data_5UIC # _entry.id 5UIC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.321 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5UIC WWPDB D_1000225916 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5UIC _pdbx_database_status.recvd_initial_deposition_date 2017-01-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Allen, C.L.' 1 ? 'Milton, M.E.' 2 ? 'Cavanagh, J.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Mol. Microbiol.' _citation.journal_id_ASTM MOMIEE _citation.journal_id_CSD 2007 _citation.journal_id_ISSN 1365-2958 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 106 _citation.language ? _citation.page_first 223 _citation.page_last 235 _citation.title ;Structure of the Francisella response regulator QseB receiver domain, and characterization of QseB inhibition by antibiofilm 2-aminoimidazole-based compounds. ; _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1111/mmi.13759 _citation.pdbx_database_id_PubMed 28755524 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Milton, M.E.' 1 ? primary 'Allen, C.L.' 2 ? primary 'Feldmann, E.A.' 3 ? primary 'Bobay, B.G.' 4 ? primary 'Jung, D.K.' 5 ? primary 'Stephens, M.D.' 6 ? primary 'Melander, R.J.' 7 ? primary 'Theisen, K.E.' 8 ? primary 'Zeng, D.' 9 ? primary 'Thompson, R.J.' 10 ? primary 'Melander, C.' 11 ? primary 'Cavanagh, J.' 12 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5UIC _cell.details ? _cell.formula_units_Z ? _cell.length_a 47.737 _cell.length_a_esd ? _cell.length_b 47.737 _cell.length_b_esd ? _cell.length_c 191.789 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5UIC _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Two-component response regulator' 15786.270 2 ? ? ? ? 2 water nat water 18.015 40 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMASMTGGQQMGRDPNMRILLAEDDLHLGEGLLEALQKEGLIVNLVSDGEAAQTFIESGLYDIVVLDIGMPIKTGLEV LRNIRNRGIKVPIILLTARDGLEDRIKGLDLGADDYLTKPFELKELVARIKAISRRIDTRSGKS ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMASMTGGQQMGRDPNMRILLAEDDLHLGEGLLEALQKEGLIVNLVSDGEAAQTFIESGLYDIVVLDIGMPIKTGLEV LRNIRNRGIKVPIILLTARDGLEDRIKGLDLGADDYLTKPFELKELVARIKAISRRIDTRSGKS ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 ALA n 1 6 SER n 1 7 MET n 1 8 THR n 1 9 GLY n 1 10 GLY n 1 11 GLN n 1 12 GLN n 1 13 MET n 1 14 GLY n 1 15 ARG n 1 16 ASP n 1 17 PRO n 1 18 ASN n 1 19 MET n 1 20 ARG n 1 21 ILE n 1 22 LEU n 1 23 LEU n 1 24 ALA n 1 25 GLU n 1 26 ASP n 1 27 ASP n 1 28 LEU n 1 29 HIS n 1 30 LEU n 1 31 GLY n 1 32 GLU n 1 33 GLY n 1 34 LEU n 1 35 LEU n 1 36 GLU n 1 37 ALA n 1 38 LEU n 1 39 GLN n 1 40 LYS n 1 41 GLU n 1 42 GLY n 1 43 LEU n 1 44 ILE n 1 45 VAL n 1 46 ASN n 1 47 LEU n 1 48 VAL n 1 49 SER n 1 50 ASP n 1 51 GLY n 1 52 GLU n 1 53 ALA n 1 54 ALA n 1 55 GLN n 1 56 THR n 1 57 PHE n 1 58 ILE n 1 59 GLU n 1 60 SER n 1 61 GLY n 1 62 LEU n 1 63 TYR n 1 64 ASP n 1 65 ILE n 1 66 VAL n 1 67 VAL n 1 68 LEU n 1 69 ASP n 1 70 ILE n 1 71 GLY n 1 72 MET n 1 73 PRO n 1 74 ILE n 1 75 LYS n 1 76 THR n 1 77 GLY n 1 78 LEU n 1 79 GLU n 1 80 VAL n 1 81 LEU n 1 82 ARG n 1 83 ASN n 1 84 ILE n 1 85 ARG n 1 86 ASN n 1 87 ARG n 1 88 GLY n 1 89 ILE n 1 90 LYS n 1 91 VAL n 1 92 PRO n 1 93 ILE n 1 94 ILE n 1 95 LEU n 1 96 LEU n 1 97 THR n 1 98 ALA n 1 99 ARG n 1 100 ASP n 1 101 GLY n 1 102 LEU n 1 103 GLU n 1 104 ASP n 1 105 ARG n 1 106 ILE n 1 107 LYS n 1 108 GLY n 1 109 LEU n 1 110 ASP n 1 111 LEU n 1 112 GLY n 1 113 ALA n 1 114 ASP n 1 115 ASP n 1 116 TYR n 1 117 LEU n 1 118 THR n 1 119 LYS n 1 120 PRO n 1 121 PHE n 1 122 GLU n 1 123 LEU n 1 124 LYS n 1 125 GLU n 1 126 LEU n 1 127 VAL n 1 128 ALA n 1 129 ARG n 1 130 ILE n 1 131 LYS n 1 132 ALA n 1 133 ILE n 1 134 SER n 1 135 ARG n 1 136 ARG n 1 137 ILE n 1 138 ASP n 1 139 THR n 1 140 ARG n 1 141 SER n 1 142 GLY n 1 143 LYS n 1 144 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 144 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene FTN_1465 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain U112 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Francisella tularensis subsp. novicida (strain U112)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 401614 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0Q7W8_FRATN _struct_ref.pdbx_db_accession A0Q7W8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MRILLAEDDLHLGEGLLEALQKEGLIVNLVSDGEAAQTFIESGLYDIVVLDIGMPIKTGLEVLRNIRNRGIKVPIILLTA RDGLEDRIKGLDLGADDYLTKPFELKELVARIKAISRRIDTRSGKS ; _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5UIC A 19 ? 144 ? A0Q7W8 1 ? 126 ? 1 126 2 1 5UIC B 19 ? 144 ? A0Q7W8 1 ? 126 ? 1 126 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5UIC GLY A 1 ? UNP A0Q7W8 ? ? 'expression tag' -17 1 1 5UIC SER A 2 ? UNP A0Q7W8 ? ? 'expression tag' -16 2 1 5UIC HIS A 3 ? UNP A0Q7W8 ? ? 'expression tag' -15 3 1 5UIC MET A 4 ? UNP A0Q7W8 ? ? 'expression tag' -14 4 1 5UIC ALA A 5 ? UNP A0Q7W8 ? ? 'expression tag' -13 5 1 5UIC SER A 6 ? UNP A0Q7W8 ? ? 'expression tag' -12 6 1 5UIC MET A 7 ? UNP A0Q7W8 ? ? 'expression tag' -11 7 1 5UIC THR A 8 ? UNP A0Q7W8 ? ? 'expression tag' -10 8 1 5UIC GLY A 9 ? UNP A0Q7W8 ? ? 'expression tag' -9 9 1 5UIC GLY A 10 ? UNP A0Q7W8 ? ? 'expression tag' -8 10 1 5UIC GLN A 11 ? UNP A0Q7W8 ? ? 'expression tag' -7 11 1 5UIC GLN A 12 ? UNP A0Q7W8 ? ? 'expression tag' -6 12 1 5UIC MET A 13 ? UNP A0Q7W8 ? ? 'expression tag' -5 13 1 5UIC GLY A 14 ? UNP A0Q7W8 ? ? 'expression tag' -4 14 1 5UIC ARG A 15 ? UNP A0Q7W8 ? ? 'expression tag' -3 15 1 5UIC ASP A 16 ? UNP A0Q7W8 ? ? 'expression tag' -2 16 1 5UIC PRO A 17 ? UNP A0Q7W8 ? ? 'expression tag' -1 17 1 5UIC ASN A 18 ? UNP A0Q7W8 ? ? 'expression tag' 0 18 2 5UIC GLY B 1 ? UNP A0Q7W8 ? ? 'expression tag' -17 19 2 5UIC SER B 2 ? UNP A0Q7W8 ? ? 'expression tag' -16 20 2 5UIC HIS B 3 ? UNP A0Q7W8 ? ? 'expression tag' -15 21 2 5UIC MET B 4 ? UNP A0Q7W8 ? ? 'expression tag' -14 22 2 5UIC ALA B 5 ? UNP A0Q7W8 ? ? 'expression tag' -13 23 2 5UIC SER B 6 ? UNP A0Q7W8 ? ? 'expression tag' -12 24 2 5UIC MET B 7 ? UNP A0Q7W8 ? ? 'expression tag' -11 25 2 5UIC THR B 8 ? UNP A0Q7W8 ? ? 'expression tag' -10 26 2 5UIC GLY B 9 ? UNP A0Q7W8 ? ? 'expression tag' -9 27 2 5UIC GLY B 10 ? UNP A0Q7W8 ? ? 'expression tag' -8 28 2 5UIC GLN B 11 ? UNP A0Q7W8 ? ? 'expression tag' -7 29 2 5UIC GLN B 12 ? UNP A0Q7W8 ? ? 'expression tag' -6 30 2 5UIC MET B 13 ? UNP A0Q7W8 ? ? 'expression tag' -5 31 2 5UIC GLY B 14 ? UNP A0Q7W8 ? ? 'expression tag' -4 32 2 5UIC ARG B 15 ? UNP A0Q7W8 ? ? 'expression tag' -3 33 2 5UIC ASP B 16 ? UNP A0Q7W8 ? ? 'expression tag' -2 34 2 5UIC PRO B 17 ? UNP A0Q7W8 ? ? 'expression tag' -1 35 2 5UIC ASN B 18 ? UNP A0Q7W8 ? ? 'expression tag' 0 36 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5UIC _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.73 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 28.92 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1 M potassium citrate, 0.1 M glycine, and 0.05 M bis-tris propane (BTP) pH 7.0' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 300 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-03-03 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 22-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 22-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 55.100 _reflns.entry_id 5UIC _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.4870 _reflns.d_resolution_low 38.250 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8414 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.600 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 18.100 _reflns.pdbx_Rmerge_I_obs 0.116 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.200 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 2.811 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.120 _reflns.pdbx_Rpim_I_all 0.030 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.500 2.540 ? ? ? ? ? ? ? 99.700 ? ? ? ? 0.862 ? ? ? ? ? ? ? ? 19.600 ? 1.084 ? ? 0.885 0.198 ? 1 1 0.990 ? 2.540 2.590 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.722 ? ? ? ? ? ? ? ? 19.700 ? 1.161 ? ? 0.741 0.165 ? 2 1 0.987 ? 2.590 2.640 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.702 ? ? ? ? ? ? ? ? 19.800 ? 1.192 ? ? 0.721 0.160 ? 3 1 0.985 ? 2.640 2.690 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.560 ? ? ? ? ? ? ? ? 19.700 ? 1.235 ? ? 0.575 0.129 ? 4 1 0.991 ? 2.690 2.750 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.466 ? ? ? ? ? ? ? ? 19.800 ? 1.315 ? ? 0.479 0.108 ? 5 1 0.995 ? 2.750 2.820 ? ? ? ? ? ? ? 99.800 ? ? ? ? 0.419 ? ? ? ? ? ? ? ? 19.500 ? 1.361 ? ? 0.430 0.097 ? 6 1 0.991 ? 2.820 2.890 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.361 ? ? ? ? ? ? ? ? 19.600 ? 1.538 ? ? 0.370 0.083 ? 7 1 0.993 ? 2.890 2.960 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.272 ? ? ? ? ? ? ? ? 19.800 ? 1.783 ? ? 0.279 0.062 ? 8 1 0.994 ? 2.960 3.050 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.252 ? ? ? ? ? ? ? ? 19.100 ? 1.850 ? ? 0.259 0.059 ? 9 1 0.994 ? 3.050 3.150 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.203 ? ? ? ? ? ? ? ? 19.300 ? 2.305 ? ? 0.209 0.047 ? 10 1 0.995 ? 3.150 3.260 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.188 ? ? ? ? ? ? ? ? 19.300 ? 2.435 ? ? 0.194 0.044 ? 11 1 0.996 ? 3.260 3.390 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.157 ? ? ? ? ? ? ? ? 18.600 ? 2.873 ? ? 0.161 0.038 ? 12 1 0.997 ? 3.390 3.550 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.130 ? ? ? ? ? ? ? ? 18.500 ? 3.472 ? ? 0.134 0.031 ? 13 1 0.998 ? 3.550 3.730 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.112 ? ? ? ? ? ? ? ? 17.700 ? 3.832 ? ? 0.116 0.028 ? 14 1 0.998 ? 3.730 3.970 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.107 ? ? ? ? ? ? ? ? 17.500 ? 4.311 ? ? 0.110 0.026 ? 15 1 0.998 ? 3.970 4.270 ? ? ? ? ? ? ? 99.800 ? ? ? ? 0.095 ? ? ? ? ? ? ? ? 16.700 ? 4.773 ? ? 0.098 0.024 ? 16 1 0.998 ? 4.270 4.700 ? ? ? ? ? ? ? 99.800 ? ? ? ? 0.082 ? ? ? ? ? ? ? ? 16.400 ? 5.023 ? ? 0.085 0.022 ? 17 1 0.999 ? 4.700 5.380 ? ? ? ? ? ? ? 99.800 ? ? ? ? 0.083 ? ? ? ? ? ? ? ? 15.400 ? 5.233 ? ? 0.086 0.023 ? 18 1 0.990 ? 5.380 6.780 ? ? ? ? ? ? ? 98.700 ? ? ? ? 0.082 ? ? ? ? ? ? ? ? 15.800 ? 4.881 ? ? 0.085 0.021 ? 19 1 0.996 ? 6.780 50.000 ? ? ? ? ? ? ? 96.300 ? ? ? ? 0.070 ? ? ? ? ? ? ? ? 12.700 ? 6.790 ? ? 0.073 0.021 ? 20 1 0.996 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 167.380 _refine.B_iso_mean 71.9301 _refine.B_iso_min 30.000 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5UIC _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.4870 _refine.ls_d_res_low 38.2500 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8354 _refine.ls_number_reflns_R_free 398 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.6400 _refine.ls_percent_reflns_R_free 4.7600 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2260 _refine.ls_R_factor_R_free 0.2380 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2254 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1KGS _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.4900 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2300 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.4870 _refine_hist.d_res_low 38.2500 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 40 _refine_hist.number_atoms_total 1916 _refine_hist.pdbx_number_residues_total 241 _refine_hist.pdbx_B_iso_mean_solvent 48.78 _refine_hist.pdbx_number_atoms_protein 1876 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? 1890 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.559 ? 2545 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.043 ? 311 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 326 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 15.219 ? 737 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.4868 2.8466 2621 . 101 2520 96.0000 . . . 0.3068 0.0000 0.2867 . . . . . . 3 . . . 'X-RAY DIFFRACTION' 2.8466 3.5860 2775 . 157 2618 100.0000 . . . 0.3021 0.0000 0.2618 . . . . . . 3 . . . 'X-RAY DIFFRACTION' 3.5860 38.2544 2958 . 140 2818 100.0000 . . . 0.1972 0.0000 0.2000 . . . . . . 3 . . . # _struct.entry_id 5UIC _struct.title 'Structure of the Francisella response regulator receiver domain, QseB' _struct.pdbx_descriptor 'Two-component response regulator' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5UIC _struct_keywords.text 'Francisella, response regulator, QseB, biofilm, two component system, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 27 ? LYS A 40 ? ASP A 9 LYS A 22 1 ? 14 HELX_P HELX_P2 AA2 ASP A 50 ? GLU A 59 ? ASP A 32 GLU A 41 1 ? 10 HELX_P HELX_P3 AA3 THR A 76 ? ARG A 87 ? THR A 58 ARG A 69 1 ? 12 HELX_P HELX_P4 AA4 GLY A 101 ? LEU A 111 ? GLY A 83 LEU A 93 1 ? 11 HELX_P HELX_P5 AA5 GLU A 122 ? ARG A 136 ? GLU A 104 ARG A 118 1 ? 15 HELX_P HELX_P6 AA6 GLY B 33 ? GLU B 41 ? GLY B 15 GLU B 23 1 ? 9 HELX_P HELX_P7 AA7 ASP B 50 ? SER B 60 ? ASP B 32 SER B 42 1 ? 11 HELX_P HELX_P8 AA8 THR B 76 ? ARG B 87 ? THR B 58 ARG B 69 1 ? 12 HELX_P HELX_P9 AA9 GLY B 101 ? LEU B 111 ? GLY B 83 LEU B 93 1 ? 11 HELX_P HELX_P10 AB1 GLU B 122 ? SER B 134 ? GLU B 104 SER B 116 1 ? 13 HELX_P HELX_P11 AB2 ARG B 135 ? ILE B 137 ? ARG B 117 ILE B 119 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 119 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 101 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 120 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 102 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.98 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 44 ? VAL A 48 ? ILE A 26 VAL A 30 AA1 2 ARG A 20 ? ALA A 24 ? ARG A 2 ALA A 6 AA1 3 ILE A 65 ? ASP A 69 ? ILE A 47 ASP A 51 AA1 4 ILE A 93 ? THR A 97 ? ILE A 75 THR A 79 AA1 5 ASP A 115 ? THR A 118 ? ASP A 97 THR A 100 AA2 1 LEU B 43 ? VAL B 48 ? LEU B 25 VAL B 30 AA2 2 MET B 19 ? ALA B 24 ? MET B 1 ALA B 6 AA2 3 ILE B 65 ? ASP B 69 ? ILE B 47 ASP B 51 AA2 4 ILE B 93 ? LEU B 96 ? ILE B 75 LEU B 78 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O VAL A 48 ? O VAL A 30 N LEU A 23 ? N LEU A 5 AA1 2 3 N LEU A 22 ? N LEU A 4 O VAL A 67 ? O VAL A 49 AA1 3 4 N LEU A 68 ? N LEU A 50 O ILE A 94 ? O ILE A 76 AA1 4 5 N LEU A 95 ? N LEU A 77 O LEU A 117 ? O LEU A 99 AA2 1 2 O ILE B 44 ? O ILE B 26 N ILE B 21 ? N ILE B 3 AA2 2 3 N LEU B 22 ? N LEU B 4 O VAL B 67 ? O VAL B 49 AA2 3 4 N LEU B 68 ? N LEU B 50 O ILE B 94 ? O ILE B 76 # _atom_sites.entry_id 5UIC _atom_sites.fract_transf_matrix[1][1] 0.020948 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020948 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005214 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -17 ? ? ? A . n A 1 2 SER 2 -16 ? ? ? A . n A 1 3 HIS 3 -15 ? ? ? A . n A 1 4 MET 4 -14 ? ? ? A . n A 1 5 ALA 5 -13 ? ? ? A . n A 1 6 SER 6 -12 ? ? ? A . n A 1 7 MET 7 -11 ? ? ? A . n A 1 8 THR 8 -10 ? ? ? A . n A 1 9 GLY 9 -9 ? ? ? A . n A 1 10 GLY 10 -8 ? ? ? A . n A 1 11 GLN 11 -7 ? ? ? A . n A 1 12 GLN 12 -6 ? ? ? A . n A 1 13 MET 13 -5 ? ? ? A . n A 1 14 GLY 14 -4 ? ? ? A . n A 1 15 ARG 15 -3 ? ? ? A . n A 1 16 ASP 16 -2 ? ? ? A . n A 1 17 PRO 17 -1 ? ? ? A . n A 1 18 ASN 18 0 0 ASN ASN A . n A 1 19 MET 19 1 1 MET MET A . n A 1 20 ARG 20 2 2 ARG ARG A . n A 1 21 ILE 21 3 3 ILE ILE A . n A 1 22 LEU 22 4 4 LEU LEU A . n A 1 23 LEU 23 5 5 LEU LEU A . n A 1 24 ALA 24 6 6 ALA ALA A . n A 1 25 GLU 25 7 7 GLU GLU A . n A 1 26 ASP 26 8 8 ASP ASP A . n A 1 27 ASP 27 9 9 ASP ASP A . n A 1 28 LEU 28 10 10 LEU LEU A . n A 1 29 HIS 29 11 11 HIS HIS A . n A 1 30 LEU 30 12 12 LEU LEU A . n A 1 31 GLY 31 13 13 GLY GLY A . n A 1 32 GLU 32 14 14 GLU GLU A . n A 1 33 GLY 33 15 15 GLY GLY A . n A 1 34 LEU 34 16 16 LEU LEU A . n A 1 35 LEU 35 17 17 LEU LEU A . n A 1 36 GLU 36 18 18 GLU GLU A . n A 1 37 ALA 37 19 19 ALA ALA A . n A 1 38 LEU 38 20 20 LEU LEU A . n A 1 39 GLN 39 21 21 GLN GLN A . n A 1 40 LYS 40 22 22 LYS LYS A . n A 1 41 GLU 41 23 23 GLU GLU A . n A 1 42 GLY 42 24 24 GLY GLY A . n A 1 43 LEU 43 25 25 LEU LEU A . n A 1 44 ILE 44 26 26 ILE ILE A . n A 1 45 VAL 45 27 27 VAL VAL A . n A 1 46 ASN 46 28 28 ASN ASN A . n A 1 47 LEU 47 29 29 LEU LEU A . n A 1 48 VAL 48 30 30 VAL VAL A . n A 1 49 SER 49 31 31 SER SER A . n A 1 50 ASP 50 32 32 ASP ASP A . n A 1 51 GLY 51 33 33 GLY GLY A . n A 1 52 GLU 52 34 34 GLU GLU A . n A 1 53 ALA 53 35 35 ALA ALA A . n A 1 54 ALA 54 36 36 ALA ALA A . n A 1 55 GLN 55 37 37 GLN GLN A . n A 1 56 THR 56 38 38 THR THR A . n A 1 57 PHE 57 39 39 PHE PHE A . n A 1 58 ILE 58 40 40 ILE ILE A . n A 1 59 GLU 59 41 41 GLU GLU A . n A 1 60 SER 60 42 42 SER SER A . n A 1 61 GLY 61 43 43 GLY GLY A . n A 1 62 LEU 62 44 44 LEU LEU A . n A 1 63 TYR 63 45 45 TYR TYR A . n A 1 64 ASP 64 46 46 ASP ASP A . n A 1 65 ILE 65 47 47 ILE ILE A . n A 1 66 VAL 66 48 48 VAL VAL A . n A 1 67 VAL 67 49 49 VAL VAL A . n A 1 68 LEU 68 50 50 LEU LEU A . n A 1 69 ASP 69 51 51 ASP ASP A . n A 1 70 ILE 70 52 52 ILE ILE A . n A 1 71 GLY 71 53 53 GLY GLY A . n A 1 72 MET 72 54 54 MET MET A . n A 1 73 PRO 73 55 55 PRO PRO A . n A 1 74 ILE 74 56 56 ILE ILE A . n A 1 75 LYS 75 57 57 LYS LYS A . n A 1 76 THR 76 58 58 THR THR A . n A 1 77 GLY 77 59 59 GLY GLY A . n A 1 78 LEU 78 60 60 LEU LEU A . n A 1 79 GLU 79 61 61 GLU GLU A . n A 1 80 VAL 80 62 62 VAL VAL A . n A 1 81 LEU 81 63 63 LEU LEU A . n A 1 82 ARG 82 64 64 ARG ARG A . n A 1 83 ASN 83 65 65 ASN ASN A . n A 1 84 ILE 84 66 66 ILE ILE A . n A 1 85 ARG 85 67 67 ARG ARG A . n A 1 86 ASN 86 68 68 ASN ASN A . n A 1 87 ARG 87 69 69 ARG ARG A . n A 1 88 GLY 88 70 70 GLY GLY A . n A 1 89 ILE 89 71 71 ILE ILE A . n A 1 90 LYS 90 72 72 LYS LYS A . n A 1 91 VAL 91 73 73 VAL VAL A . n A 1 92 PRO 92 74 74 PRO PRO A . n A 1 93 ILE 93 75 75 ILE ILE A . n A 1 94 ILE 94 76 76 ILE ILE A . n A 1 95 LEU 95 77 77 LEU LEU A . n A 1 96 LEU 96 78 78 LEU LEU A . n A 1 97 THR 97 79 79 THR THR A . n A 1 98 ALA 98 80 80 ALA ALA A . n A 1 99 ARG 99 81 81 ARG ARG A . n A 1 100 ASP 100 82 82 ASP ASP A . n A 1 101 GLY 101 83 83 GLY GLY A . n A 1 102 LEU 102 84 84 LEU LEU A . n A 1 103 GLU 103 85 85 GLU GLU A . n A 1 104 ASP 104 86 86 ASP ASP A . n A 1 105 ARG 105 87 87 ARG ARG A . n A 1 106 ILE 106 88 88 ILE ILE A . n A 1 107 LYS 107 89 89 LYS LYS A . n A 1 108 GLY 108 90 90 GLY GLY A . n A 1 109 LEU 109 91 91 LEU LEU A . n A 1 110 ASP 110 92 92 ASP ASP A . n A 1 111 LEU 111 93 93 LEU LEU A . n A 1 112 GLY 112 94 94 GLY GLY A . n A 1 113 ALA 113 95 95 ALA ALA A . n A 1 114 ASP 114 96 96 ASP ASP A . n A 1 115 ASP 115 97 97 ASP ASP A . n A 1 116 TYR 116 98 98 TYR TYR A . n A 1 117 LEU 117 99 99 LEU LEU A . n A 1 118 THR 118 100 100 THR THR A . n A 1 119 LYS 119 101 101 LYS LYS A . n A 1 120 PRO 120 102 102 PRO PRO A . n A 1 121 PHE 121 103 103 PHE PHE A . n A 1 122 GLU 122 104 104 GLU GLU A . n A 1 123 LEU 123 105 105 LEU LEU A . n A 1 124 LYS 124 106 106 LYS LYS A . n A 1 125 GLU 125 107 107 GLU GLU A . n A 1 126 LEU 126 108 108 LEU LEU A . n A 1 127 VAL 127 109 109 VAL VAL A . n A 1 128 ALA 128 110 110 ALA ALA A . n A 1 129 ARG 129 111 111 ARG ARG A . n A 1 130 ILE 130 112 112 ILE ILE A . n A 1 131 LYS 131 113 113 LYS LYS A . n A 1 132 ALA 132 114 114 ALA ALA A . n A 1 133 ILE 133 115 115 ILE ILE A . n A 1 134 SER 134 116 116 SER SER A . n A 1 135 ARG 135 117 117 ARG ARG A . n A 1 136 ARG 136 118 118 ARG ARG A . n A 1 137 ILE 137 119 119 ILE ILE A . n A 1 138 ASP 138 120 ? ? ? A . n A 1 139 THR 139 121 ? ? ? A . n A 1 140 ARG 140 122 ? ? ? A . n A 1 141 SER 141 123 ? ? ? A . n A 1 142 GLY 142 124 ? ? ? A . n A 1 143 LYS 143 125 ? ? ? A . n A 1 144 SER 144 126 ? ? ? A . n B 1 1 GLY 1 -17 ? ? ? B . n B 1 2 SER 2 -16 ? ? ? B . n B 1 3 HIS 3 -15 ? ? ? B . n B 1 4 MET 4 -14 ? ? ? B . n B 1 5 ALA 5 -13 ? ? ? B . n B 1 6 SER 6 -12 ? ? ? B . n B 1 7 MET 7 -11 ? ? ? B . n B 1 8 THR 8 -10 ? ? ? B . n B 1 9 GLY 9 -9 ? ? ? B . n B 1 10 GLY 10 -8 ? ? ? B . n B 1 11 GLN 11 -7 ? ? ? B . n B 1 12 GLN 12 -6 ? ? ? B . n B 1 13 MET 13 -5 ? ? ? B . n B 1 14 GLY 14 -4 ? ? ? B . n B 1 15 ARG 15 -3 ? ? ? B . n B 1 16 ASP 16 -2 ? ? ? B . n B 1 17 PRO 17 -1 ? ? ? B . n B 1 18 ASN 18 0 0 ASN ASN B . n B 1 19 MET 19 1 1 MET MET B . n B 1 20 ARG 20 2 2 ARG ARG B . n B 1 21 ILE 21 3 3 ILE ILE B . n B 1 22 LEU 22 4 4 LEU LEU B . n B 1 23 LEU 23 5 5 LEU LEU B . n B 1 24 ALA 24 6 6 ALA ALA B . n B 1 25 GLU 25 7 7 GLU GLU B . n B 1 26 ASP 26 8 8 ASP ASP B . n B 1 27 ASP 27 9 9 ASP ASP B . n B 1 28 LEU 28 10 10 LEU LEU B . n B 1 29 HIS 29 11 11 HIS HIS B . n B 1 30 LEU 30 12 12 LEU LEU B . n B 1 31 GLY 31 13 13 GLY GLY B . n B 1 32 GLU 32 14 14 GLU GLU B . n B 1 33 GLY 33 15 15 GLY GLY B . n B 1 34 LEU 34 16 16 LEU LEU B . n B 1 35 LEU 35 17 17 LEU LEU B . n B 1 36 GLU 36 18 18 GLU GLU B . n B 1 37 ALA 37 19 19 ALA ALA B . n B 1 38 LEU 38 20 20 LEU LEU B . n B 1 39 GLN 39 21 21 GLN GLN B . n B 1 40 LYS 40 22 22 LYS LYS B . n B 1 41 GLU 41 23 23 GLU GLU B . n B 1 42 GLY 42 24 24 GLY GLY B . n B 1 43 LEU 43 25 25 LEU LEU B . n B 1 44 ILE 44 26 26 ILE ILE B . n B 1 45 VAL 45 27 27 VAL VAL B . n B 1 46 ASN 46 28 28 ASN ASN B . n B 1 47 LEU 47 29 29 LEU LEU B . n B 1 48 VAL 48 30 30 VAL VAL B . n B 1 49 SER 49 31 31 SER SER B . n B 1 50 ASP 50 32 32 ASP ASP B . n B 1 51 GLY 51 33 33 GLY GLY B . n B 1 52 GLU 52 34 34 GLU GLU B . n B 1 53 ALA 53 35 35 ALA ALA B . n B 1 54 ALA 54 36 36 ALA ALA B . n B 1 55 GLN 55 37 37 GLN GLN B . n B 1 56 THR 56 38 38 THR THR B . n B 1 57 PHE 57 39 39 PHE PHE B . n B 1 58 ILE 58 40 40 ILE ILE B . n B 1 59 GLU 59 41 41 GLU GLU B . n B 1 60 SER 60 42 42 SER SER B . n B 1 61 GLY 61 43 43 GLY GLY B . n B 1 62 LEU 62 44 44 LEU LEU B . n B 1 63 TYR 63 45 45 TYR TYR B . n B 1 64 ASP 64 46 46 ASP ASP B . n B 1 65 ILE 65 47 47 ILE ILE B . n B 1 66 VAL 66 48 48 VAL VAL B . n B 1 67 VAL 67 49 49 VAL VAL B . n B 1 68 LEU 68 50 50 LEU LEU B . n B 1 69 ASP 69 51 51 ASP ASP B . n B 1 70 ILE 70 52 52 ILE ILE B . n B 1 71 GLY 71 53 53 GLY GLY B . n B 1 72 MET 72 54 54 MET MET B . n B 1 73 PRO 73 55 55 PRO PRO B . n B 1 74 ILE 74 56 56 ILE ILE B . n B 1 75 LYS 75 57 57 LYS LYS B . n B 1 76 THR 76 58 58 THR THR B . n B 1 77 GLY 77 59 59 GLY GLY B . n B 1 78 LEU 78 60 60 LEU LEU B . n B 1 79 GLU 79 61 61 GLU GLU B . n B 1 80 VAL 80 62 62 VAL VAL B . n B 1 81 LEU 81 63 63 LEU LEU B . n B 1 82 ARG 82 64 64 ARG ARG B . n B 1 83 ASN 83 65 65 ASN ASN B . n B 1 84 ILE 84 66 66 ILE ILE B . n B 1 85 ARG 85 67 67 ARG ARG B . n B 1 86 ASN 86 68 68 ASN ASN B . n B 1 87 ARG 87 69 69 ARG ARG B . n B 1 88 GLY 88 70 70 GLY GLY B . n B 1 89 ILE 89 71 71 ILE ILE B . n B 1 90 LYS 90 72 72 LYS LYS B . n B 1 91 VAL 91 73 73 VAL VAL B . n B 1 92 PRO 92 74 74 PRO PRO B . n B 1 93 ILE 93 75 75 ILE ILE B . n B 1 94 ILE 94 76 76 ILE ILE B . n B 1 95 LEU 95 77 77 LEU LEU B . n B 1 96 LEU 96 78 78 LEU LEU B . n B 1 97 THR 97 79 79 THR THR B . n B 1 98 ALA 98 80 80 ALA ALA B . n B 1 99 ARG 99 81 81 ARG ARG B . n B 1 100 ASP 100 82 82 ASP ASP B . n B 1 101 GLY 101 83 83 GLY GLY B . n B 1 102 LEU 102 84 84 LEU LEU B . n B 1 103 GLU 103 85 85 GLU GLU B . n B 1 104 ASP 104 86 86 ASP ASP B . n B 1 105 ARG 105 87 87 ARG ARG B . n B 1 106 ILE 106 88 88 ILE ILE B . n B 1 107 LYS 107 89 89 LYS LYS B . n B 1 108 GLY 108 90 90 GLY GLY B . n B 1 109 LEU 109 91 91 LEU LEU B . n B 1 110 ASP 110 92 92 ASP ASP B . n B 1 111 LEU 111 93 93 LEU LEU B . n B 1 112 GLY 112 94 94 GLY GLY B . n B 1 113 ALA 113 95 95 ALA ALA B . n B 1 114 ASP 114 96 96 ASP ASP B . n B 1 115 ASP 115 97 97 ASP ASP B . n B 1 116 TYR 116 98 98 TYR TYR B . n B 1 117 LEU 117 99 99 LEU LEU B . n B 1 118 THR 118 100 100 THR THR B . n B 1 119 LYS 119 101 101 LYS LYS B . n B 1 120 PRO 120 102 102 PRO PRO B . n B 1 121 PHE 121 103 103 PHE PHE B . n B 1 122 GLU 122 104 104 GLU GLU B . n B 1 123 LEU 123 105 105 LEU LEU B . n B 1 124 LYS 124 106 106 LYS LYS B . n B 1 125 GLU 125 107 107 GLU GLU B . n B 1 126 LEU 126 108 108 LEU LEU B . n B 1 127 VAL 127 109 109 VAL VAL B . n B 1 128 ALA 128 110 110 ALA ALA B . n B 1 129 ARG 129 111 111 ARG ARG B . n B 1 130 ILE 130 112 112 ILE ILE B . n B 1 131 LYS 131 113 113 LYS LYS B . n B 1 132 ALA 132 114 114 ALA ALA B . n B 1 133 ILE 133 115 115 ILE ILE B . n B 1 134 SER 134 116 116 SER SER B . n B 1 135 ARG 135 117 117 ARG ARG B . n B 1 136 ARG 136 118 118 ARG ARG B . n B 1 137 ILE 137 119 119 ILE ILE B . n B 1 138 ASP 138 120 120 ASP ASP B . n B 1 139 THR 139 121 ? ? ? B . n B 1 140 ARG 140 122 ? ? ? B . n B 1 141 SER 141 123 ? ? ? B . n B 1 142 GLY 142 124 ? ? ? B . n B 1 143 LYS 143 125 ? ? ? B . n B 1 144 SER 144 126 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 HOH 1 201 19 HOH HOH A . C 2 HOH 2 202 5 HOH HOH A . C 2 HOH 3 203 12 HOH HOH A . C 2 HOH 4 204 2 HOH HOH A . C 2 HOH 5 205 23 HOH HOH A . C 2 HOH 6 206 1 HOH HOH A . C 2 HOH 7 207 11 HOH HOH A . C 2 HOH 8 208 30 HOH HOH A . C 2 HOH 9 209 7 HOH HOH A . C 2 HOH 10 210 18 HOH HOH A . C 2 HOH 11 211 10 HOH HOH A . C 2 HOH 12 212 3 HOH HOH A . C 2 HOH 13 213 22 HOH HOH A . C 2 HOH 14 214 17 HOH HOH A . C 2 HOH 15 215 15 HOH HOH A . C 2 HOH 16 216 8 HOH HOH A . C 2 HOH 17 217 13 HOH HOH A . C 2 HOH 18 218 29 HOH HOH A . C 2 HOH 19 219 21 HOH HOH A . D 2 HOH 1 201 31 HOH HOH B . D 2 HOH 2 202 6 HOH HOH B . D 2 HOH 3 203 34 HOH HOH B . D 2 HOH 4 204 9 HOH HOH B . D 2 HOH 5 205 33 HOH HOH B . D 2 HOH 6 206 27 HOH HOH B . D 2 HOH 7 207 40 HOH HOH B . D 2 HOH 8 208 25 HOH HOH B . D 2 HOH 9 209 37 HOH HOH B . D 2 HOH 10 210 14 HOH HOH B . D 2 HOH 11 211 35 HOH HOH B . D 2 HOH 12 212 28 HOH HOH B . D 2 HOH 13 213 39 HOH HOH B . D 2 HOH 14 214 4 HOH HOH B . D 2 HOH 15 215 26 HOH HOH B . D 2 HOH 16 216 38 HOH HOH B . D 2 HOH 17 217 36 HOH HOH B . D 2 HOH 18 218 32 HOH HOH B . D 2 HOH 19 219 16 HOH HOH B . D 2 HOH 20 220 24 HOH HOH B . D 2 HOH 21 221 20 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,C 1 2 B,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1820 ? 1 MORE -10 ? 1 'SSA (A^2)' 11770 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_554 y+1/2,-x+1/2,z-1/4 0.0000000000 1.0000000000 0.0000000000 23.8685000000 -1.0000000000 0.0000000000 0.0000000000 23.8685000000 0.0000000000 0.0000000000 1.0000000000 -47.9472500000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-08-16 2 'Structure model' 1 1 2017-08-23 3 'Structure model' 1 2 2017-09-13 4 'Structure model' 1 3 2017-10-18 5 'Structure model' 1 4 2020-01-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 3 'Structure model' 'Author supporting evidence' 3 4 'Structure model' 'Database references' 4 5 'Structure model' 'Author supporting evidence' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' diffrn_detector 2 3 'Structure model' pdbx_audit_support 3 4 'Structure model' citation 4 4 'Structure model' citation_author 5 5 'Structure model' pdbx_audit_support # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_diffrn_detector.type' 2 3 'Structure model' '_pdbx_audit_support.funding_organization' 3 4 'Structure model' '_citation.journal_volume' 4 4 'Structure model' '_citation.page_first' 5 4 'Structure model' '_citation.page_last' 6 4 'Structure model' '_citation_author.name' 7 5 'Structure model' '_pdbx_audit_support.funding_organization' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.11.1_2575 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 B _pdbx_validate_close_contact.auth_comp_id_1 PHE _pdbx_validate_close_contact.auth_seq_id_1 39 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HG _pdbx_validate_close_contact.auth_asym_id_2 B _pdbx_validate_close_contact.auth_comp_id_2 SER _pdbx_validate_close_contact.auth_seq_id_2 42 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.57 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 219 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 B _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 221 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 5_555 _pdbx_validate_symm_contact.dist 2.18 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 31 ? ? -142.80 12.56 2 1 ILE A 56 ? ? 73.47 -84.10 3 1 ASP A 82 ? ? -87.90 32.37 4 1 ILE B 56 ? ? 67.50 -88.07 5 1 THR B 79 ? ? -98.95 -112.63 6 1 LEU B 99 ? ? -174.22 112.14 7 1 PRO B 102 ? ? -69.71 79.84 8 1 ILE B 119 ? ? -167.01 -165.56 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -17 ? A GLY 1 2 1 Y 1 A SER -16 ? A SER 2 3 1 Y 1 A HIS -15 ? A HIS 3 4 1 Y 1 A MET -14 ? A MET 4 5 1 Y 1 A ALA -13 ? A ALA 5 6 1 Y 1 A SER -12 ? A SER 6 7 1 Y 1 A MET -11 ? A MET 7 8 1 Y 1 A THR -10 ? A THR 8 9 1 Y 1 A GLY -9 ? A GLY 9 10 1 Y 1 A GLY -8 ? A GLY 10 11 1 Y 1 A GLN -7 ? A GLN 11 12 1 Y 1 A GLN -6 ? A GLN 12 13 1 Y 1 A MET -5 ? A MET 13 14 1 Y 1 A GLY -4 ? A GLY 14 15 1 Y 1 A ARG -3 ? A ARG 15 16 1 Y 1 A ASP -2 ? A ASP 16 17 1 Y 1 A PRO -1 ? A PRO 17 18 1 Y 1 A ASP 120 ? A ASP 138 19 1 Y 1 A THR 121 ? A THR 139 20 1 Y 1 A ARG 122 ? A ARG 140 21 1 Y 1 A SER 123 ? A SER 141 22 1 Y 1 A GLY 124 ? A GLY 142 23 1 Y 1 A LYS 125 ? A LYS 143 24 1 Y 1 A SER 126 ? A SER 144 25 1 Y 1 B GLY -17 ? B GLY 1 26 1 Y 1 B SER -16 ? B SER 2 27 1 Y 1 B HIS -15 ? B HIS 3 28 1 Y 1 B MET -14 ? B MET 4 29 1 Y 1 B ALA -13 ? B ALA 5 30 1 Y 1 B SER -12 ? B SER 6 31 1 Y 1 B MET -11 ? B MET 7 32 1 Y 1 B THR -10 ? B THR 8 33 1 Y 1 B GLY -9 ? B GLY 9 34 1 Y 1 B GLY -8 ? B GLY 10 35 1 Y 1 B GLN -7 ? B GLN 11 36 1 Y 1 B GLN -6 ? B GLN 12 37 1 Y 1 B MET -5 ? B MET 13 38 1 Y 1 B GLY -4 ? B GLY 14 39 1 Y 1 B ARG -3 ? B ARG 15 40 1 Y 1 B ASP -2 ? B ASP 16 41 1 Y 1 B PRO -1 ? B PRO 17 42 1 Y 1 B THR 121 ? B THR 139 43 1 Y 1 B ARG 122 ? B ARG 140 44 1 Y 1 B SER 123 ? B SER 141 45 1 Y 1 B GLY 124 ? B GLY 142 46 1 Y 1 B LYS 125 ? B LYS 143 47 1 Y 1 B SER 126 ? B SER 144 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 'RO1 GM55769' 1 'Department of Health & Human Services (HHS)' 'United States' HHSN272201500010C 2 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #