data_5U87 # _entry.id 5U87 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5U87 pdb_00005u87 10.2210/pdb5u87/pdb WWPDB D_1000224959 ? ? BMRB 30209 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'NMR structure of the precursor protein PawS1 comprising SFTI-1 and a seed storage albumin' _pdbx_database_related.db_id 30209 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5U87 _pdbx_database_status.recvd_initial_deposition_date 2016-12-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Franke, B.' 1 ? 'James, A.M.' 2 ? 'Mobli, M.' 3 ? 'Colgrave, M.L.' 4 ? 'Mylne, J.S.' 5 ? 'Rosengren, K.J.' 6 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'to be published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'NMR structure of the precursor protein PawS1 comprising SFTI-1 and a seed storage albumin' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Franke, B.' 1 ? primary 'James, A.M.' 2 ? primary 'Mobli, M.' 3 ? primary 'Colgrave, M.L.' 4 ? primary 'Mylne, J.S.' 5 ? primary 'Rosengren, K.J.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Preproalbumin PawS1' _entity.formula_weight 13280.334 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 36-151' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GRCTKSIPPICFPDGLDNPRGCQIRIQQLNHCQMHLTSFDYKLRMAVENPKQQQHLSLCCNQLQEVEKQCQCEAIKQVVE QAQKQLQQGQGGQQQVQQMVKKAQMLPNQCNLQCSI ; _entity_poly.pdbx_seq_one_letter_code_can ;GRCTKSIPPICFPDGLDNPRGCQIRIQQLNHCQMHLTSFDYKLRMAVENPKQQQHLSLCCNQLQEVEKQCQCEAIKQVVE QAQKQLQQGQGGQQQVQQMVKKAQMLPNQCNLQCSI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ARG n 1 3 CYS n 1 4 THR n 1 5 LYS n 1 6 SER n 1 7 ILE n 1 8 PRO n 1 9 PRO n 1 10 ILE n 1 11 CYS n 1 12 PHE n 1 13 PRO n 1 14 ASP n 1 15 GLY n 1 16 LEU n 1 17 ASP n 1 18 ASN n 1 19 PRO n 1 20 ARG n 1 21 GLY n 1 22 CYS n 1 23 GLN n 1 24 ILE n 1 25 ARG n 1 26 ILE n 1 27 GLN n 1 28 GLN n 1 29 LEU n 1 30 ASN n 1 31 HIS n 1 32 CYS n 1 33 GLN n 1 34 MET n 1 35 HIS n 1 36 LEU n 1 37 THR n 1 38 SER n 1 39 PHE n 1 40 ASP n 1 41 TYR n 1 42 LYS n 1 43 LEU n 1 44 ARG n 1 45 MET n 1 46 ALA n 1 47 VAL n 1 48 GLU n 1 49 ASN n 1 50 PRO n 1 51 LYS n 1 52 GLN n 1 53 GLN n 1 54 GLN n 1 55 HIS n 1 56 LEU n 1 57 SER n 1 58 LEU n 1 59 CYS n 1 60 CYS n 1 61 ASN n 1 62 GLN n 1 63 LEU n 1 64 GLN n 1 65 GLU n 1 66 VAL n 1 67 GLU n 1 68 LYS n 1 69 GLN n 1 70 CYS n 1 71 GLN n 1 72 CYS n 1 73 GLU n 1 74 ALA n 1 75 ILE n 1 76 LYS n 1 77 GLN n 1 78 VAL n 1 79 VAL n 1 80 GLU n 1 81 GLN n 1 82 ALA n 1 83 GLN n 1 84 LYS n 1 85 GLN n 1 86 LEU n 1 87 GLN n 1 88 GLN n 1 89 GLY n 1 90 GLN n 1 91 GLY n 1 92 GLY n 1 93 GLN n 1 94 GLN n 1 95 GLN n 1 96 VAL n 1 97 GLN n 1 98 GLN n 1 99 MET n 1 100 VAL n 1 101 LYS n 1 102 LYS n 1 103 ALA n 1 104 GLN n 1 105 MET n 1 106 LEU n 1 107 PRO n 1 108 ASN n 1 109 GLN n 1 110 CYS n 1 111 ASN n 1 112 LEU n 1 113 GLN n 1 114 CYS n 1 115 SER n 1 116 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 116 _entity_src_gen.gene_src_common_name 'Common sunflower' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PawS1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Helianthus annuus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4232 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code H2L0T2_HELAN _struct_ref.pdbx_db_accession H2L0T2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GRCTKSIPPICFPDGLDNPRGCQIRIQQLNHCQMHLTSFDYKLRMAVENPKQQQHLSLCCNQLQEVEKQCQCEAIKQVVE QAQKQLQQGQGGQQQVQQMVKKAQMLPNQCNLQCSI ; _struct_ref.pdbx_align_begin 36 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5U87 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 116 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession H2L0T2 _struct_ref_seq.db_align_beg 36 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 151 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 116 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-13C HSQC' 1 isotropic 3 1 1 '3D HNCACB' 1 isotropic 4 1 1 '3D CBCA(CO)NH' 1 isotropic 5 1 1 '3D HNCO' 1 isotropic 6 1 1 '3D HBHA(CO)NH' 1 isotropic 7 1 1 '3D H(CC)(CO)NH-TOCSY' 1 isotropic 8 1 1 '3D (H)CC(CO)NH-TOCSY' 1 isotropic 9 1 1 '3D 1H-15N NOESY' 1 isotropic 10 1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic 11 1 1 '3D 1H-13C NOESY aromatic' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units bar _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 4.62 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label 'Proalbumin PawS1' _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '3.9 mg/mL [U-13C; U-15N] Proalbumin PawS1, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 'Proalbumin PawS1' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details 'equipped with cryoprobe' # _pdbx_nmr_refine.entry_id 5U87 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'Final structures were calculated and waterminimised using cartesian dynamics in CNS.' _pdbx_nmr_refine.software_ordinal 2 # _pdbx_nmr_ensemble.entry_id 5U87 _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5U87 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria molprobity # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'structure calculation' CYANA 3.0 'Guntert, Mumenthaler and Wuthrich' 2 refinement CNS 1.2 'Brunger, Adams, Clore, Gros, Nilges and Read' 3 'peak picking' CcpNMR ? CCPN 4 collection TopSpin 2.1 'Bruker Biospin' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5U87 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5U87 _struct.title 'NMR structure of the precursor protein PawS1 comprising SFTI-1 and a seed storage albumin' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5U87 _struct_keywords.text 'trypsin inhibitor, SFTI-1, seed storage albumin, Structure from MOLMOL, PLANT PROTEIN' _struct_keywords.pdbx_keywords 'PLANT PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 29 ? SER A 38 ? LEU A 29 SER A 38 1 ? 10 HELX_P HELX_P2 AA2 ASN A 49 ? GLN A 52 ? ASN A 49 GLN A 52 5 ? 4 HELX_P HELX_P3 AA3 GLN A 53 ? GLN A 64 ? GLN A 53 GLN A 64 1 ? 12 HELX_P HELX_P4 AA4 GLU A 67 ? GLN A 88 ? GLU A 67 GLN A 88 1 ? 22 HELX_P HELX_P5 AA5 GLY A 92 ? LYS A 101 ? GLY A 92 LYS A 101 1 ? 10 HELX_P HELX_P6 AA6 LYS A 102 ? GLN A 104 ? LYS A 102 GLN A 104 5 ? 3 HELX_P HELX_P7 AA7 MET A 105 ? CYS A 110 ? MET A 105 CYS A 110 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 11 SG ? ? A CYS 3 A CYS 11 1_555 ? ? ? ? ? ? ? 2.040 ? ? disulf2 disulf ? ? A CYS 22 SG ? ? ? 1_555 A CYS 70 SG ? ? A CYS 22 A CYS 70 1_555 ? ? ? ? ? ? ? 2.034 ? ? disulf3 disulf ? ? A CYS 32 SG ? ? ? 1_555 A CYS 59 SG ? ? A CYS 32 A CYS 59 1_555 ? ? ? ? ? ? ? 2.017 ? ? disulf4 disulf ? ? A CYS 60 SG ? ? ? 1_555 A CYS 110 SG ? ? A CYS 60 A CYS 110 1_555 ? ? ? ? ? ? ? 2.040 ? ? disulf5 disulf ? ? A CYS 72 SG ? ? ? 1_555 A CYS 114 SG ? ? A CYS 72 A CYS 114 1_555 ? ? ? ? ? ? ? 2.028 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ILE 7 A . ? ILE 7 A PRO 8 A ? PRO 8 A 1 0.99 2 ILE 7 A . ? ILE 7 A PRO 8 A ? PRO 8 A 2 -1.27 3 ILE 7 A . ? ILE 7 A PRO 8 A ? PRO 8 A 3 -0.95 4 ILE 7 A . ? ILE 7 A PRO 8 A ? PRO 8 A 4 -2.47 5 ILE 7 A . ? ILE 7 A PRO 8 A ? PRO 8 A 5 -1.21 6 ILE 7 A . ? ILE 7 A PRO 8 A ? PRO 8 A 6 -0.19 7 ILE 7 A . ? ILE 7 A PRO 8 A ? PRO 8 A 7 0.01 8 ILE 7 A . ? ILE 7 A PRO 8 A ? PRO 8 A 8 -1.16 9 ILE 7 A . ? ILE 7 A PRO 8 A ? PRO 8 A 9 -3.37 10 ILE 7 A . ? ILE 7 A PRO 8 A ? PRO 8 A 10 -0.76 11 ILE 7 A . ? ILE 7 A PRO 8 A ? PRO 8 A 11 -1.96 12 ILE 7 A . ? ILE 7 A PRO 8 A ? PRO 8 A 12 0.72 13 ILE 7 A . ? ILE 7 A PRO 8 A ? PRO 8 A 13 -1.24 14 ILE 7 A . ? ILE 7 A PRO 8 A ? PRO 8 A 14 1.09 15 ILE 7 A . ? ILE 7 A PRO 8 A ? PRO 8 A 15 0.65 16 ILE 7 A . ? ILE 7 A PRO 8 A ? PRO 8 A 16 -1.29 17 ILE 7 A . ? ILE 7 A PRO 8 A ? PRO 8 A 17 0.08 18 ILE 7 A . ? ILE 7 A PRO 8 A ? PRO 8 A 18 -1.27 19 ILE 7 A . ? ILE 7 A PRO 8 A ? PRO 8 A 19 -0.72 20 ILE 7 A . ? ILE 7 A PRO 8 A ? PRO 8 A 20 0.09 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 2 ? CYS A 3 ? ARG A 2 CYS A 3 AA1 2 CYS A 11 ? PHE A 12 ? CYS A 11 PHE A 12 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ARG _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 2 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ARG _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 2 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id PHE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 12 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 12 # _atom_sites.entry_id 5U87 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 MET 34 34 34 MET MET A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 MET 45 45 45 MET MET A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 HIS 55 55 55 HIS HIS A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 CYS 59 59 59 CYS CYS A . n A 1 60 CYS 60 60 60 CYS CYS A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 CYS 70 70 70 CYS CYS A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 CYS 72 72 72 CYS CYS A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 GLN 93 93 93 GLN GLN A . n A 1 94 GLN 94 94 94 GLN GLN A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 GLN 98 98 98 GLN GLN A . n A 1 99 MET 99 99 99 MET MET A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 LYS 102 102 102 LYS LYS A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 GLN 104 104 104 GLN GLN A . n A 1 105 MET 105 105 105 MET MET A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 PRO 107 107 107 PRO PRO A . n A 1 108 ASN 108 108 108 ASN ASN A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 CYS 110 110 110 CYS CYS A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 GLN 113 113 113 GLN GLN A . n A 1 114 CYS 114 114 114 CYS CYS A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 ILE 116 116 116 ILE ILE A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-03-01 2 'Structure model' 1 1 2017-09-27 3 'Structure model' 1 2 2020-01-01 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 2 'Structure model' 'Structure summary' 3 3 'Structure model' 'Author supporting evidence' 4 3 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Derived calculations' 7 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' entity 2 2 'Structure model' pdbx_audit_support 3 3 'Structure model' pdbx_audit_support 4 3 'Structure model' pdbx_nmr_software 5 3 'Structure model' pdbx_nmr_spectrometer 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_database_status 8 4 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_entity.pdbx_number_of_molecules' 2 3 'Structure model' '_pdbx_audit_support.funding_organization' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_database_2.pdbx_DOI' 6 4 'Structure model' '_database_2.pdbx_database_accession' 7 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 8 4 'Structure model' '_struct_conn.pdbx_dist_value' # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component 'Proalbumin PawS1' _pdbx_nmr_exptl_sample.concentration 3.9 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mg/mL _pdbx_nmr_exptl_sample.isotopic_labeling '[U-13C; U-15N]' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 6 HH22 A ARG 20 ? ? OE1 A GLU 80 ? ? 1.58 2 9 OD1 A ASP 40 ? ? HZ2 A LYS 42 ? ? 1.57 3 13 OD2 A ASP 40 ? ? HZ1 A LYS 42 ? ? 1.58 4 15 OE2 A GLU 73 ? ? HZ3 A LYS 76 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 47 ? ? -123.41 -70.76 2 1 GLN A 90 ? ? -158.43 -26.20 3 1 GLN A 113 ? ? -72.92 44.68 4 2 LEU A 16 ? ? -156.30 -56.72 5 2 ARG A 20 ? ? -144.16 -53.97 6 2 MET A 45 ? ? -161.67 29.88 7 2 VAL A 47 ? ? -122.39 -61.96 8 2 GLN A 113 ? ? -71.70 37.53 9 3 ASP A 14 ? ? -161.79 -148.16 10 3 LEU A 16 ? ? -141.96 -58.76 11 3 ASP A 17 ? ? -165.59 92.59 12 3 MET A 45 ? ? -155.29 26.34 13 3 GLN A 113 ? ? -74.74 31.44 14 4 MET A 45 ? ? -116.91 69.48 15 4 GLU A 48 ? ? -154.25 29.42 16 4 GLN A 90 ? ? -145.96 -58.11 17 4 GLN A 113 ? ? -72.70 35.26 18 5 ASP A 14 ? ? -139.00 -71.11 19 5 ARG A 20 ? ? -133.34 -63.87 20 5 LEU A 43 ? ? -66.22 90.63 21 5 GLN A 113 ? ? -67.20 30.66 22 6 PRO A 13 ? ? -77.79 45.96 23 6 ASP A 17 ? ? -140.71 19.25 24 6 ARG A 20 ? ? -132.26 -63.43 25 6 GLN A 113 ? ? -70.43 35.03 26 7 ASP A 14 ? ? -152.55 -64.15 27 7 LEU A 43 ? ? -80.10 37.84 28 7 VAL A 47 ? ? -93.67 -68.37 29 7 GLN A 113 ? ? -75.88 35.79 30 8 LEU A 16 ? ? -170.27 -50.49 31 8 ASP A 17 ? ? -170.08 100.65 32 8 ARG A 20 ? ? -140.91 -47.22 33 8 LEU A 43 ? ? -65.36 96.25 34 8 GLN A 113 ? ? -82.83 45.53 35 9 ASP A 14 ? ? -167.21 -169.67 36 9 ARG A 44 ? ? -105.15 -79.30 37 9 ASN A 111 ? ? 60.31 60.67 38 9 GLN A 113 ? ? -70.00 26.96 39 10 PRO A 13 ? ? -67.16 76.09 40 10 ARG A 20 ? ? -127.84 -63.20 41 10 MET A 45 ? ? -151.70 82.09 42 10 GLN A 113 ? ? -80.30 43.79 43 11 VAL A 47 ? ? -124.82 -58.56 44 11 ASN A 111 ? ? 60.56 61.45 45 11 GLN A 113 ? ? -78.87 49.79 46 12 ASP A 14 ? ? -120.20 -78.85 47 12 LEU A 16 ? ? -130.24 -44.26 48 12 ASN A 111 ? ? 60.69 61.47 49 12 GLN A 113 ? ? -81.37 43.74 50 13 PRO A 13 ? ? -77.00 42.58 51 13 TYR A 41 ? ? -149.86 -33.61 52 13 LEU A 43 ? ? -58.74 102.28 53 13 GLN A 113 ? ? -78.47 39.83 54 14 ASP A 14 ? ? -159.42 -153.34 55 14 LEU A 16 ? ? -137.49 -61.86 56 14 ARG A 20 ? ? -126.08 -50.86 57 14 GLN A 113 ? ? -74.37 35.83 58 15 ASP A 14 ? ? -152.86 -67.40 59 15 LEU A 16 ? ? -147.30 -28.84 60 15 ARG A 44 ? ? -107.08 -61.83 61 15 VAL A 47 ? ? -127.67 -73.14 62 15 GLN A 113 ? ? -78.22 31.25 63 16 LEU A 16 ? ? -175.40 146.24 64 16 ARG A 44 ? ? -98.96 -68.27 65 16 GLN A 113 ? ? -69.36 41.55 66 17 PRO A 13 ? ? -73.65 36.49 67 17 LEU A 16 ? ? -170.75 -60.39 68 17 ASN A 18 ? ? -161.25 87.03 69 17 MET A 45 ? ? -151.70 11.68 70 17 VAL A 47 ? ? -130.11 -65.10 71 17 GLN A 113 ? ? -81.08 45.10 72 18 ASN A 111 ? ? 60.00 64.33 73 18 GLN A 113 ? ? -74.32 45.28 74 19 PRO A 13 ? ? -76.38 45.32 75 19 LEU A 16 ? ? -151.40 -52.48 76 19 VAL A 47 ? ? -132.33 -57.78 77 19 GLN A 90 ? ? -150.42 -37.56 78 19 GLN A 113 ? ? -78.77 43.87 79 20 ASP A 14 ? ? -140.92 -77.41 80 20 MET A 45 ? ? -148.93 16.15 81 20 VAL A 47 ? ? -130.01 -68.17 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 7 ARG A 20 ? ? 0.077 'SIDE CHAIN' 2 20 ARG A 2 ? ? 0.077 'SIDE CHAIN' 3 20 ARG A 20 ? ? 0.135 'SIDE CHAIN' # _pdbx_audit_support.funding_organization 'Australian Research Council (ARC)' _pdbx_audit_support.country Australia _pdbx_audit_support.grant_number DP120103369 _pdbx_audit_support.ordinal 1 #