 LYS LYS A . n A 1 78 SER 78 77 77 SER SER A . n A 1 79 TYR 79 78 78 TYR TYR A . n A 1 80 TRP 80 79 79 TRP TRP A . n A 1 81 LYS 81 80 80 LYS LYS A . n A 1 82 ALA 82 81 81 ALA ALA A . n A 1 83 LEU 83 82 82 LEU LEU A . n A 1 84 GLY 84 83 83 GLY GLY A . n A 1 85 ILE 85 84 84 ILE ILE A . n A 1 86 SER 86 85 85 SER SER A . n A 1 87 PRO 87 86 86 PRO PRO A . n A 1 88 PHE 88 87 87 PHE PHE A . n A 1 89 HIS 89 88 88 HIS HIS A . n A 1 90 GLU 90 89 89 GLU GLU A . n A 1 91 HIS 91 90 90 HIS HIS A . n A 1 92 ALA 92 91 91 ALA ALA A . n A 1 93 GLU 93 92 92 GLU GLU A . n A 1 94 VAL 94 93 93 VAL VAL A . n A 1 95 VAL 95 94 94 VAL VAL A . n A 1 96 PHE 96 95 95 PHE PHE A . n A 1 97 THR 97 96 96 THR THR A . n A 1 98 ALA 98 97 97 ALA ALA A . n A 1 99 ASN 99 98 98 ASN ASN A . n A 1 100 ASP 100 99 99 ASP ASP A . n A 1 101 SER 101 100 100 SER SER A . n A 1 102 GLY 102 101 101 GLY GLY A . n A 1 103 PRO 103 102 102 PRO PRO A . n A 1 104 ARG 104 103 103 ARG ARG A . n A 1 105 ARG 105 104 104 ARG ARG A . n A 1 106 TYR 106 105 105 TYR TYR A . n A 1 107 THR 107 106 106 THR THR A . n A 1 108 ILE 108 107 107 ILE ILE A . n A 1 109 ALA 109 108 108 ALA ALA A . n A 1 110 ALA 110 109 109 ALA ALA A . n A 1 111 LEU 111 110 110 LEU LEU A . n A 1 112 LEU 112 111 111 LEU LEU A . n A 1 113 SER 113 112 112 SER SER A . n A 1 114 PRO 114 113 113 PRO PRO A . n A 1 115 TYR 115 114 114 TYR TYR A . n A 1 116 SER 116 115 115 SER SER A . n A 1 117 TYR 117 116 116 TYR TYR A . n A 1 118 SER 118 117 117 SER SER A . n A 1 119 THR 119 118 118 THR THR A . n A 1 120 THR 120 119 119 THR THR A . n A 1 121 ALA 121 120 120 ALA ALA A . n A 1 122 VAL 122 121 121 VAL VAL A . n A 1 123 VAL 123 122 122 VAL VAL A . n A 1 124 THR 124 123 123 THR THR A . n A 1 125 ASN 125 124 124 ASN ASN A . n A 1 126 PRO 126 125 125 PRO PRO A . n A 1 127 LYS 127 126 ? ? ? A . n A 1 128 GLU 128 127 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 S2L 1 200 200 S2L S2L A . C 3 HOH 1 301 2 HOH HOH A . C 3 HOH 2 302 11 HOH HOH A . C 3 HOH 3 303 1 HOH HOH A . C 3 HOH 4 304 5 HOH HOH A . C 3 HOH 5 305 10 HOH HOH A . C 3 HOH 6 306 3 HOH HOH A . C 3 HOH 7 307 6 HOH HOH A . C 3 HOH 8 308 4 HOH HOH A . C 3 HOH 9 309 9 HOH HOH A . C 3 HOH 10 310 8 HOH HOH A . C 3 HOH 11 311 7 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C 1 2 A,B,C 1 3 A,B,C 1 4 A,B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_775 -x+2,-y+2,z -1.0000000000 0.0000000000 0.0000000000 89.0340000000 0.0000000000 -1.0000000000 0.0000000000 131.7900000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_756 -x+2,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 89.0340000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 84.5940000000 4 'crystal symmetry operation' 4_576 x,-y+2,-z+1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 131.7900000000 0.0000000000 0.0000000000 -1.0000000000 84.5940000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id S2L _pdbx_struct_special_symmetry.auth_seq_id 200 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id B _pdbx_struct_special_symmetry.label_comp_id S2L _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-09-27 2 'Structure model' 1 1 2017-10-11 3 'Structure model' 1 2 2018-04-18 4 'Structure model' 1 3 2019-11-27 5 'Structure model' 1 4 2023-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 4 'Structure model' 'Author supporting evidence' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Database references' 7 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' diffrn_detector 3 4 'Structure model' pdbx_audit_support 4 4 'Structure model' pdbx_struct_special_symmetry 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' database_2 8 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 3 'Structure model' '_diffrn_detector.detector' 5 4 'Structure model' '_pdbx_audit_support.funding_organization' 6 5 'Structure model' '_database_2.pdbx_DOI' 7 5 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 50 ? ? -73.01 -163.86 2 1 HIS A 90 ? ? 175.57 179.39 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 0 ? A MET 1 2 1 Y 1 A GLY 1 ? A GLY 2 3 1 Y 1 A PRO 2 ? A PRO 3 4 1 Y 1 A THR 3 ? A THR 4 5 1 Y 1 A GLY 4 ? A GLY 5 6 1 Y 1 A THR 5 ? A THR 6 7 1 Y 1 A GLY 6 ? A GLY 7 8 1 Y 1 A GLU 7 ? A GLU 8 9 1 Y 1 A SER 8 ? A SER 9 10 1 Y 1 A LYS 9 ? A LYS 10 11 1 Y 1 A LYS 126 ? A LYS 127 12 1 Y 1 A GLU 127 ? A GLU 128 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLU N N N N 88 GLU CA C N S 89 GLU C C N N 90 GLU O O N N 91 GLU CB C N N 92 GLU CG C N N 93 GLU CD C N N 94 GLU OE1 O N N 95 GLU OE2 O N N 96 GLU OXT O N N 97 GLU H H N N 98 GLU H2 H N N 99 GLU HA H N N 100 GLU HB2 H N N 101 GLU HB3 H N N 102 GLU HG2 H N N 103 GLU HG3 H N N 104 GLU HE2 H N N 105 GLU HXT H N N 106 GLY N N N N 107 GLY CA C N N 108 GLY C C N N 109 GLY O O N N 110 GLY OXT O N N 111 GLY H H N N 112 GLY H2 H N N 113 GLY HA2 H N N 114 GLY HA3 H N N 115 GLY HXT H N N 116 HIS N N N N 117 HIS CA C N S 118 HIS C C N N 119 HIS O O N N 120 HIS CB C N N 121 HIS CG C Y N 122 HIS ND1 N Y N 123 HIS CD2 C Y N 124 HIS CE1 C Y N 125 HIS NE2 N Y N 126 HIS OXT O N N 127 HIS H H N N 128 HIS H2 H N N 129 HIS HA H N N 130 HIS HB2 H N N 131 HIS HB3 H N N 132 HIS HD1 H N N 133 HIS HD2 H N N 134 HIS HE1 H N N 135 HIS HE2 H N N 136 HIS HXT H N N 137 HOH O O N N 138 HOH H1 H N N 139 HOH H2 H N N 140 ILE N N N N 141 ILE CA C N S 142 ILE C C N N 143 ILE O O N N 144 ILE CB C N S 145 ILE CG1 C N N 146 ILE CG2 C N N 147 ILE CD1 C N N 148 ILE OXT O N N 149 ILE H H N N 150 ILE H2 H N N 151 ILE HA H N N 152 ILE HB H N N 153 ILE HG12 H N N 154 ILE HG13 H N N 155 ILE HG21 H N N 156 ILE HG22 H N N 157 ILE HG23 H N N 158 ILE HD11 H N N 159 ILE HD12 H N N 160 ILE HD13 H N N 161 ILE HXT H N N 162 LEU N N N N 163 LEU CA C N S 164 LEU C C N N 165 LEU O O N N 166 LEU CB C N N 167 LEU CG C N N 168 LEU CD1 C N N 169 LEU CD2 C N N 170 LEU OXT O N N 171 LEU H H N N 172 LEU H2 H N N 173 LEU HA H N N 174 LEU HB2 H N N 175 LEU HB3 H N N 176 LEU HG H N N 177 LEU HD11 H N N 178 LEU HD12 H N N 179 LEU HD13 H N N 180 LEU HD21 H N N 181 LEU HD22 H N N 182 LEU HD23 H N N 183 LEU HXT H N N 184 LYS N N N N 185 LYS CA C N S 186 LYS C C N N 187 LYS O O N N 188 LYS CB C N N 189 LYS CG C N N 190 LYS CD C N N 191 LYS CE C N N 192 LYS NZ N N N 193 LYS OXT O N N 194 LYS H H N N 195 LYS H2 H N N 196 LYS HA H N N 197 LYS HB2 H N N 198 LYS HB3 H N N 199 LYS HG2 H N N 200 LYS HG3 H N N 201 LYS HD2 H N N 202 LYS HD3 H N N 203 LYS HE2 H N N 204 LYS HE3 H N N 205 LYS HZ1 H N N 206 LYS HZ2 H N N 207 LYS HZ3 H N N 208 LYS HXT H N N 209 MET N N N N 210 MET CA C N S 211 MET C C N N 212 MET O O N N 213 MET CB C N N 214 MET CG C N N 215 MET SD S N N 216 MET CE C N N 217 MET OXT O N N 218 MET H H N N 219 MET H2 H N N 220 MET HA H N N 221 MET HB2 H N N 222 MET HB3 H N N 223 MET HG2 H N N 224 MET HG3 H N N 225 MET HE1 H N N 226 MET HE2 H N N 227 MET HE3 H N N 228 MET HXT H N N 229 PHE N N N N 230 PHE CA C N S 231 PHE C C N N 232 PHE O O N N 233 PHE CB C N N 234 PHE CG C Y N 235 PHE CD1 C Y N 236 PHE CD2 C Y N 237 PHE CE1 C Y N 238 PHE CE2 C Y N 239 PHE CZ C Y N 240 PHE OXT O N N 241 PHE H H N N 242 PHE H2 H N N 243 PHE HA H N N 244 PHE HB2 H N N 245 PHE HB3 H N N 246 PHE HD1 H N N 247 PHE HD2 H N N 248 PHE HE1 H N N 249 PHE HE2 H N N 250 PHE HZ H N N 251 PHE HXT H N N 252 PRO N N N N 253 PRO CA C N S 254 PRO C C N N 255 PRO O O N N 256 PRO CB C N N 257 PRO CG C N N 258 PRO CD C N N 259 PRO OXT O N N 260 PRO H H N N 261 PRO HA H N N 262 PRO HB2 H N N 263 PRO HB3 H N N 264 PRO HG2 H N N 265 PRO HG3 H N N 266 PRO HD2 H N N 267 PRO HD3 H N N 268 PRO HXT H N N 269 S2L C01 C Y N 270 S2L C02 C Y N 271 S2L C03 C Y N 272 S2L C04 C Y N 273 S2L C05 C Y N 274 S2L C06 C Y N 275 S2L O01 O N N 276 S2L C07 C N N 277 S2L C08 C N N 278 S2L C09 C Y N 279 S2L C10 C Y N 280 S2L C11 C Y N 281 S2L C12 C Y N 282 S2L C13 C Y N 283 S2L C14 C Y N 284 S2L CL1 CL N N 285 S2L O02 O N N 286 S2L O03 O N N 287 S2L H1 H N N 288 S2L H2 H N N 289 S2L H3 H N N 290 S2L H4 H N N 291 S2L H5 H N N 292 S2L H6 H N N 293 S2L H7 H N N 294 S2L H8 H N N 295 S2L H9 H N N 296 S2L H10 H N N 297 S2L H11 H N N 298 SER N N N N 299 SER CA C N S 300 SER C C N N 301 SER O O N N 302 SER CB C N N 303 SER OG O N N 304 SER OXT O N N 305 SER H H N N 306 SER H2 H N N 307 SER HA H N N 308 SER HB2 H N N 309 SER HB3 H N N 310 SER HG H N N 311 SER HXT H N N 312 THR N N N N 313 THR CA C N S 314 THR C C N N 315 THR O O N N 316 THR CB C N R 317 THR OG1 O N N 318 THR CG2 C N N 319 THR OXT O N N 320 THR H H N N 321 THR H2 H N N 322 THR HA H N N 323 THR HB H N N 324 THR HG1 H N N 325 THR HG21 H N N 326 THR HG22 H N N 327 THR HG23 H N N 328 THR HXT H N N 329 TRP N N N N 330 TRP CA C N S 331 TRP C C N N 332 TRP O O N N 333 TRP CB C N N 334 TRP CG C Y N 335 TRP CD1 C Y N 336 TRP CD2 C Y N 337 TRP NE1 N Y N 338 TRP CE2 C Y N 339 TRP CE3 C Y N 340 TRP CZ2 C Y N 341 TRP CZ3 C Y N 342 TRP CH2 C Y N 343 TRP OXT O N N 344 TRP H H N N 345 TRP H2 H N N 346 TRP HA H N N 347 TRP HB2 H N N 348 TRP HB3 H N N 349 TRP HD1 H N N 350 TRP HE1 H N N 351 TRP HE3 H N N 352 TRP HZ2 H N N 353 TRP HZ3 H N N 354 TRP HH2 H N N 355 TRP HXT H N N 356 TYR N N N N 357 TYR CA C N S 358 TYR C C N N 359 TYR O O N N 360 TYR CB C N N 361 TYR CG C Y N 362 TYR CD1 C Y N 363 TYR CD2 C Y N 364 TYR CE1 C Y N 365 TYR CE2 C Y N 366 TYR CZ C Y N 367 TYR OH O N N 368 TYR OXT O N N 369 TYR H H N N 370 TYR H2 H N N 371 TYR HA H N N 372 TYR HB2 H N N 373 TYR HB3 H N N 374 TYR HD1 H N N 375 TYR HD2 H N N 376 TYR HE1 H N N 377 TYR HE2 H N N 378 TYR HH H N N 379 TYR HXT H N N 380 VAL N N N N 381 VAL CA C N S 382 VAL C C N N 383 VAL O O N N 384 VAL CB C N N 385 VAL CG1 C N N 386 VAL CG2 C N N 387 VAL OXT O N N 388 VAL H H N N 389 VAL H2 H N N 390 VAL HA H N N 391 VAL HB H N N 392 VAL HG11 H N N 393 VAL HG12 H N N 394 VAL HG13 H N N 395 VAL HG21 H N N 396 VAL HG22 H N N 397 VAL HG23 H N N 398 VAL HXT H N N 399 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLU N CA sing N N 83 GLU N H sing N N 84 GLU N H2 sing N N 85 GLU CA C sing N N 86 GLU CA CB sing N N 87 GLU CA HA sing N N 88 GLU C O doub N N 89 GLU C OXT sing N N 90 GLU CB CG sing N N 91 GLU CB HB2 sing N N 92 GLU CB HB3 sing N N 93 GLU CG CD sing N N 94 GLU CG HG2 sing N N 95 GLU CG HG3 sing N N 96 GLU CD OE1 doub N N 97 GLU CD OE2 sing N N 98 GLU OE2 HE2 sing N N 99 GLU OXT HXT sing N N 100 GLY N CA sing N N 101 GLY N H sing N N 102 GLY N H2 sing N N 103 GLY CA C sing N N 104 GLY CA HA2 sing N N 105 GLY CA HA3 sing N N 106 GLY C O doub N N 107 GLY C OXT sing N N 108 GLY OXT HXT sing N N 109 HIS N CA sing N N 110 HIS N H sing N N 111 HIS N H2 sing N N 112 HIS CA C sing N N 113 HIS CA CB sing N N 114 HIS CA HA sing N N 115 HIS C O doub N N 116 HIS C OXT sing N N 117 HIS CB CG sing N N 118 HIS CB HB2 sing N N 119 HIS CB HB3 sing N N 120 HIS CG ND1 sing Y N 121 HIS CG CD2 doub Y N 122 HIS ND1 CE1 doub Y N 123 HIS ND1 HD1 sing N N 124 HIS CD2 NE2 sing Y N 125 HIS CD2 HD2 sing N N 126 HIS CE1 NE2 sing Y N 127 HIS CE1 HE1 sing N N 128 HIS NE2 HE2 sing N N 129 HIS OXT HXT sing N N 130 HOH O H1 sing N N 131 HOH O H2 sing N N 132 ILE N CA sing N N 133 ILE N H sing N N 134 ILE N H2 sing N N 135 ILE CA C sing N N 136 ILE CA CB sing N N 137 ILE CA HA sing N N 138 ILE C O doub N N 139 ILE C OXT sing N N 140 ILE CB CG1 sing N N 141 ILE CB CG2 sing N N 142 ILE CB HB sing N N 143 ILE CG1 CD1 sing N N 144 ILE CG1 HG12 sing N N 145 ILE CG1 HG13 sing N N 146 ILE CG2 HG21 sing N N 147 ILE CG2 HG22 sing N N 148 ILE CG2 HG23 sing N N 149 ILE CD1 HD11 sing N N 150 ILE CD1 HD12 sing N N 151 ILE CD1 HD13 sing N N 152 ILE OXT HXT sing N N 153 LEU N CA sing N N 154 LEU N H sing N N 155 LEU N H2 sing N N 156 LEU CA C sing N N 157 LEU CA CB sing N N 158 LEU CA HA sing N N 159 LEU C O doub N N 160 LEU C OXT sing N N 161 LEU CB CG sing N N 162 LEU CB HB2 sing N N 163 LEU CB HB3 sing N N 164 LEU CG CD1 sing N N 165 LEU CG CD2 sing N N 166 LEU CG HG sing N N 167 LEU CD1 HD11 sing N N 168 LEU CD1 HD12 sing N N 169 LEU CD1 HD13 sing N N 170 LEU CD2 HD21 sing N N 171 LEU CD2 HD22 sing N N 172 LEU CD2 HD23 sing N N 173 LEU OXT HXT sing N N 174 LYS N CA sing N N 175 LYS N H sing N N 176 LYS N H2 sing N N 177 LYS CA C sing N N 178 LYS CA CB sing N N 179 LYS CA HA sing N N 180 LYS C O doub N N 181 LYS C OXT sing N N 182 LYS CB CG sing N N 183 LYS CB HB2 sing N N 184 LYS CB HB3 sing N N 185 LYS CG CD sing N N 186 LYS CG HG2 sing N N 187 LYS CG HG3 sing N N 188 LYS CD CE sing N N 189 LYS CD HD2 sing N N 190 LYS CD HD3 sing N N 191 LYS CE NZ sing N N 192 LYS CE HE2 sing N N 193 LYS CE HE3 sing N N 194 LYS NZ HZ1 sing N N 195 LYS NZ HZ2 sing N N 196 LYS NZ HZ3 sing N N 197 LYS OXT HXT sing N N 198 MET N CA sing N N 199 MET N H sing N N 200 MET N H2 sing N N 201 MET CA C sing N N 202 MET CA CB sing N N 203 MET CA HA sing N N 204 MET C O doub N N 205 MET C OXT sing N N 206 MET CB CG sing N N 207 MET CB HB2 sing N N 208 MET CB HB3 sing N N 209 MET CG SD sing N N 210 MET CG HG2 sing N N 211 MET CG HG3 sing N N 212 MET SD CE sing N N 213 MET CE HE1 sing N N 214 MET CE HE2 sing N N 215 MET CE HE3 sing N N 216 MET OXT HXT sing N N 217 PHE N CA sing N N 218 PHE N H sing N N 219 PHE N H2 sing N N 220 PHE CA C sing N N 221 PHE CA CB sing N N 222 PHE CA HA sing N N 223 PHE C O doub N N 224 PHE C OXT sing N N 225 PHE CB CG sing N N 226 PHE CB HB2 sing N N 227 PHE CB HB3 sing N N 228 PHE CG CD1 doub Y N 229 PHE CG CD2 sing Y N 230 PHE CD1 CE1 sing Y N 231 PHE CD1 HD1 sing N N 232 PHE CD2 CE2 doub Y N 233 PHE CD2 HD2 sing N N 234 PHE CE1 CZ doub Y N 235 PHE CE1 HE1 sing N N 236 PHE CE2 CZ sing Y N 237 PHE CE2 HE2 sing N N 238 PHE CZ HZ sing N N 239 PHE OXT HXT sing N N 240 PRO N CA sing N N 241 PRO N CD sing N N 242 PRO N H sing N N 243 PRO CA C sing N N 244 PRO CA CB sing N N 245 PRO CA HA sing N N 246 PRO C O doub N N 247 PRO C OXT sing N N 248 PRO CB CG sing N N 249 PRO CB HB2 sing N N 250 PRO CB HB3 sing N N 251 PRO CG CD sing N N 252 PRO CG HG2 sing N N 253 PRO CG HG3 sing N N 254 PRO CD HD2 sing N N 255 PRO CD HD3 sing N N 256 PRO OXT HXT sing N N 257 S2L C11 C10 doub Y N 258 S2L C11 C12 sing Y N 259 S2L O03 C02 sing N N 260 S2L C10 C09 sing Y N 261 S2L C02 C03 doub Y N 262 S2L C02 C01 sing Y N 263 S2L C03 C04 sing Y N 264 S2L O02 C12 sing N N 265 S2L C12 C13 doub Y N 266 S2L C08 C09 sing N N 267 S2L C08 C07 doub N E 268 S2L C09 C14 doub Y N 269 S2L C01 C06 doub Y N 270 S2L C04 C07 sing N N 271 S2L C04 C05 doub Y N 272 S2L C13 C14 sing Y N 273 S2L C05 C06 sing Y N 274 S2L C06 O01 sing N N 275 S2L C14 CL1 sing N N 276 S2L C01 H1 sing N N 277 S2L C03 H2 sing N N 278 S2L C05 H3 sing N N 279 S2L O01 H4 sing N N 280 S2L C07 H5 sing N N 281 S2L C08 H6 sing N N 282 S2L C10 H7 sing N N 283 S2L C11 H8 sing N N 284 S2L C13 H9 sing N N 285 S2L O02 H10 sing N N 286 S2L O03 H11 sing N N 287 SER N CA sing N N 288 SER N H sing N N 289 SER N H2 sing N N 290 SER CA C sing N N 291 SER CA CB sing N N 292 SER CA HA sing N N 293 SER C O doub N N 294 SER C OXT sing N N 295 SER CB OG sing N N 296 SER CB HB2 sing N N 297 SER CB HB3 sing N N 298 SER OG HG sing N N 299 SER OXT HXT sing N N 300 THR N CA sing N N 301 THR N H sing N N 302 THR N H2 sing N N 303 THR CA C sing N N 304 THR CA CB sing N N 305 THR CA HA sing N N 306 THR C O doub N N 307 THR C OXT sing N N 308 THR CB OG1 sing N N 309 THR CB CG2 sing N N 310 THR CB HB sing N N 311 THR OG1 HG1 sing N N 312 THR CG2 HG21 sing N N 313 THR CG2 HG22 sing N N 314 THR CG2 HG23 sing N N 315 THR OXT HXT sing N N 316 TRP N CA sing N N 317 TRP N H sing N N 318 TRP N H2 sing N N 319 TRP CA C sing N N 320 TRP CA CB sing N N 321 TRP CA HA sing N N 322 TRP C O doub N N 323 TRP C OXT sing N N 324 TRP CB CG sing N N 325 TRP CB HB2 sing N N 326 TRP CB HB3 sing N N 327 TRP CG CD1 doub Y N 328 TRP CG CD2 sing Y N 329 TRP CD1 NE1 sing Y N 330 TRP CD1 HD1 sing N N 331 TRP CD2 CE2 doub Y N 332 TRP CD2 CE3 sing Y N 333 TRP NE1 CE2 sing Y N 334 TRP NE1 HE1 sing N N 335 TRP CE2 CZ2 sing Y N 336 TRP CE3 CZ3 doub Y N 337 TRP CE3 HE3 sing N N 338 TRP CZ2 CH2 doub Y N 339 TRP CZ2 HZ2 sing N N 340 TRP CZ3 CH2 sing Y N 341 TRP CZ3 HZ3 sing N N 342 TRP CH2 HH2 sing N N 343 TRP OXT HXT sing N N 344 TYR N CA sing N N 345 TYR N H sing N N 346 TYR N H2 sing N N 347 TYR CA C sing N N 348 TYR CA CB sing N N 349 TYR CA HA sing N N 350 TYR C O doub N N 351 TYR C OXT sing N N 352 TYR CB CG sing N N 353 TYR CB HB2 sing N N 354 TYR CB HB3 sing N N 355 TYR CG CD1 doub Y N 356 TYR CG CD2 sing Y N 357 TYR CD1 CE1 sing Y N 358 TYR CD1 HD1 sing N N 359 TYR CD2 CE2 doub Y N 360 TYR CD2 HD2 sing N N 361 TYR CE1 CZ doub Y N 362 TYR CE1 HE1 sing N N 363 TYR CE2 CZ sing Y N 364 TYR CE2 HE2 sing N N 365 TYR CZ OH sing N N 366 TYR OH HH sing N N 367 TYR OXT HXT sing N N 368 VAL N CA sing N N 369 VAL N H sing N N 370 VAL N H2 sing N N 371 VAL CA C sing N N 372 VAL CA CB sing N N 373 VAL CA HA sing N N 374 VAL C O doub N N 375 VAL C OXT sing N N 376 VAL CB CG1 sing N N 377 VAL CB CG2 sing N N 378 VAL CB HB sing N N 379 VAL CG1 HG11 sing N N 380 VAL CG1 HG12 sing N N 381 VAL CG1 HG13 sing N N 382 VAL CG2 HG21 sing N N 383 VAL CG2 HG22 sing N N 384 VAL CG2 HG23 sing N N 385 VAL OXT HXT sing N N 386 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 'T32 GM008349' 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 'R01 GM044783' 2 'National Science Foundation (NSF, United States)' 'United States' 'MCB 1518160' 3 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '5-[(E)-2-(2-chloro-4-hydroxyphenyl)ethenyl]benzene-1,3-diol' S2L 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2QGB _pdbx_initial_refinement_model.details 'pdbid 2QGB' #